Prothioconazole methyltransferase gene pmt80 from mycobacterium and use thereof
Patent Information
- Application Number
- CN202611079272.4
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- Filing Date
- 2026-07-20
- Publication Date
- 2026-08-28
AI Technical Summary
然而,随着其在农业生产中广泛使用,近年来也发现其残留易造成环境污染并具有手性选择性毒性
[0017]This invention identified the methyltransferase gene pmt80, which is effective in degrading prothioconazole, and its recombinant expression, resulting in the enzyme pmt80 with a catalytic efficiency of 3.4 × 10⁻⁶ for (R)-PTC. -3 min -1 μM -1 The optimal temperature for this enzyme to catalyze (R)-PTC is 37 °C, and the reaction conditions are mild. At the same time, the pmt80 of this invention can catalyze the degradation of PTC and PTC analogues 4-ethyl-5-phenyl-4H-[1,2,4]triazole-3-thiol, which has good industrial application potential in environmental pollution control.
Smart Images

Figure CN122648451A_ABST
Abstract
Description
Technical Field
[0001] This invention belongs to the field of environmental biotechnology, and in particular, it relates to the pmt80 gene of prothioconazole methyltransferase from mycobacteria and its application. Background Technology
[0002] Prothioconazole (PTC) is a chiral triazole fungicide with CAS Registry Number 178928-70-6 and molecular formula C. 14 H 15Cl2N3OS has a relative molecular mass of 344.26. Prothioconazole belongs to the sterol demethylation inhibitor (DMI) class and is classified as subgroup G1 by the International Fungicide Resistance Action Committee (FRAC). Its mechanism of action is to inhibit the demethylation of lanosterol or 2,4-methylenedihydrolanosterol, precursors of sterols in fungi, at the 14-position, thereby blocking ergosterol synthesis and disrupting the integrity of the fungal cell membrane. After application to plants, prothioconazole is metabolized into its bioactive form, dethioconazole-desthio, which inhibits the C14-demethylation process with greater activity. This agent not only has excellent systemic activity but also possesses superior protective, curative, and eradicative activities, with a long residual effect. Prothioconazole has a broad fungicidal spectrum, showing excellent control effects against almost all fungal diseases on cereals, including powdery mildew, Fusarium head blight, sheath blight, and rust. It can also effectively control soil-borne diseases and major foliar diseases of rapeseed and peanuts, such as gray mold, brown spot, black spot, and black shank. Its application crops include wheat, soybeans, rapeseed, rice, peanuts, sugar beets, corn, and cotton. In terms of formulation, prothioconazole can be made into various forms such as suspension concentrates, oil-dispersible suspensions, water-dispersible granules, and emulsifiable concentrates, which can be used for foliar spraying or seed treatment. However, with its widespread use in agricultural production, it has been found in recent years that its residues can easily cause environmental pollution and exhibit chiral selective toxicity. The European Food Safety Authority (EFSA) has confirmed the potential acute risks of prothioconazole and has set maximum residue limits (MRLs) of 0.02-0.1 mg / kg for crops such as corn, sugar beets, potatoes, and peanuts. Canada has set an MRL of 0.2 mg / kg for prothioconazole in sunflowers. Therefore, the degradation treatment of prothioconazole is an important research direction. Jia Ye et al. disclosed (“Enantioselective Metabolism of Chiral Fungicide Prothioconazole by Mycobacterium sp. Y-3 and Its Bioaugmentation”, Journal of Agricultural and Food Chemistry, DOI: 10.1021 / acs.jafc.5c02382) a Mycobacterium Y-3 strain capable of degrading prothioconazole. This strain preferentially metabolizes (R)-prothioconazole via methylation, with a degradation rate 2.5 times that of (S)-prothioconazole. At 37°C and pH 5.0, the half-lives (T1 / 2) of strain Y-3 for 20–80 μM (Rac)-, (S)-, and (R)-prothioconazole were 4.1–7.1 hours, respectively.However, in order to further improve enzymatic methods and obtain strains with stronger degradation capabilities, it is necessary to conduct further research and exploration on methylation-related genes and enzymes in the process of strains degrading prothioconazole. Summary of the Invention
[0003] To address the related problems in the prior art, this invention, through further in-depth research, discovered a prothioconazole methyltransferase gene pmt80 from Mycobacterium sp. Y-3, laying the foundation for enzymatic degradation of prothioconazole, construction of recombinant prothioconazole-degrading bacteria, and mutation screening to obtain stronger prothioconazole-degrading bacteria, thus completing this invention.
