Alphavirus-based replicas for the administration of biological agents

Modifying Alphavirus replicons with New and Old World sequences reduces immune responses, addressing the challenge of anti-drug antibodies and improving the efficacy of biological agents.

JP7846986B2Active Publication Date: 2026-04-16JANSSEN PHARMACEUTICALS INC
View PDF 3 Cites 0 Cited by

Patent Information

Application Number
JP2021518944
Authority / Receiving Office
JP · JP
Patent Type
Patents
Current Assignee / Owner
Priority Date
2018-10-08
Filing Date
2019-10-08
Publication Date
2026-04-16
Estimated Expiration
2039-10-08

AI Technical Summary

Technical Problem

Alphavirus-based replicons used for biological agents face challenges due to immune responses, particularly anti-drug antibodies (ADAs), which reduce therapeutic efficacy, especially when delivered in inflammatory environments.

Method used

RNA replicons are modified to include sequences from both New and Old World Alphaviruses, specifically altering the nsP3 hypervariable domain, to reduce or eliminate immune responses, allowing for effective in vivo expression of heterologous proteins or peptides.

Benefits of technology

The modified replicons significantly reduce or eliminate immune responses, enhancing the therapeutic efficacy of biological agents by minimizing anti-drug antibody generation.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 0007846986000001
    Figure 0007846986000001
  • Figure 0007846986000002
    Figure 0007846986000002
  • Figure 0007846986000003
    Figure 0007846986000003
Patent Text Reader

Abstract

The present invention provides an RNA replicon useful for administering a heterologous protein or peptide to a mammal to elicit a reduced or no immune response from the mammal. The RNA replicon comprises an RNA sequence encoding the heterologous protein or peptide, an RNA sequence encoding the nonstructural proteins nsP1, nsP2, and nsP4 of a New World alphavirus, and an RNA sequence encoding the macrodomain, central domain, and hypervariable domain of the alphavirus nsP3 protein. The encoded hypervariable domain may have an amino acid sequence derived from an Old World alphavirus nsP3 hypervariable domain, or may have an amino acid sequence derived from a portion of the New World alphavirus nsP3 hypervariable domain and another portion derived from an Old World alphavirus nsP3 hypervariable domain.
Need to check novelty before this filing date? Find Prior Art

Description

Technical Field

[0001] Cross - reference to related applications This application claims the benefit of priority to U.S. Provisional Patent Application No. 62 / 742,868, filed Oct. 8, 2018, the disclosure of which is hereby incorporated by reference in its entirety.

[0002] Reference to electronically submitted sequence listings This application includes a sequence listing that was electronically submitted via EFS - Web as an ASCII - formatted sequence listing with a creation date of Oct. 7, 2019 and a file name of "689405.107WO_SL" having a size of 147 KB. The sequence listing submitted via EFS - Web is part of this specification and is hereby incorporated by reference in its entirety.

Background Art

[0003] Alphavirus - based self - amplifying RNA (replicons) have been used for decades as a general - purpose platform for vaccines. Two properties that make replicons suitable for such a platform are 1) high and long - lasting protein expression and 2) the self - adjuvanticity of the platform that promotes robust cellular, humoral, and mucosal immunity. These properties make replicons excellent as a vaccine platform, but in other areas, they can potentially impede replicon performance as a platform for in vivo expression of biological agents.

[0004] The use of biological agents in medicine is increasing. However, these recombinant proteins are often recognized as exogenous, inducing immune responses and the development of anti-drug antibodies (ADAs), resulting in reduced therapeutic efficacy of the proteins. While there are various factors that cause anti-drug antibody (ADA) responses, the inflammatory environment in which the biological agent is delivered may promote and / or enhance the ADA response. Therefore, the delivery of replicon-derived biological agents, which are naturally autoadjuvants and inflammatory, carries the risk of promoting ADA responses and reducing the clinical efficacy of the encoded biological agent. The ability of replicons to downregulate the immune response to heterologous proteins expressed by replicons would reduce the risk of ADA generation and enhance the usefulness of replicons in the in vivo expression of biological agents.

[0005] Therefore, it would be useful to have compositions and methods that enable the administration of biological drug molecules to humans or animals with reduced or eliminated risk of causing an undesirable immune response. [Overview of the Initiative]

[0006] The present invention provides RNA replicons useful for administering heterologous molecules to humans or animals and reducing or eliminating the immune response from humans or animals to the heterologous molecules. The RNA replicons of the present invention have an RNA sequence (e.g., a gene of interest (GOI)) encoding a heterologous molecule (e.g., a protein or peptide), the RNA sequence encoding the non-structural proteins nsP1, nsP2, and nsP4 of the New World Alphavirus; as well as the macrodomain, central domain, and hypervariable domain (HVD) of the Alphavirus nsP3 protein. The encoded hypervariable domain may have an amino acid sequence derived from the Old World Alphavirus nsP3 hypervariable domain, or it may have an amino acid sequence derived from a part of the New World Alphavirus nsP3 hypervariable domain and another part derived from the Old World Alphavirus nsP3 hypervariable domain, i.e., a chimeric nsP3 hypervariable domain. Modification of replicons based on the New World Alphavirus as described herein has been found to reduce or eliminate the immune response caused by the encoded heterologous protein or peptide.

[0007] RNA replicons are useful for administering biological drug molecules such as proteins and peptides. The replicons of the present invention are administered to humans or animals together with the biological drug encoded by the replicon, and the encoded biological drug (e.g., a heterologous protein or peptide) is expressed in humans or animals.

[0008] In a first aspect, the present invention provides an RNA replicon comprising: an RNA sequence encoding a heterologous protein or peptide; 5' and 3' alphavirus uncoding regions; an RNA sequence encoding amino acid sequences derived from the New World Alphavirus non-structural proteins nsP1, nsP2, and nsP4; an RNA sequence encoding an amino acid sequence derived from the Alphavirus nsP3 macrodomain; an RNA sequence encoding an amino acid sequence derived from the Alphavirus nsP3 central domain; an RNA sequence encoding a hypervariable domain having an amino acid sequence derived from the Old World Alphavirus nsP3 hypervariable domain, or an RNA sequence encoding an amino acid sequence including a portion derived from the New World Alphavirus nsP3 hypervariable domain and a portion derived from the Old World Alphavirus nsP3 hypervariable domain.

[0009] In some embodiments, the alphavirus nsP3 macrodomain and alphavirus nsP3 central domain are derived from a New World alphavirus, while in other embodiments, the alphavirus nsP3 macrodomain and alphavirus nsP3 central domain are derived from an Old World alphavirus. In various embodiments, the Old World alphavirus is selected from the group consisting of CHIKV, SINV, and SFV. The New World alphavirus can be Venezuelan horse encephalitis virus (VEEV), Western horse encephalitis virus (WEEV), or Eastern horse encephalitis virus (EEEV). In various embodiments, the Old World alphavirus may be any of the following: Sindbis virus (SINV), Chikungunya virus (CHIKV), Semlik Forest virus (SFV), Ross River virus (RRV), Sagiyama virus (SAGV), Geta virus (GETV), Middleberg virus (MIDV), Beval virus (BEBV), Onyonnyon virus (ONNV), Ndum (NDUV), and Barma Forest virus (BFV).

[0010] In some embodiments, the portion derived from the Old World alphavirus nsP3 hypervariable domain includes a motif selected from the group consisting of FGDF (SEQ ID NO: 18) and FGSF (SEQ ID NO: 19). The portion derived from the Old World alphavirus nsP3 hypervariable domain may have repeats selected from the group consisting of FGDF / FGDF (SEQ ID NO: 20) repeats, FGSF / FGSF (SEQ ID NO: 21) repeats, FGDF / FGSF (SEQ ID NO: 22) repeats, and FGSF / FGDF (SEQ ID NO: 23) repeats; and the repeat sequences may be separated by at least 10 and 25 or fewer amino acids. In some embodiments, the repeat sequences are separated by amino acid sequences derived from the group consisting of NEGEIESLSSELLT (SEQ ID NO: 6), SDGEIDELSRRVTTESEPVL (SEQ ID NO: 7), and DEHEVDALASGIT (SEQ ID NO: 8).