[0004] The technical solution of the present invention is as follows:
[0005] In one aspect, the present invention discloses a prothioconazole methyltransferase gene pmt80, the nucleotide sequence of which is shown in SEQ ID NO.1.
[0006] TTACGCGGGTGTGCAGACAACGGCCAGCGCGTCGTTGACCGCGTCGACCCCGTCACCGCCGAGCCGCTCGGCGAGGCGGCCGCGCAGCTCATCGCGGGCCGACGCGGTGAGGGTCAGGTGGTTGGAATACGTGAACACCAGATTCAGCCAGTCCTCGGTGGTGTAGTGCAACTGCTCGACGACACTGCGGGTATCCACGGTGAAGCCACCGTCTTCGATGAGCGCGGTCACCTCCGCCAGGCGGGTGGCGTCGACGATCGAACTCCGGGCCTCACCGAGATAGTCGCCGTAGATGTCGTCCATGTCGGCCCACGTCGGTGACTTCGGCACGATCCGGTTGGACAACAGCACGAGCCGCCCACCGGGATTGAGGATGCCGCGCACCTTGGTCAGCGCGGGCCGGGGCTGGACCCAGTGAAACGACTGGGCGAACACCACCAAGTCGAACGTCCGGGCCTCCGGCTGCCAGTCCTCGAACGTGGCGAGCTCGGCGGTAACCCCTTTGGCGGCGGCGACGGCGGCCATGCGTTGATCGGGCTCGACGGCGAGAACCGTCGCGCCGGCCTGCATCAACTGGACCGATGAAATGCCGGTGCCCGCACCGACATCCAGTGTCGCCAGCCCGGGAGCGGTGATCAGATCGGCGATGAGTGCCTGCGGATACCGTGGCCGGTACCGATCGTAATCGTCGGACGCCGCGCCGAATGATTCGGCCCGCCTGCGGTCAGCGTGCAGTTCCTCCAT
[0007] In one aspect of the present invention, the present invention discloses a prothioconazole methyltransferase pmt80, the amino acid sequence of which is shown as SEQ ID NO.2.
[0008] MEELHADRRRAESFGAASDDYDRYRPRYPQALIADLITAPGLATLDVGAGTGISSVQLMQAGATVLAVEPDQRMAAVAAAKGVTAELATFEDWQPEARTFDLVVFAQSFHWVQPRPALTKVRGI LNPGGRLVLLSNRIVPKSPTWADMDDIYGDYLGEARSSIVDATRLAEVTALIEDGGFTVDTRSVVEQLHYTTEDWLNLVFTYSNHLTLTASARDELRGRLAERLGGDGVDAVNDALAVVCTPA*
[0009] In one aspect, the present invention discloses an expression vector containing the prothioconazole methyltransferase gene pmt80. The expression vector can be a prokaryotic expression vector or a eukaryotic expression vector; preferably, the expression vector is a prokaryotic expression vector.
[0010] In one aspect, the present invention discloses a recombinant strain containing an expression vector containing the prothioconazole methyltransferase gene pmt80.
[0011] In one embodiment, the strain is Escherichia coli.
[0012] In one aspect, the present invention discloses the application of strains containing the prothioconazole methyltransferase pmt80 gene expression vector in the degradation of prothioconazole.
[0013] In one aspect, the present invention discloses the application of prothioconazole methyltransferase pmt80 in the degradation of prothioconazole and its analogues.
[0014] In one embodiment, the prothioconazole is R-prothioconazole or S-prothioconazole; the analogue is 4-ethyl-5-phenyl-4H-[1,2,4]triazole-3-thiol.
[0015] In one aspect, the present invention also discloses a formulation for degrading prothioconazole, wherein the formulation contains a strain expressing the prothioconazole methyltransferase gene pmt80 gene; or the formulation contains prothioconazole methyltransferase pmt80.
[0016] In one aspect, the present invention also discloses an immobilized enzyme preparation, wherein the immobilized enzyme in the immobilized enzyme preparation is prothioconazole methyltransferase PMT80. Beneficial effects
[0017] This invention identified the methyltransferase gene pmt80, which is effective in degrading prothioconazole, and its recombinant expression, resulting in the enzyme pmt80 with a catalytic efficiency of 3.4 × 10⁻⁶ for (R)-PTC. -3 min -1 μM -1 The optimal temperature for this enzyme to catalyze (R)-PTC is 37 °C, and the reaction conditions are mild. At the same time, the pmt80 of this invention can catalyze the degradation of PTC and PTC analogues 4-ethyl-5-phenyl-4H-[1,2,4]triazole-3-thiol, which has good industrial application potential in environmental pollution control. Attached Figure Description
[0018] Figure 1 Electrophoresis image of PCR amplification of the target gene pmt80, where M is the marker and 5 is the pmt80 gene.
[0019] Figure 2 E. coil BL21 (DE3) (pET-pmt80) PTC liquid phase diagram.
[0020] Figure 3 SDS-PAGE gel image of the fusion protein His-pmt80, where M is the protein marker; 1 is the crude pmt80 protein, and 2 is the purified pmt80 protein.
[0021] Figure 4 : PMT80's ability to convert PTC.
[0022] Figure 5 The products generated by pmt80 catalyzing PTC were detected by HPLC and UPLC-Q-TOF-MS. A is the HPLC chromatogram of pmt80 converting (Rac)-PTC; B is the mass spectrum.
[0023] Figure 6 Enzyme kinetic curves of pmt80 catalyzing the conversion of (R)-PTC and (S)-PTC.
[0024] Figure 7 The effect of temperature on the activity of pmt80 enzyme.
[0025] Figure 8 The effect of pH on the activity of pmt80 enzyme.
[0026] Figure 9 The effects of metal ions and chemical reagents on the activity of pmt80 enzyme. Detailed Implementation
[0027] To make the objectives, technical solutions, and advantages of this invention clearer, the invention will be further described in detail below with reference to embodiments. Unless otherwise specified, the equipment and reagents used in the embodiments and experimental examples are commercially available. Unless otherwise stated, all reagents used in this invention are analytical grade reagents. The specific embodiments described herein are for illustrative purposes only and are not intended to limit the invention.
[0028] Example 1: Cloning, expression, and purification of the prothioconazole methyltransferase gene
[0029] 1.1 PCR amplification of methyltransferase candidate genes
[0030] Using Mycobacterium sp. Y-3 as a template, the target gene pmt80 was amplified by PCR using pre-designed primers. After separation by agarose gel electrophoresis, a single gel band containing the target DNA fragment was rapidly excised under UV light. The target fragment was purified using the FastPure® Gel DNA Extraction Mini Kit. The gene sequence of pmt80 is shown in SEQ ID No. 1, and the amino acid sequence is shown in SEQ ID No. 2.
[0031] 1.2 Construction of heterologous expression vector for methyltransferase
[0032] The homologous recombination seamless cloning kit ligated the amplified pmt80 gene with the linearized expression vector pET28a (+) to obtain the exogenous recombinant expression vector pET28a-pmt80. The recombinant vector was transformed into E. coli BL21(DE3). After the reaction, plasmids were extracted, and PCR detection was performed. The bacterial culture corresponding to a single PCR product with the same size as the target band was sent to Anhui General Biotechnology Co., Ltd. for sequencing. The successfully constructed and correctly expressed strain E. coli BL21(DE3) was mixed with sterilized 30% glycerol at a 1:1 ratio and stored at -80 ℃ for later use.
[0033] 1.3 Test of the transformation ability of recombinant strains to prothioconazole (PTC)
[0034] The successfully constructed recombinant plasmids were inoculated into 30 mL LB medium containing 50 mg / L Km and cultured at 37 ℃ with shaking at 150 r / min until the OD600 reached 0.6. Then, 0.1 mM IPTG and 40 mg / L (Rac)-PTC were added to the medium, and the culture was further induced for 24 h at 150 r / min. One mL of culture medium was taken, and an equal volume of methanol was added. The mixture was thoroughly mixed by inversion and centrifuged at 12000 r / min for 5 min. The supernatant was filtered through a 0.22 μm organic filter membrane, and the concentration change of (Rac)-PTC in the culture medium was detected by HPLC.