[0011] In any embodiment of the RNA replicon, the portion derived from the Old World Alphavirus hypervariable domain may have any of amino acids 479-482 or 497-500 or 479-500 or 335-517 of CHIKV nsP3 HVD; or any of amino acids 451-454 or 468-471 or 451-471 of SFV nsP3 HVD; or amino acids 490-493 or 513-516 or 490-516 or 335-538 of SINV nsP3 HVD. In any of these embodiments (or any embodiment described herein), the New World Alphavirus may be VEEV, and the portion derived from the New World Alphavirus hypervariable domain may not have amino acids 478-518 of the VEEV nsP3 hypervariable domain; or may not have amino acids 478-545 of the VEEV nsP3 hypervariable domain; or may not have amino acids 335-518 of the VEEV nsP3 hypervariable domain. In other embodiments, the New World Alphavirus may be EEEV, and the portion derived from the New World Alphavirus hypervariable domain may not contain amino acids 531-547 of the EEEV hypervariable domain. Alternatively, the New World Alphavirus may be WEEV, and the portion derived from the New World Alphavirus hypervariable domain may not contain amino acids 504-520 of the WEEV hypervariable domain.

[0012] In any embodiment, the RNA replicon may have a subgenome promoter that is operably ligated to an RNA sequence encoding a heterologous protein and modulates the translation of the RNA sequence. The RNA replicon may also have a 5' cap and a 3' poly-A tail. The RNA replicon may have positive sense single-stranded RNA. In various embodiments, the RNA replicon may have RNA of 10–12 kb and / or a diameter of 30–50 nm.

[0013] In various embodiments, the heterologous protein is a protein or peptide of a biological preparation, which can be, for example, an antibody or a modified chimeric antibody or antibody fragment, an antigenic polypeptide or any other therapeutic or immunogenic polypeptide or peptide.

[0014] In certain embodiments of the replicon, the new world alphavirus is VEEV, and the portion derived from the new world alphavirus nsP3 hypervariable domain does not contain amino acids 335-518 of the VEEV nsP3 hypervariable domain, while the portion derived from the old world alphavirus nsP3 hypervariable domain contains amino acids 490-516 of SINV nsP3 HVD; or the old world alphavirus is SINV, and the portion derived from the old world alphavirus nsP3 hypervariable domain contains amino acids 335-538 of SINV nsP3 HVD.

[0015] In any embodiment, RNA sequences encoding heterologous proteins or peptides can be operably ligated to RNA sequences encoding nsP1, nsP2, and nsP4.

[0016] In another aspect, the present invention provides a method for administering a heterologous protein or peptide to a mammal. The method of the present invention comprises the step of administering an RNA replicon described herein, which encodes a heterologous protein or peptide, to a mammal, wherein the heterologous protein or peptide is expressed in the mammal. The RNA replicon may be any of those described herein.

[0017] In another embodiment, the present invention provides an RNA replicon having: an RNA sequence encoding a heterologous protein or peptide; an RNA sequence encoding amino acid sequences derived from the non-structural proteins nsP1, nsP2, and nsP4 of the New World Alphavirus; and an RNA sequence encoding an amino acid sequence derived from the nsP3 protein of the Old World Alphavirus, wherein the first 1 to 6 amino acids on the N-terminal and / or C-terminal side of the nsP3 protein are derived from the New World Alphavirus sequence. Thus, the 1 to 6 amino acids may be located at the junction between nsP2 and nsP3; or the 1 to 6 amino acids may be located at the junction between nsP3 and nsP4. In various embodiments, the Old World Alphavirus may be any of those described herein. If the New World Alphavirus is VEEV, the nsP2 / nsP3 junction sequence may be LHEAGC / APSY (SEQ ID NO: 12); if the junction is the nsP3 / nsP4 junction, the sequence may be RFDAGA / YIFS (SEQ ID NO: 13). In any embodiment, the second-to-last glycine (also referred to by its single-letter code "G") can be preserved, and the remaining amino acids of nsP3 can be modified as described herein. A stop codon (TGA) can optionally precede the conjugate sequence, which can be a read-through stop codon. In other embodiments where the New World Alphavirus is EEEV, the nsP2 / nsP3 conjugate sequence can be QHEAGR / APAY (SEQ ID NO: 14), with the second-to-last G preserved. When the New World Alphavirus is EEEV, the sequence at the nsP3 / nsP4 conjugate can be RYEAGA / YIFS (SEQ ID NO: 15), with the second-to-last glycine being optionally preserved, but the remaining amino acids of nsP3 can be modified as described herein. A read-through stop codon (TGA) can also precede these sequences.In other embodiments, the New World Alphavirus is WEEV, and the nsP2 / nsP3 junction sequence may be RYEAGR / APAY (SEQ ID NO: 16), where the second-to-last G is conserved, but the remaining amino acids of the nsP2 / nsP3 junction are modified as described herein. For the nsP3 / nsP4 junction of WEEV, the sequence may be RYEAGA / YIFS (SEQ ID NO: 17), where the second-to-last glycine is conserved, and the remaining amino acids of nsP3 can be modified as described herein; these sequences may also be preceded by a read-through stop codon (TGA). In various embodiments, the sequences of SEQ ID NOs: 12-17 may also contain one, two, or three substitutions on the N-terminal and / or C-terminal side.

[0018] The above summary of the present invention is not limiting, and other features and advantages of the present invention will become apparent from the following detailed description of the invention and from the claims. Section headings or subheadings are provided solely for the convenience of the reader and do not indicate a deviation from the discussion or necessarily an entirely new subject area. Any subject may be discussed or disclosed under any section heading or subheading.

[0019] The above summary and the following detailed description of the present invention will be better understood when read in conjunction with the accompanying drawings. It should be understood that the present invention is not limited to the exact embodiments shown in the drawings. [Brief explanation of the drawing]

[0020] [Figure 1] This figure provides an illustrative example of wild-type alphavirus. The virus particle is shown as a spherical icosahedron with an envelope and a capsid with a diameter of 65-70 nm, having icosahedral symmetry with T=4, composed of 240 monomers. The envelope contains 80 spikes, each of which is a trimmer of the E1 / E2 protein. [Figure 2]Figure A2 is a graphical example of a VEEV-based alphavirus replicon encoding red-luminescent firefly luciferase (rFF). Three embodiments are shown: one having wild-type nsP3 VEEV HVD (WT), one a VEEV / SINV hybrid (VEEV / SINV) having a portion of SINV HVD (by substituting amino acid residues 335-538 of VEEV HVD with amino acids 335-538 of SINV HVD); and another hybrid (VEEV / CHIKV) having a portion of CHIKV HVD (by substituting amino acid residues 335-518 of VEEV HVD with amino acids 335-517 of CHIKV HVD). Figures 2B and 2C are graphical examples showing that a replicon containing mutant nsP3 protein replicates to the same level (Figure 2B) and expresses the same level of rFF (Figure 2C) as a replicon containing wild-type nsP3. [Figure 3A] Figure 3A is a graph showing the results of monitoring in vivo luciferase activity, reported as total flux. 10 μg each of the three VEEV-based alphavirus replicon RNAs described in Figure 2A, contained in physiological saline, was delivered intramuscularly to the quadriceps muscle of BALB / c mice. α.SGI.rFF encodes VEEV WT, α.SGI.SINV.rFF encodes VEEV / SINV, and α.SGI.CHIKV.rFF encodes VEEV / CHIKV. [Figure 3B] Figure 3B is the same as Figure 3A, but shows the results of monitoring using 1 μg of replicon RNA. Replicons expressing mutant forms of nsP3 exhibited luciferase activity at levels similar to those of wild-type nsP3 replicons. [Figure 4] These plots and bar graphs show the results of in vivo studies of VEEV-based replicons expressing HA from H5N1 influenza virus. The data show that the replicon encoding the VEEV / CHIKV HVD chimera did not induce HA-specific IgG titers compared to the replicon expressing wild-type HVD. [Figure 5A] Figure 5A is a figure providing a plot in pictorial format demonstrating the frequency of HA-specific short-lived effector CD8+ T cells (SLECs) in BALB / c mice immunized with the indicated VEEV-based replicon expressing H5N1 HA. WT refers to the unmodified replicon backbone derived from VEEV's TC-83 strain; SGI refers to the replicon backbone modified to be interferon-resistant. [Figure 5B] Figure 5B is a figure providing a plot in pictorial format demonstrating the frequency of HA-specific memory precursor effector CD8+ T cells (MPECs) in BALB / c mice immunized with the indicated VEEV-based replicon expressing H5N1 HA. WT refers to the unmodified replicon backbone derived from VEEV's TC-83 strain; SGI refers to the replicon backbone modified to be interferon-resistant. [Figure 6]This figure provides partial domain structure and sequence alignments of nsP3 proteins from representative members of New World and Old World alphaviruses. The schematic diagram of the nsP3 protein shows three predicted structural domains: macrodomain, alphadomain, and HVD. Sequence alignments of nsP3 proteins from various alphaviruses were performed using Clustal Omega. Domain sequences are underlined in the same color as used in the schematic diagram. The exemplified nsP3 protein sequences originated from the following viruses: SFV (GenBank accession number NP_740667.1) (the protein shown is SEQ ID NO: 24), SINV (GenBank accession number P03317.1) (the protein shown is SEQ ID NO: 25), CHIKV (GenBank accession number NP_690588.1) (the protein shown is SEQ ID NO: 26), VEEV (GenBank accession number P27282.2) (the protein shown is SEQ ID NO: 27), and EEEV (GenBank accession number Q4QXJ8.2) (the protein shown is SEQ ID NO: 28). The image is from Foy et al., Journal of Virology, Vol. 87, No. 4, pp. 1997-2010 (2013). [Figure 7]Figure showing examples of various regions in the hypervariable domain (HVD) of the encoded nsP3 protein of various New World and Old World viruses (reproduced from Figure 2 of Gotte et al., Viruses, 2018, 10, 105). The Uniprot entries of the nsP3 sequences used in the figure are: MAYV (Q8QZ73), RRV (P13887), SFV (P08411), CHIKV (Q8JUX6), ONNV (Q8QZ73), BFV (P87515), SINV (P03317), VEEV (P36328), EEEV (Q4QXJ8), WEEV (P13896). The G3BP binding sites are present for the following Old World virus nsP3 proteins: for MAYV, amino acids 470 - 473; for RRV, amino acids 512 - 515 and 523 - 5,26; for SFV, amino acids 451 - 454 and 468 - 471; for CHIKV, amino acids 479 - 482 and 497 - 500; for ONNV, amino acids 519 - 522 and 537 - 540; for BFV, amino acids 429 - P32 and 447 - 450; for SINV, amino acids 490 - 493 and 513 - 516. For the New World P1234, the binding sites for the viral proteins G3BP (and FXR) are present as follows: for VEEV, amino acids 478 - 545 have the FXR binding site; for EEEV, amino acids 471 - 483 have the G3BP binding site and amino acids 531 - 547 encode the FXR binding site; for WEEV, amino acids 504 - 520 have the FXR binding site.

Mode for Carrying Out the Invention

[0021] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. In case of conflict, the term(s) defined herein have precedence over their definition(s) in dictionaries, in the art, or in other references. All patents, patent applications published and other publications cited herein are incorporated by reference herein as though fully set forth. It is to be noted that as used in this specification and the appended claims, the singular forms "a", "an" and "the" include plural referents unless the context clearly dictates otherwise.

[0022] Unless otherwise specified, any numerical values such as % sequence identity or ranges of % sequence identity described herein are to be understood as being modified in all instances by the term "about". Thus, a numerical value typically includes ±10% of the recited value. For example, a dosage of 10 mg includes 9 mg to 11 mg. As used herein, the use of a numerical range explicitly includes all individual numerical values within such range, including all possible sub-ranges, integers, and fractional values within that range, unless the context clearly indicates otherwise.

[0023] Throughout this specification and the following claims, unless the context requires otherwise, the word "comprise", and variations such as "comprises" and "comprising", are to be interpreted to mean that the recited integer or step or group of integers or steps includes, but does not exclude, any other integer or step or group of integers or steps. As used herein, the term "comprising" can be replaced by the term "containing" or "including" or, in some cases, the term "having" as used herein.

[0024] As used herein, “consisting of” excludes any element, step, or component not expressed in the elements of the claim. As used herein, “consisting essentially of” does not exclude any substance or step that does not substantially affect the basic novel properties of the claim. The aforementioned terms “comprising,” “containing,” “including,” and “having” may be replaced with the terms “consisting of” or “consisting essentially of” whenever used herein in the context of aspects or embodiments of the invention, in order to diversify the scope of this disclosure.

[0025] In a general embodiment, the present invention relates to RNA replicons encoding heterologous proteins or peptides, and methods for administering them to humans or animals using RNA replicons. The RNA replicons of the present invention contain an RNA sequence encoding a heterologous protein or peptide, and an RNA sequence encoding amino acid sequences derived from the New World AlphaVirus nsP1, nsP2, and nsP4 proteins, respectively. The replicons also have an RNA sequence encoding an amino acid sequence derived from the AlphaVirus nsP3 macrodomain, and an RNA sequence encoding an amino acid sequence derived from the AlphaVirus nsP3 central domain. The RNA replicons of the present invention further have an RNA sequence encoding an amino acid sequence entirely derived from the Old World AlphaVirus nsP3 hypervariable domain, or an amino acid sequence having a portion derived from the New World AlphaVirus nsP3 hypervariable domain and a portion derived from the Old World AlphaVirus nsP3 hypervariable domain. That is, the HVD can be a hybrid or chimeric New World / Old World sequence. As used herein, “polypeptide,” “peptide,” or “protein” means a molecule comprising at least two amino acid residues linked by peptide bonds to form a polypeptide.

[0026] As used herein, with respect to alphavirus nsP3 or the alphavirus nsP3 hypervariable domain (HVD), amino acid residues are numbered in comparison to the amino acid sequence of wild-type alphavirus nsP3. The amino acid sequence of wild-type alphavirus nsP3 is described herein or otherwise available from public records such as the GenBank database. For example, with respect to SFV nsP3, the amino acid residues are numbered in comparison to the wild-type SFV nsP3 of SEQ ID NO: 24; with respect to SINV nsP3, the amino acid residues are numbered in comparison to the wild-type SINV nsP3 of SEQ ID NO: 25; with respect to CHIKV nsP3, the amino acid residues are numbered in comparison to the wild-type CHIKV nsP3 of SEQ ID NO: 26; with respect to VEEV nsP3, the amino acid residues are numbered in comparison to the wild-type VEEV nsP3 of SEQ ID NO: 27; with respect to EEEV nsP3, the amino acid residues are numbered in comparison to the wild-type EEEV nsP3 of SEQ ID NO: 28; and with respect to WEEV nsP3, the amino acid residues are numbered in comparison to the wild-type WEEV nsP3 of SEQ ID NO: 29.

[0027] The nsP1, nsP2, nsP3, and nsP4 proteins encoded by the replicon are functionally or biologically active proteins. The RNA replicon of the present invention can also encode a 3' untranslated region (UTR) and a 5' UTR, which can be the 3' UTR and 5' UTR of an alphavirus. The RNA replicon can also encode a regulatory element (e.g., one or more subgenome promoters) and a poly-A tail. The promoter, 5' UTR and / or 3' UTR, and the RNA sequence encoding the heterologous protein or peptide can be operably ligated so that the replicon RNA self-amplifies when introduced into a living organism, and the heterologous protein or peptide is expressed in the organism.

[0028] The inventors of this application have unexpectedly discovered that, in RNA replicons derived from the New World Alphavirus (NW) genome, replacing at least a portion of the RNA encoding the nsP3 protein with RNA encoding at least a portion of nsP3 derived from Old World Alphavirus (OW) significantly reduces or eliminates mammalian immunogenicity to the heterologous protein or peptide encoded in the replicon. Therefore, in some embodiments of the replicon, the macrodomain and central domain of nsP3 may be derived from the New World Alphavirus sequence, while the HVD may a) be derived from the Old World Alphavirus HVD sequence, or b) have a portion derived from the Old World Alphavirus HVD sequence and a portion derived from the New World Alphavirus HVD sequence.