[0035] 1.4 Preparation and purification of crude enzyme solution for recombinant protein
[0036] Single colonies of recombinant E. coli BL21 (DE3) containing pET28a-pmt80 were picked and inoculated into 300 mL LB liquid medium containing 50 mg / L Km. The culture was incubated at 37 °C with shaking until the OD600 reached 0.6. IPTG was then added to the E. coli BL21 (pET-pmt80) culture to a final concentration of 0.5 mM, and the culture was induced at 25 °C for 12 h with shaking. After induction, the colonies were centrifuged at 4 °C, 10000 r / min for 8 min, and the precipitated bacterial cells were collected. The bacterial cells were resuspended in pre-chilled 20 mM Tris-HCl (pH=7.4) buffer, washed twice by centrifugation at 5000 r / min for 10 min, and finally resuspended in 25 mL buffer. The resuspended bacterial solution was then sonicated and centrifuged at 10000 r / min for 30 min at 4 ℃. The collected supernatant was the pMT80 crude enzyme solution. The sample was placed on ice or stored at 4 ℃ for later use. Recombinant protein purification was performed using a Ni-TED.6EF pre-packed gravity column. After purification, the molecular size of the recombinant protein was determined by SDS-PAGE, and the protein concentration was determined using the Bradford Protein Assay Kit (Takara).
[0037] Results: See Figure 1 The amplified pmt80 target gene is shown, with a molecular weight of approximately 744 bp; see also Figure 2High-performance liquid chromatography (HPLC) results showed that the characteristic peaks of PTC (retention time RT = 5.6 min) in the culture medium of recombinant E. coli BL21 (pET-pmt80) all exhibited significant attenuation. Simultaneously, a novel product peak appeared at a retention time of 10.2 min, whose elution time perfectly matched the characteristic peak of the PTM standard (RT = 10.2 min). These results indicate that recombinant E. coli can catalyze the conversion of PTC to PTM, and pmt80 is the functional gene responsible for catalyzing the methylation reaction of PTC. See also... Figure 3 SDS-PAGE analysis showed that the purified pmt80 enzyme was approximately 30 kDa, consistent with the theoretical value of 28.5 kDa.
[0038] Example 2: Comparison of the ability of pmt80 to convert PTCs of different configurations
[0039] A final concentration of 40 μM (Rac)- / (R)- / (S)-PTC and 1 mM SAM were added to 500 μL of purified enzyme PMT80 in an enzyme reaction solution, and the reaction was carried out in a 30 °C water bath. Samples were taken at different time points, and an equal volume of acetonitrile was added to terminate the enzyme reaction. The terminated enzyme reaction solution was vortexed, centrifuged at 12000 r / min for 5 min, and filtered through a 0.22 μm organic phase filter. The concentrations of substrate and product were determined by HPLC with a chiral column. All treatments were performed in triplicate.
[0040] Results: pmt80 achieved a 46% conversion rate of (Rac)-PTC within 88 min, and the EF value decreased from 0.50 to 0.46. Figure 4 These results indicate that Pmt80-catalyzed (Rac)-PTC conversion has no significant chiral selectivity.
[0041] Example 3: Metabolic pathway analysis of pmt80 to PTC conversion
[0042] Add 40 μM (Rac)-PTC and 1 mM SAM to 500 μL of enzyme-catalyzed reaction solution containing an appropriate amount of PMT80 pure enzyme. Incubate in a 30 °C water bath for 30 min, then terminate the enzyme reaction with an equal volume of acetonitrile. Vortex the terminated enzyme reaction solution, centrifuge at 12000 r / min for 5 min, filter through a 0.22 μm organic phase filter, and analyze by HPLC. After confirming the presence of a distinct product peak, dilute the sample (1:1 methanol:water) to a concentration less than 1 ppm, vortex, centrifuge at 13500 r / min for 3 min, filter through a 0.22 μm organic phase filter, and detect the peak using UPLC-Q-TOF-MS. Identify the product based on the primary and secondary mass spectra.
[0043] Results: See Figure 5 The products generated after the PMT80-catalyzed (Rac)-PTC conversion were identified by UPLC-QTOF-MS. The target product PTM was present in the PMT80-catalyzed (Rac)-PTC conversion system. Figure 5 (A). HPLC-MS / MS results ( Figure 5 As shown in Figure B), the characteristic peak at m / z = 358.0559 in the primary mass spectrometry is related to prothioconazole [M+CH2+H]. + The theoretical value of 358.0543 is completely consistent; the characteristic diagnostic ions of the secondary mass spectrometry (m / z = 98.9632 and 124.9655) match the fragmentation pattern of prothioconazole, thus confirming that Pmt80 can catalyze the metabolism of PTC to methyl prothioconazole PTM.