[0029] In another embodiment, the macrodomain and central domain are derived from the macrodomain and central domain sequences of Old World Alphavirus, and the HVD has a portion derived from a) Old World Alphavirus HVD sequence, or b) a portion derived from Old World Alphavirus HVD sequence and a portion derived from New World Alphavirus HVD sequence.

[0030] In another embodiment, the macrodomain is derived from a New World AlphaVirus macrodomain sequence, the central domain is derived from a Old World AlphaVirus central domain sequence, and the HVD has a portion derived from either a) an Old World AlphaVirus HVD sequence or b) an Old World AlphaVirus HVD sequence and a portion derived from a New World AlphaVirus HVD sequence.

[0031] In another embodiment, the macrodomain is derived from a Old World AlphaVirus macrodomain sequence, the central domain is derived from a New World AlphaVirus central domain sequence, and the HVD has a portion derived from either a) an Old World AlphaVirus HVD sequence or b) an Old World AlphaVirus HVD sequence and an HVD sequence.

[0032] In some embodiments, the replicon encodes an HVD that is a hybrid or chimeric new-world / old-world sequence having a portion derived from a new-world alphavirus HVD sequence and a portion derived from an old-world HVD sequence. In various embodiments, the old-world portion may consist of at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 52, at least 53, at least 75, at least 100, at least 125, at least 150, at least 175, or at least 200 amino acids. The two world segments together may contain an HVD that is the same length as the wild-type Old World or New World alphavirus HVD sequence, or it may be up to 10, 20, or 30 amino acids shorter than the wild-type Old World or New World alphavirus HVD sequence; or it may be up to 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 amino acids longer.

[0033] In some embodiments, the N-terminal portion of the HVD may be derived from the New World nsP3 HVD sequence, and the C-terminal amino acids of the HVD may be derived from the wild-type OW alphavirus HVD amino acid sequence. For example, of the HVD, at least 5 or at least 10 or at least 15 or at least 20 or at least 25 or at least 30 or at least 31 or at least 32 or at least 33 or at least 34 or at least 35 or at least 35-55 or at least 35-65 or at least 40 or at least 45 or at least 50 or at least 52 or at least 53 or at least 60 or at least 70 or at least 80 or at least 100 or at least 125 or at least 150 or at least 175 C-terminal amino acids may be derived from (and optionally corresponding to) amino acid sequences of the OW HVD. In any of these embodiments, the HVD may also be less than 200, less than 175, less than 150, less than 125, less than 100, or less than 80 amino acids in length. In further embodiments, the C-terminal amino acids may be retained, for example, 1 to 5, 5, 5 to 10, 10 to 12, 10 to 13, 10 to 15, or 15 to 20 amino acids from the terminal NW alphavirus C-terminal HVD sequence, while the remaining C-terminal amino acids may be derived from the OW alphavirus HVD as described.

[0034] In any embodiment described herein, the new world alphavirus may be VEEV, EEEV, WEEV, or any new world alphavirus described herein or known in the art, and the old world alphavirus may be CHIKV, SINV, or SFV, or any old world alphavirus described herein or known in the art. New world and old world alphaviruses may be used in the present invention in any combination, and all possible combinations and subcombinations are disclosed as if they were fully described herein.

[0035] Alphavirus Replicon Alphaviruses are classified as viruses of the Togaviridae family, group IV. These viruses typically carry a positive-sense single-stranded RNA genome in the range of 11kb–12kb. The alphavirus replicons of the present invention can be 11kb–12kb, or 10–13kb, or 7–20kb, or 7–25kb in length, and can have a 5' cap and a 3' poly-A tail, which can be the 5' cap and 3' poly-A tail of the alphavirus. The 5' cap can be one known to those skilled in the art, for example, a 7-methylguanylate cap, or an anti-reverse cap analog 3'-O-Me-m7G(5')ppp(5')G, or another analog cap structure. Alphaviruses are generally enveloped viruses, spherical in shape, and have a diameter of about 70 nm. They can also have an isometric nucleocapsid. Replicons can encode on a single fragment of RNA. Alphavirus genomes and replicons have two open reading frames (ORFs), one non-structural and one structural. The non-structural portion of the genome encodes proteins nsP1-nsP4, which play a role in the transcription and replication of viral RNA, are produced as polyproteins, and are part of the viral replication mechanism. However, replicons can have one, two, or more than one open reading frame. None of the alphavirus replicons of the present invention may lack, contain, or be not associated with a capsid, nucleocapsid, coat protein, or nucleoprotein. The alphavirus replicons of the present invention may be RNA molecules.

[0036] The structural portion of the genome encodes the coanucleocapsid protein C, and the envelope proteins P62 and E1, which associate as heterodimers. The RNA replicons of the present invention may have any one or more of the described characteristics of alphaviruses. In some embodiments, the RNA replicons of the present invention lack sequences encoding alphavirus structural proteins; or do not encode alphavirus (or any other, optionally) structural proteins. In some embodiments, the RNA replicons of the present invention do not encode one or more of proteins C, P62, 6K, and E1, including any combinations and subcombinations, as they are fully described herein. In some embodiments, the RNA replicons of the present invention do not encode one of proteins C, P62, 6K, and E1.

[0037] Geographic isolation of alphavirus families can be a factor in the evolution and adaptation of these viruses to their unique environments. Circulating alphavirus serocomplexes can be further classified as either Old World or New World alphaviruses. Old World and New World alphaviruses have sequences that can be utilized in the present invention as described herein. Examples of New World alphaviruses include any New World alphavirus, such as Eastern Equine Encephalitis Virus (EEEV), Venezuelan Equine Encephalitis Virus (VEEV), Western Equine Encephalitis Virus (WEEV), Fort Morgan (FMV), Highland J Virus (HJV), Buggy Creek Virus (BCRV), Mukambo Virus (MUCV), and Pixna Virus (PIXV). Examples of Old World alphaviruses include any Old World alphavirus, such as Sindbis virus (SINV), Semryki forest virus (SFV), Chikungunya virus (CHIKV), Beval virus (BEBV), Onyonnyon virus (ONNV), Ross River virus (RRV), Sagiyama virus (SAGV), Geta virus (GETV), Middleberg virus (MIDV), Nudum virus (NDUV), Bamma forest virus (BFV), Mayarovirus (MAYV), Aura virus (AURA), Una virus, Wataroa virus, Babanki virus, and Psyllida virus. New World and Old World viruses and their sequences can be used in any combination or subcombination in the RNA replicons of the present invention, and are disclosed in all possible combinations and subcombinations as they are fully described herein.

[0038] The RNA replicons of the present invention may be derived from an alphavirus genome, meaning that the replicon has some of the structural characteristics of the alphavirus genome, or is similar to its structural characteristics. The RNA replicons of the present invention may be modified alphavirus genomes. In some embodiments of the replicons disclosed herein, one or more sequences of the replicon may be provided in "trans," i.e., the sequences of the replicon are provided on two or more RNA molecules. In other embodiments, all sequences of the replicon reside on a single RNA molecule, which can also be administered to a mammal treated as described herein.

[0039] Origin The RNA replicons of the present invention may contain RNA sequences from wild-type New World or Old World alphavirus genomes (or amino acid sequences encoded thereby). Any of the RNA replicons of the present invention disclosed herein may contain RNA sequences "derived from" or "based on" wild-type alphavirus genome sequences, meaning that these RNA sequences have sequence identity of at least 60%, at least 65%, at least 68%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100%, or 80-99%, or 90-100%, or 95-99%, or 95-100%, or 97-99%, or 98-99%. Any nucleic acid or amino acid sequence disclosed herein can be functionally or biologically active and operably linked to another sequence necessary for the self-replication of an alphavirus or replicon. A molecule is functionally or biologically active if it performs at least 50% of the activity of its natural (or wild-type) counterpart, although a functional molecule may perform at least 60%, at least 70%, at least 90%, at least 95%, or 100% of the activity of its natural (or wild-type) counterpart.RNA replicons may also encode amino acid sequences derived from or based on the amino acid sequence of wild-type alphavirus, which means that these RNA sequences have at least 60%, at least 65%, at least 68%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, 100%, 80-99%, 90-100%, 95-99%, 95-100%, 97-99%, or 98-99% sequence identity with the amino acid sequence (or equivalent sequence) encoded by the wild-type RNA alphavirus genome, which may be the New World or Old World alphavirus genome. Sequences derived from other sequences may be up to 5%, up to 10%, up to 20%, or up to 30% longer or shorter than the original sequence. In any embodiment, sequence identity can be at least 95%, at least 97%, at least 98%, at least 99%, or 100% with respect to any nucleotide sequence encoding a G3BP or FXR binding site (or an amino acid sequence having it). These sequences may also be up to 5%, up to 10%, up to 20%, or up to 30% longer or shorter than the original sequence.

[0040] For example, in some embodiments, the RNA sequences encoding one or more of the nsP1, nsP2, nsP3 macrodomains, nsP3 central domain, nsP3 hypervariable domain, and / or nsP4 proteins may be derived from corresponding wild-type alphavirus sequences. The “corresponding” sequence may also be a similar sequence of another type of alphavirus. Corresponding sequences are disclosed herein and may also be determined by sequence alignment tools known to those skilled in the art (e.g., Clustal Omega). Figure 6 shows illustrative sequence alignments of corresponding sequences for the nsP3 protein from representative members of Old World and New World alphaviruses obtained using Clustal Omega. However, other sequence alignment tools approved by those skilled in the art may be used. Programs useful for performing sequence alignment can also be found in Molecular Systems Biology (2011) 7, 539. Therefore, the nsP1, nsP2, nsP3, and nsP4 sequences from the New World Alphavirus "correspond" to the nsP1, nsP2, nsP3, and nsP4 sequences from the Old World Alphavirus, respectively. The sequences may similarly be corresponding sequences. The corresponding amino acid sequence can consist of at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 52, at least 53, at least 75, at least 100, at least 125, at least 150, at least 175, or at least 200 amino acids, and may be up to 5%, at least 10%, at least 20%, or at least 30% longer or shorter than the original sequence; the corresponding nucleic acid sequence can consist of at least 15, at least 30, at least 45, at least 60, at least 75, at least 90, at least 156, at least 159, at least 225, at least 300, at least 375, at least 450, at least 525, or at least 600 nucleotides.Such sequences may be up to 5%, 10%, 20%, or 30% longer or shorter than the original sequences.

[0041] In some embodiments of the replicon, the sequences of nsP1, nsP2, and nsP4, respectively, may be derived from or based on the New World alphavirus genome. In some embodiments, an RNA replicon derived from or based on the wild-type New World alphavirus genome may contain at least one RNA sequence (in addition to at least one heterologous protein or peptide) that is not from the wild-type New World alphavirus genome, but this RNA sequence may be the sequence of nsP3, or the sequence of the central domain and / or macrodomain of nsP3, or at least a portion of the sequence of HVD. In some embodiments, an RNA replicon derived from the New World alphavirus genome may have an RNA sequence encoding nsP3, or the domain of nsP3, or a portion of the domain of nsP3, which has been replaced with a corresponding sequence from the wild-type Old World alphavirus genome. When referring to the entire replicon, “derived from” or “based on” means that sequences of RNA encoding at least one heterologous protein or peptide are not included in the count, and optionally, sequences encoding the nsP3 protein, or one or more of the macrodomain, central domain, and / or HVD domain of nsP3 in any combination or subcombination.

[0042] The term "RNA replicon" refers to RNA containing all the genetic information necessary to induce its own amplification or self-replication within a permissive cell, which may be a human, mammalian, or animal cell. RNA replicons 1) encode RNA-dependent RNA polymerase, which can interact with viral or host cell-derived proteins, nucleic acids, or ribonucleoproteins to catalyze the RNA amplification process. Non-structural proteins include nsP1, nsP2, nsP3, and nsP4, and 2) contain cis-acting RNA sequences necessary for the replication and transcription of genomic and subgenomic RNA, such as the 3'UTR and 5'UTR (alpha-viral nucleotide sequences for non-structural protein-mediated amplification), as well as / or subgenomic promoters. These sequences can be conjugated during the replication process to self-coding proteins, or non-self-coding cell-derived proteins, nucleic acids, or ribonucleoproteins, or complexes of any of these components. In some embodiments, the modified RNA replicon molecule typically contains elements in the following order: a 5' viral RNA sequence required in cis for replication (e.g., 5'UTR and 5'CSE), a sequence encoding a biologically active non-structural protein (e.g., nsP1234), a promoter for transcribing the subgenomic RNA, a 3' viral sequence required in cis for replication (e.g., 3'UTR), and a polyadenylated tract, as well as, optionally, one (or more) sequences encoding a heterologous protein or peptide after or under the control of the subgenomic promoter. Furthermore, the term RNA replicon may refer to a positive-sense (or message-sense) molecule, and the RNA replicon may be of a length different from that of any known native RNA virus. In any embodiment of this disclosure, the RNA replicon may lack (or not contain) at least one (or all) sequences of structural viral proteins (e.g., nucleocapsid protein C, and envelope proteins P62, 6K, and E1).In these embodiments, sequences encoding one or more structural genes can be replaced with one or more heterologous sequences, such as the coding sequence of at least one heterologous protein or peptide (or another gene of interest (GOI)).

[0043] In various embodiments, the RNA replicons disclosed herein may be engineered RNA replicons, synthetic RNA replicons, or recombinant RNA replicons. As used herein, the term recombinant means any molecule (e.g., DNA, RNA, etc.) that is from or indirectly results from a human treatment of polynucleotides. As a non-limiting example, cDNA is a recombinant DNA molecule, and similarly, any nucleic acid molecule produced by an in vitro polymerase reaction, or to which a linker is attached, or incorporated into a vector such as a cloning vector or an expression vector. As a non-limiting example, recombinant RNA replicons may be one or more of the following: 1) synthesized or modified in vitro using chemical or enzymatic techniques of nucleic acid molecules (e.g., by using chemical nucleic acid synthesis, or by using enzymes for replication, polymerization, exonuclease digestion, endonuclease digestion, ligation, reverse transcription, transcription, base modification (e.g., including methylation), or recombination (including homologous and site-directed recombination); 2) binding nucleotide sequences that are not naturally bound; 3) manipulated using molecular cloning techniques to have one or more nucleotides deleted from a natural nucleotide sequence; and 4) treated using molecular cloning techniques to have one or more sequence changes or rearrangements from a natural nucleotide sequence.

[0044] As used herein, the terms “percent identity,” “homology,” “shared sequence identity,” or “percent (%) sequence identity” relating to nucleic acid or polypeptide sequences are defined as the percentage of nucleotide or amino acid residues in a candidate sequence that is identical to a known polypeptide after the sequence has been aligned for maximum percentage identity and gaps have been introduced as necessary to obtain maximum percentage homology. Insertions or deletions at the N-terminus or C-terminus should not be construed as affecting homology, and internal deletions and / or insertions into polypeptide sequences of fewer than approximately 30, 20, 10, or 5 amino acid residues should not be construed as affecting homology. Homology or identity at the nucleotide or amino acid sequence level can be determined by BLAST (Basic Local Alignment Search Tool) analysis using algorithms employed in programs designed for sequence similarity searches: blastp, blastn, blastx, tblastn, and tblastx (Altschul (1997), Nucleic Acids Res. 25, 3389-3402 and Karlin (1990), Proc. Natl. Acad. Sci. USA 87, 2264-2268). The approach used by the BLAST program first considers similar segments between the query sequence and the database sequence, with or without gaps; then evaluates the statistical significance of all identified matches; and finally, groups together only those matches that meet a pre-selected significance threshold. For a discussion of fundamental issues in sequence database similarity searches, see Altschul (1994), Nature Genetics 6, 119-129. The search parameters for histogram, description, alignment, expected value (i.e., the statistical significance threshold for reporting fits to the database sequence), cutoff, matrix, and filter (low complexity) can be left at their default settings.The default scoring matrix used by blastp, blastx, tblastn, and tblastx is the BLOSUM62 matrix (Henikoff (1992), Proc. Natl. Acad. Sci. USA 89, 10915-10919), which is recommended for query sequences longer than 85 (nucleotides or amino acids).