[0044] Example 4: Measurement of pmt80 kinetic parameters
[0045] In a 500 μL Tris-HCl enzymatic reaction system containing an appropriate amount of pmt80, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 140, 160, and 180 μM of (S)-PTC and (R)-PTC were added, respectively, and the reaction was carried out in a 37 ℃ water bath for 30 min. The enzymatic reaction system consisted of 1 mL of 20 mM Tris-HCl (pH = 7.4) buffer, with a final concentration of 40 μM (Rac)-PTC, an appropriate amount of SAM, and an appropriate amount of pmt80 added. Specific enzyme activity was defined as the amount of enzyme required to catalyze the conversion of 1 μmol of substrate per 1 min. An equal volume of acetonitrile was added to the above reaction solution, and the mixture was thoroughly inverted to terminate the enzymatic reaction. The mixture was centrifuged at 12000 r / min for 3 min, and the supernatant was filtered through a 0.22 μm organic filter membrane. The concentrations of PTC and the product PTM were determined by HPLC. The substrate concentration and reaction rate in the reaction were nonlinearly fitted using GraphPad Prism software (GraphPad Software Inc., San Diego, CA) to obtain K. m Vmax and k cat Values. All processes are set up with three parallel groups.
[0046] Results: Enzyme kinetic analysis showed that the catalytic efficiency of Pmt80 for (R)-PTC was kcat / Km = 3.4 × 10⁻⁶. -3 min -1 μM -1 ( Figure 6 The catalytic efficiency of (S)-PTC for (A) is kcat / Km = 3.0 × 10⁻⁶. -3min -1 μM -1 ( Figure 6 The catalytic efficiency of Pmt80 for (R)-PTC is 1.1 times that for (S)-PTC.
[0047] Example 5: Effect of temperature on pmt80 enzyme activity
[0048] An appropriate amount of PMT80 purified enzyme, 0.5 mM SAM, and 40 μM (S)- / (R)-PTC were added to the buffer solution. The mixture was reacted at temperatures of 4, 16, 25, 30, 37, 42, 50, 60, and 70 °C for 20 min, and samples were taken. The enzyme reaction was terminated by adding an equal volume of acetonitrile. The substrate and product concentrations were determined by HPLC. The relative enzyme activity at different temperatures was calculated with the highest enzyme activity defined as 100%. No enzyme was added as a blank control. Both the control and treatment groups were set up in triplicate.
[0049] Results: The optimal reaction temperature for Pmt80-catalyzed (R)- / (S)-PTC conversion was 37 ℃. Figure 7 Within the temperature range of 4-37 ℃, the enzyme activity of Pmt80 gradually increases with increasing temperature; when the temperature is above 37 ℃, the enzyme activity of Pmt80 begins to gradually decrease; when the temperature is above 50 ℃ or below 20 ℃, the enzyme activity of Pmt80 catalyzing (R)- / (S)-PTC is less than 25%. Therefore, the enzyme activity of Pmt80 catalyzing (R)- / (S)-PTC is highly sensitive to temperature.
[0050] Example 6: Effect of pH on pmt80 enzyme activity
[0051] Different pH buffer systems were prepared: 50 mM acetate-sodium acetate (pH 3.5-6.0), 50 mM citric acid-sodium citrate (pH 5.5-8.5), 50 mM Tris-HCl buffer (pH 7.0-9.0), and 50 mM glycine-NaOH buffer (pH 9.0-11.0). Appropriate amounts of PMT80 purified enzyme, 0.5 mM MSAM, and 40 μM (S)- / (R)-PTC were added to each, and the reactions were carried out in a water bath at the optimal temperature for 20 min. The reaction was terminated by adding an equal volume of acetonitrile. The concentrations of substrate and product were determined by HPLC, and the relative enzyme activities under other pH conditions were calculated with the highest enzyme activity defined as 100%.
[0052] Results: The reaction pH significantly affected the relative enzyme activity of Pmt80 catalyzing (R)- / (S)-PTC. The optimal catalytic pH for both substrates was 9.0. Figure 8When the pH is in the range of 6.0-11.0, Pmt80 has the activity to convert (R)- / (S)-PTC; when the pH is < 5.0, its relative enzyme activity for catalyzing the conversion of (R)- / (S)-PTC is less than 10%.
[0053] Example 7 Effects of metal ions and chemical reagents on the activity of pmt80 enzyme
[0054] In a buffer system at the optimal pH, appropriate amounts of pmt80 pure enzyme, 0.5 mM SAM, and 40 μM (S)- / (R)-PTC were added, followed by the addition of various metal ions (K+, K+, and PTC) to a final concentration of 1.0 mM. + Na + Ag + Zn 2+ Mg 2+ Cu 2+ Ca 2+ Mn 2+ Ni 2+ Fe 2+ Fe 3+ and Cr 3+ Various inhibitors, including EDTA (1 mM), 1,10-phenanthroline, and detergents CTAB and SDS (0.5% m / v), were reacted in a water bath at the optimal temperature. The enzyme activity under the reaction system without any added metal ions or other chemical reagents was taken as 100%, and the relative enzyme activities under other reagent conditions were calculated.