[0045] For blastn, designed for comparing nucleotide sequences, the scoring matrix is ​​set by the ratio of M (i.e., the reward score for a pair of matched residues) to N (i.e., the penalty score for mismatched residues), with default values ​​of M and N being +5 and -4, respectively. The four blastn parameters may be adjusted as follows: Q=10 (gap creation penalty); R=10 (gap elongation penalty); wink=1 (generates a word hit at every wink position along the query); and gapw=16 (sets the window width at which gapped alignments occur). Equivalent Blastp parameter settings for comparing amino acid sequences may be Q=9, R=2, wink=1, and gapw=32. BESTFIT® comparison between sequences, available in version 10.0 of the GCG package, can use DNA parameters GAP=50 (gap creation penalty) and LEN=3 (gap elongation penalty), while equivalent settings for protein comparisons may be GAP=8 and LEN=2.

[0046] In disclosing nucleic acid or polypeptide sequences in this specification, for example, the sequences of nsP1, nsP2, nsP3, nsP3 macrodomain, nsP3 central domain, nsP3 hypervariable domain, nsP4, RdRp, and P1234 disclosed are also sequences that are based on or are thought to be derived from the original sequences. Accordingly, the sequences disclosed include full-length polypeptide sequences of any polypeptide sequences described herein, and, for example, SEQ ID NOs. 1 to 29 (and nucleotide sequences encoding any of SEQ ID NOs. 1 to 29), and fragments thereof, and polypeptide sequences having sequence identity of at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, or at least 85%, for example, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%, or 85-99%, or 85-95%, or 90-99%, or 95-99%, or 97-99%, or 98-99%. Fragments or parts of any of the sequences disclosed herein are also disclosed.A fragment or portion of a sequence contains, of the whole sequence, at least 5 or at least 7 or at least 10 or at least 20 or at least 30, at least 50, at least 75, at least 100, at least 125, 150 or more amino acid residues (or nucleic acids encoding such a fragment), or at least 100 or at least 200 or at least 300 or The disclosed information may include sequences (or nucleic acids encoding such fragments) having at least 400, or at least 500, or at least 600, or at least 700, or at least 800, or at least 900, or at least 1000, or 100-200, or 100-500, or 100-1000, or 500-1000 amino acid residues, or nucleic acids encoding any of these amounts, but less than 500, less than 700, less than 1000, or less than 2000 consecutive amino acids of any of Sequence ID Nos. 1-29 or any fragment disclosed herein, or such fragments. Also disclosed are variants of such sequences, for example, in which at least one, two, three, four, or five amino acid residues are inserted at the N-terminus and / or C-terminus of the disclosed sequence, and / or within the sequence, and nucleic acid sequences encoding such variants.The intended variants may additionally or alternately include: for example, those containing a predetermined mutation by homologous recombination or site-directed or PCR mutagenesis, and, but not limited to, corresponding polypeptides or nucleic acids of other species, including those described herein, alleles of a family of polypeptides or nucleic acids, or other naturally occurring variants; and / or derivatives in which a polypeptide is covalently modified by substitution, chemical means, enzymatic means or other suitable means, at a portion other than a naturally occurring amino acid (e.g., a detectable portion such as an enzyme), containing insertions and substitutions. The nucleic acid sequences described herein may be RNA sequences.

[0047] Any component or sequence of an RNA replicon can be operably ligated to any other component or sequence. Components or sequences of an RNA replicon can be operably ligated for the expression of at least one heterologous protein or peptide (or biological agent) in a host cell or treated organism, and / or for the replicon's ability to self-replicate. The term "operably ligated" means a functional linkage between two or more sequences configured to perform their normal functions. Thus, a promoter or UTR operably ligated to a coding sequence can influence the transcription and expression of the coding sequence, provided the appropriate enzyme is present. The promoter does not need to be adjacent to the coding sequence, as long as it functions to induce its expression. Therefore, an operable linkage between an RNA sequence encoding a heterologous protein or peptide and a regulatory sequence (e.g., a promoter or UTR) is a functional linkage that enables the expression of the desired polynucleotide. "Operatively linked" can also refer to sequences such as the sequence encoding RdRp (e.g., nsP4), nsP1-4, UTR, promoter, and other sequences encoding within the RNA replicon, where these sequences are linked to enable transcription and translation of the biopharmaceutical molecule and / or replication of the replicon. The UTR can be operationally linked by providing the sequences and spacing necessary for ribosome recognition and translation of the other encoded sequences.

[0048] G3BP and FXR G3BP (Ras-GTPase-activating protein (Src-homology 3 (SH3) domain) binding protein) and FXR (fragile X family proteins) are both RNA-binding proteins that self-assemble to form ribonucleoprotein complexes (RNPs). Both bind to the HVD domain. The RNP complex formed by G3BP and FXR performs distinct functions within the cell. For example, G3BP is crucial for the nucleation and formation of stress granules in the immune response. Stress granules function to sequester and shut down mRNA translation, and also to regulate the induction and secretion of type I interferons and other cytokines. Together, these activities reinforce the antiviral state within the cell and promote adaptive immune responses. On the other hand, FXR family proteins are not thought to play a role in innate immunity, but they associate with polyribosomes and form RNA transport granules in neurons. Figure 7 shows the regions on various alphavirus nsP3 HVDs to which these RNA-binding proteins bind to alphavirus sequences.

[0049] Non-structural proteins The alphaviral genome encodes non-structural proteins nsP1, nsP2, nsP3, and nsP4, which are produced as a single polyprotein precursor, sometimes referred to as P1234 (or nsP1-4 or nsP1234), and are cleaved into mature proteins through proteolytic processing. nsP1 is approximately 60 kDa in size, possesses methyltransferase activity, and can participate in viral capping reactions. nsP2 is approximately 90 kDa in size and can possess helicase and protease activity, while nsP3 is approximately 60 kDa and contains three domains: a macrodomain, a central (or alphaviral-specific) domain, and a hypervariable domain (HVD) (see Figure 6). nsP4 is approximately 70 kDa in size and contains a core RNA-dependent RNA polymerase (RdRp) catalytic domain. After infection, the alphaviral genomic RNA is translated to produce the P1234 polyprotein, which is cleaved into individual proteins.

[0050] nsP3 The alphavirus nsP3 protein contains three domains: a) a macrodomain, b) a central (or alpha) domain, and c) a hypervariable domain (HVD). The corresponding amino acid sequences for the three domains of some representative members of Old World and New World alphaviruses are shown in Figure 6. In various embodiments, the replicon of the present invention has an RNA sequence encoding an nsP3 macrodomain derived from wild-type alphavirus nsP3 and an nsP3 central domain derived from wild-type alphavirus nsP3. In various embodiments, both the macrodomain and the central domain may be derived from New World wild-type alphavirus nsP3, or both may be derived from Old World wild-type alphavirus nsP3 proteins. In some embodiments, the macrodomain may be derived from a New World wild-type alphavirus macrodomain, and the central domain may be derived from an Old World wild-type alphavirus central domain, or vice versa. The various domains can be any sequence described herein.

[0051] Hypervariable Domain (HVD) In some embodiments, the replicon may have a New World AlphaVirus HVD in which the C-terminal sequence of the amino acid initiating the FXR binding site is deleted and replaced with a Old World wild-type AlphaVirus HVD sequence or a substitution sequence of a portion thereof. Old World AlphaVirus substitution sequences are described herein. Thus, if the New World AlphaVirus is VEEV, such an amino acid can be deleted from the C-terminal side of amino acid 478 of nsP3; if the New World AlphaVirus is EEEV, such an amino acid can be deleted from the C-terminal side of amino acid 531 of nsP3; if the New World AlphaVirus is WEEV, such an amino acid can be deleted from the C-terminal side of amino acid 504 of nsP3 (see Figure 7). In any of these embodiments, the substitution sequence can be substituted as described herein. As otherwise described herein, a portion of the C-terminal amino acids of the New World AlphaVirus HVD can still be retained on the C-terminal side of the Old World sequence.

[0052] In some embodiments, at least a portion of the sequence encoding the FXR binding site of the New World Alphavirus can be deleted and replaced with a substitution sequence described herein. For example, if the New World Alphavirus is VEEV, amino acids 478-517 or 478-545 of nsP3 can be deleted and replaced with a substitution sequence of the Old World Alphavirus. Alternatively, if the New World Alphavirus is VEEV, at least one of the repeats between amino acids 478-545 of nsP3 can be deleted and optionally replaced with an Old World Alphavirus substitution sequence. If the New World Alphavirus is EEEV, amino acids 531-547 of nsP3 can be deleted and replaced with an Old World substitution sequence. If the New World Alphavirus is WEEV, amino acids 504-520 of nsP3 can be deleted and replaced with an Old World substitution sequence. In other embodiments, the entire sequence encoding the FXR binding site can be deleted, or at least 50%, 70%, 80%, or 90% of the FXR binding site can be deleted and optionally replaced with a substitution sequence. In any of the embodiments, the indicated sequence can be deleted, and it is not necessary to insert a replacement sequence.

[0053] Old World alphavirus substitution sequences may include one or more G3BP binding sites, or amino acid fragments having at least a portion of a G3BP binding site. Therefore, the substitution sequence may be FGDF (SEQ ID NO: 18) or FGSF (SEQ ID NO: 19). The substitution sequence may also be derived from at least a portion of the wild-type nsP3 hypervariable domain of an Old World alphavirus. Further examples of Old World alphavirus substitution sequences are described below. Old World alphavirus substitution sequences can be used in replicons having any of the New World alphavirus HVD sequences described herein. In any embodiment, the New World alphavirus may be VEEV, EEEV, WEEV, or any New World alphavirus described herein.

[0054] If the Old World alphavirus is CHIKV, the substitution sequence could be amino acids 479-582 or 479-500 or 479-500 of CHIKV nsP3.

[0055] If the Old World alphavirus is a SINV, the substitution sequence may be a sequence containing amino acids 490-493, 513-516, or 490-516 of the SINV nsP3.

[0056] If the Old World alphavirus is SFV, the substitution sequence may be a sequence containing amino acids 451-471, 451-454, or 468-471 of SFV nsP3.

[0057] If the Old World alphavirus is MAYV, the substitution sequence may be a sequence containing amino acids 470-473 of MAYV nsP3.

[0058] If the Old World alphavirus is an RRV, the substitution sequence may be a sequence containing amino acids 412-426, 512-515, or 523-526 of RRV nsP3.

[0059] If the Old World alphavirus is ONNV, the substitution sequence may be a sequence containing amino acids 519-540, 519-522, or 537-540 of ONNV nsP3.

[0060] If the Old World alphavirus is BFV, the substitution sequence may be a sequence containing amino acids 429-450, 429-432, or 447-450 of BFV nsP3.

[0061] New World and Old World alpha viruses may be any of those described herein, and may be combined in any possible combination or subcombination, all of which are disclosed as if they were fully described herein.

[0062] The alphavirus genome encodes the nsP4 core RNA-dependent RNA polymerase. Polyprotein cleavage can occur at the nsP2 / 3 junction, consequently affecting the RNA template used in genome replication. After cleavage, nsP3 can create a ring structure surrounding nsP2, and these two proteins form a substantial interface. Therefore, sequence conservation around the nsP2 / 3 and / or nsP3 / 4 junctions may be useful.

[0063] Therefore, in some embodiments, each macro and / or central and / or HVD domain of the nsP3 protein may have a C-terminal and / or N-terminal portion (as described herein) which is an amino acid sequence derived from a New World alphavirus, while the rest of the domain(s) may be derived from an Old World alphavirus sequence. For example, each macro and / or central and / or HVD domain may have a sequence derived from the corresponding Old World alphavirus domain, but may have the first four, five, six, four-six, six-eight, or six-tenth amino acids of the N-terminal and / or C-terminal of nsP3 derived from a New World alphavirus sequence (which may be the New World alphavirus from which nsP1, nsP2, and nsP4 originate). Therefore, the replicon may be one of those described herein having an RNA sequence encoding an amino acid sequence derived from each of the Old World Alphavirus nsP3 macro and / or central and / or HVD domains, where the first 1-3 or 1-4 or 1-5 or 1-6 or 1-7 or 1-8 amino acids on the N-terminal and / or C-terminal side of the domain may be derived from the New World Alphavirus domain or have one, two or three substitutions thereon. When used in this context, the terms “C-terminus” and “N-terminus” do not indicate true ends, but rather indicate the point at which a polyprotein (e.g., P1234) is cleaved into individual polypeptides (e.g., nsP1, nsP2, nsP3, and nsP4). Sequences encoding nsP are characterized by a stop codon, at which transcription would normally stop. However, when the stop codon is treated as a read-through stop codon, the end may be a “ / ” as shown in SEQ ID NOs. 12-17, which may represent the N-terminus and / or C-terminus of nsP. The conjugate sequence can be one to six amino acids on either terminal side, for example, on the nsP3 side. Such embodiments allow the nsP3 sequence to originate from an old-world sequence, while preserving the junctions between nsP2 / nsP3 and nsP3 / nsP4.The preservation of these junctions may allow cleavage of the P1234 protein junction using a new-world alphavirus enzyme. In some embodiments, the second-to-last glycine is preserved at the junction. The old-world alphavirus may be any of those described herein. For example, if the new-world alphavirus is VEEV, the nsP2 / nsP3 sequence may be LHEAGC / APSY (SEQ ID NO: 12), where the slash (" / ") represents the boundary between nsP2 and nsP3, and the second-to-last G is preserved, while the remaining amino acids of the nsP2 / nsP3 junction are modified as described herein. For the nsP3 / nsP4 junction of VEEV, the sequence may be RFDAGA / YIFS (SEQ ID NO: 13), where the second-to-last glycine is again preserved, and the remaining amino acids of nsP3 can be modified as described herein. These sequences may also be preceded by a stop codon (TGA), which may be treated as a read-through stop codon as described above. If the New World Alphavirus is EEEV, the nsP2 / nsP3 sequence can be QHEAGR / APAY (SEQ ID NO: 14), where the slash (" / ") represents the boundary between nsP2 and nsP3, and the second-to-last glycine is conserved, while the remaining amino acids of the nsP2 / nsP3 junction can be altered as described herein. For the nsP3 / nsP4 junction of EEEV, the sequence can be RYEAGA / YIFS (SEQ ID NO: 15), where the second-to-last glycine is again conserved, and the remaining amino acids of nsP3 can be altered as described herein. These sequences may also be preceded by a read-through stop codon (TGA) as shown above. If the New World Alphavirus is WEEV, the nsP2 / nsP3 sequence can be RYEAGR / APAY (SEQ ID NO: 16), where the slash (" / ") represents the end or terminal of nsP2 (and the junction between nsP2 and nsP3), and the second-to-last G is conserved, while the remaining amino acids of the nsP2 / nsP3 junction are modified as described herein.In the case of the nsP3 / nsP4 junction of WEEV, the sequence can be RYEAGA / YIFS (SEQ ID NO: 17), where the second-to-last glycine is conserved, and the remaining nsP3 amino acids can be modified as described herein. These sequences may also be preceded by a read-through stop codon (TGA) as described herein. Any of these sequences (SEQ ID NOs: 12-17) may also contain one, two, or three substitutions on the N-terminal and / or C-terminal side.

[0064] Repetitive motif Alphaviruses can contain conserved sequence elements (CSEs), which are similar or identical sequences in nucleic acid sequences or polypeptides across species. CSEs may also occur in HVDs of New World or Old World alphaviruses nsP3, as is known in the art.