[0055] Results: See Figure 9 Within the enzymatic reaction system, various metal ions exhibited varying degrees of inhibitory effects on the relative enzyme activity of Pmt80, with 1 mM Ni showing the most significant inhibitory effect. 2+ Cr 3+ Fe 2+ Fe 3+ Cu 2+ Zn 2+ Ag + The enzyme activity of Pmt80 catalyzing (R)- / (S)-PTC was significantly inhibited, with relative enzyme activities all below 10%. The addition of different chemical reagents showed varying degrees of inhibitory or promoting effects on Pmt80 enzyme activity. 1 mM CTAB and 0.5% (m / v) detergent SDS completely inhibited the Pmt80-catalyzed (R)- / (S)-PTC conversion, while 1 mM PMSF showed moderate inhibition (approximately 50%). However, 1 mM 1,10-phenanthroline increased the relative enzyme activity of Pmt80 catalyzing (S)-PTC by approximately 1.2-fold.
[0056] Example 8 Substrate Spectral Analysis
[0057] A suitable amount of purified PMT80 enzyme and 1 mM SAM were added to a 500 μL Tris-HCl enzymatic reaction system, followed by the addition of 20 mg / L of each of the following five PTC analogs: 4-amino-5-(2-furan)-4H-1,2,4-triazol-3-thione, 4-amino-5-(4-chlorophenyl)-1,3-dithiacyclopentadien-2-thione, 5-(4-fluorophenyl)-4-methyl-4H-1,2,4-triazol-3-thiol, 4-phenyl-4H-1,2,4-triazol-3-mercaptoethanol, and 4-ethyl-5-phenyl-4H-[1,2,4]triazol-3-thiol. The reaction was carried out at 30 °C for 24 h, and the enzyme reaction was terminated by adding an equal volume of acetonitrile. The conversion of each analog was detected by HPLC, and peaks were detected by UPLC-Q-TOF-MS. The products were identified based on the primary and secondary mass spectra.
[0058] Results: As shown in Table 1, pmt80 is only active against R-prothioconazole and S-prothioconazole, while it has no catalytic ability against other species.
[0059] Table 1: Substrate degradation profile of pmt80 enzyme
[0060]
[0061] The above description, in conjunction with specific embodiments, provides a further detailed explanation of the present invention. It should not be construed that the specific implementation of the present invention is limited to these descriptions. For those skilled in the art, several simple deductions or substitutions can be made without departing from the concept of the present invention, and all such deductions or substitutions should be considered to fall within the scope of protection defined by the claims submitted herein.
Claims
1. A prothioconazole methyltransferase gene pmt80, characterized in that, The nucleotide sequence of the gene is shown in SEQ ID NO.
1.
2. A prothioconazole methyltransferase pmt80, characterized in that, Its amino acid sequence is shown in SEQ ID NO.
2.
3. An expression carrier, characterized in that, The expression vector contains the pmt80 gene of prothioconazole methyltransferase, and the expression vector is selected from prokaryotic expression vectors or eukaryotic expression vectors; preferably, the expression vector is a prokaryotic expression vector.
4. A recombinant bacterial strain, characterized in that, The recombinant strain contains an expression vector containing the prothioconazole methyltransferase gene pmt80.
5. The recombinant strain according to claim 4, characterized in that, The strain in question is Escherichia coli.
6. Application of strains containing the prothioconazole methyltransferase pmt80 gene expression vector in the degradation of prothioconazole.
7. The application of prothioconazole methyltransferase PMT80 in the degradation of prothioconazole and its analogues, characterized in that, The prothioconazole is R-prothioconazole or S-prothioconazole; the analogue is 4-ethyl-5-phenyl-4H-[1,2,4]triazole-3-thiol.
8. A formulation for degrading prothioconazole, characterized in that, The preparation contains a strain expressing the pmt80 gene of prothioconazole methyltransferase; or the preparation contains prothioconazole methyltransferase pmt80.
9. An immobilized enzyme preparation, characterized in that, The immobilized enzyme in the immobilized enzyme preparation is prothioconazole methyltransferase PMT80.