[0065] Old World alphaviruses may also contain FGDF (SEQ ID NO: 18) or FGSF (SEQ ID NO: 19) amino acid motifs, which can be repeated within the sequence to form a repeat sequence or repeat motif. In any embodiment of the RNA replicon of the present invention, the HVD of an Old World alphavirus may contain FGDF / FGDF (SEQ ID NO: 20) repeats, or FGSF / FGSF (SEQ ID NO: 21) repeats, or FGDF / FGSF (SEQ ID NO: 22) repeats, or FGSF / FGDF (SEQ ID NO: 23) repeats. In all embodiments where repeats are present, two repeat motifs may be separated by one or more amino acid residues. In various embodiments, two repeating motifs can be separated by 5, 6, 7, 8, 9, 10, or at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acid residues, or by more than 25 amino acid residues, which in one embodiment may be random amino acids. In one embodiment, the motif or repeating motif is separated by at least 10 and 25 or fewer amino acids, which may also be random amino acids. In various embodiments, two repeating motifs can be separated by sequences derived from NEGEIESLSSELLT (SEQ ID NO: 6), SDGEIDELSRRVTTESEPVL (SEQ ID NO: 7), or DEHEVDALASGIT (SEQ ID NO: 8), which may be of the same length; therefore, repeating motifs separated by SEQ ID NOs: 6, 7, or 8 are disclosed, which have: 1) FGDF (SEQ ID NO: 18) motifs at both ends; 2) FGSF (SEQ ID NO: 19) motifs at both ends; or 3) an FGDF (SEQ ID NO: 18) motif at either the 3' or 5' end and an FGSF (SEQ ID NO: 19) motif at the opposite end. In various embodiments, an amino acid sequence may also follow the second motif.Examples include amino acid sequences, DDVLRLGRAGA (SEQ ID NO: 11), EPGEVNSIISSRSAVSFPLRKQRRRRRSRRTEY (SEQ ID NO: 10), LPGEVDDLTDSDWSTCSDTDDELRLDRAGG (SEQ ID NO: 9), or sequences derived from any of these, any of which may be followed by the motifs or repeating motifs disclosed herein.

[0066] Non-translated areas Any of the replicons of the present invention may include 5' and 3' untranslated regions (UTRs). The UTRs may be wild-type New World or Old World alphavirus UTR sequences, or sequences derived from either of these. In various embodiments, the 5' UTR may be of any suitable length, such as about 60 nt, 50-70 nt, or 40-80 nt. In some embodiments, the 5' UTR may also have a conserved primary or secondary structure (e.g., one or more stem-loops) and be involved in the replication of alphavirus or replicon RNA. In some embodiments, the 3' UTR may be up to several hundred nucleotides, for example, 50-900, 100-900, 50-800, 100-700, or 200-700 nt. The 3' UTR may also have a secondary structure, such as a step-loop, followed by a polyadenylated tract or poly-A tail. In any embodiment of the present invention, the 5' and 3' untranslated regions may be operably ligated to any other sequence encoded by the replicon. UTRs can be operably ligated to promoters and / or sequences encoding heterologous proteins or peptides by providing the sequences and intervals necessary for the recognition and transcription of other encoded sequences.

[0067] In one embodiment, the RNA replicon of the present invention may have an RNA sequence encoding a heterologous protein or peptide (e.g., a monoclonal antibody or a protein or peptide of a biological product), an RNA sequence encoding amino acid sequences derived from the nsP1, nsP2, and nsP4 protein sequences of wild-type New World Alphavirus, and a 5'UTR sequence and a 3'UTR sequence (for non-structural protein-mediated amplification). The RNA replicon may also have a 5' cap and a polyadenylated (or poly-A) tail. The RNA replicon may also encode an amino acid sequence derived from the New World Alphavirus macrodomain, an amino acid sequence derived from the New World Alphavirus central domain, and an amino acid sequence derived from the Old World Alphavirus hypervariable domain. In an alternative embodiment, the RNA replicon may encode a portion having an amino acid sequence derived from the New World hypervariable domain and another portion having an amino acid sequence derived from the Old World Alphavirus hypervariable domain, as described herein.

[0068] The immunogenicity of a heterologous protein or peptide can be determined by several assays known to those skilled in the art, such as immunostaining of intracellular cytokines or secreted cytokines by epitope-specific T cell populations, including short-lived effector and memory precursor effector CD8+ T cells, or by quantifying the frequency and total number of epitope-specific T cells and characterizing their differentiation and activation states. Immunogenicity can also be determined by measuring antibody-mediated immune responses, such as antibody production by measuring the titer of serum IgA or IgG.

[0069] Heterogeneous proteins and peptides The RNA replicon of the present invention comprises an RNA sequence that encodes at least one protein or peptide, which is heterologous to an alphavirus and may (but may not necessarily) be heterologous to a human, mammal, or animal that expresses the RNA sequence in its body. In any embodiment, the replicon may have two, three, or more RNA sequences encoding heterologous proteins or peptides. In various embodiments, the heterologous proteins or peptides are the biopharmaceutical molecules described herein. Administration of biopharmaceutical molecules to humans, mammals, or animals carries the risk of eliciting an anti-drug antibody immune response. However, according to the present invention, administration of the replicon to the body of a human, mammal, or animal, and expression of the biopharmaceutical in the body of a human, mammal, or animal are possible, while the immune response from the cells of the human, mammal, or animal that has been administered the replicon and is expressing the biopharmaceutical molecule is substantially reduced or absent. In any embodiment, a sequence encoding a heterologous protein or peptide can be operably ligated to one or more other sequences in the replicon (e.g., a promoter or a 5'UTR or 3'UTR sequence) and placed under the control of a subgenome promoter, thereby enabling the expression of the heterologous protein or peptide in humans, mammals, or animals.

[0070] Heterogeneous proteins or peptides can be any protein or peptide, including, for example, cytokines, growth factors, immunoglobulins, monoclonal antibodies (including Fab antigen-binding fragments and Fc fusion proteins), hormones, interferons, interleukins, regulatory peptides, and proteins. Specific examples of monoclonal antibodies that can be heterogeneous proteins include laxibakumab, tocilizumab, brentuzimab vedotin, factor IX Fc fusion protein, lilonacept, ofatumumab, bevacizumab, belimumab, certolizumab pegol, ramucirumab, factor VIII Fc fusion protein, etanercept, vedolizumab, cetuximab, aflibercept, obinutuzumab, trastuzumab, adalimumab, canakinumab, infliximab, and adtrastuzumab emta. Examples include cephalocytes, pembrolizumab, alemtuzumab, ranivizumab, romiplostim, beratacept, abatacept, pertuzumab, denosumab, infliximab, katumakisomab, infliximab, absiximab, rituximab, golimumab, basiliximab, ecrizamab, ustekinumab, siltuximab, palivizumab, natalizumab, panitumumab, denosumab, omalizumab, ipilimumab, zibaflibercept, and ibritumomab tiuxetan. In other embodiments, the heterologous protein or peptide may be endothelial growth factor (e.g., vascular EGF), hormones (e.g., insulin, relaxin), exon-skipping oligonucleotides, morpholino oligomers, morpholino antisense oligomers, or RNA encoding tumor-specific antigens. In some embodiments, the heterologous protein or peptide may be encoded by RNA sequences of up to 5kb, 6kb, 7kb, or 8kb, or up to 9kb, 10kb, 11kb, or 12kb. The heterologous protein may also be a single-chain antibody molecule.

[0071] The alphavirus replicons of the present invention may also have subgenome promoters for the expression of heterologous proteins or peptides. As used herein, the term “subgenome promoter” refers to the promoter of the subgenome mRNA of the viral nucleic acid. As used herein, “alphavirus subgenome promoter” is a promoter originally defined in the wild-type alphavirus genome that induces the transcription of subgenome messenger RNA as part of the alphavirus replication process.

[0072] When used in relation to polynucleotides, genes, nucleic acids, polypeptides, proteins, or enzymes, the term “heterogenetic” refers to a polynucleotide, gene, nucleic acid, polypeptide, protein, or enzyme that does not originate from the host species. For example, as used herein, “heterogenetic” or “heterogenetic nucleic acid sequence” refers to a gene or nucleic acid sequence from a species different from the species of the host organism into which it is introduced. Heterogenetic sequences may also be synthetic, non-originating from an organism, or not found in nature. When referring to a gene regulatory sequence, or an accessory nucleic acid sequence used to process the expression of a gene sequence (e.g., a 5' untranslated region, a 3' untranslated region, a poly-A addition sequence, an intron sequence, a splice site, a ribosome binding site, an internal ribosome entry site, a genome homology region, a recombination site, etc.), or a nucleic acid sequence encoding a protein domain or protein localization sequence, “heterogeneous” means that the sequence encoding the regulatory or accessory sequence or the protein domain or localization sequence is from a different source than the gene to which the regulatory or accessory nucleic acid sequence or the protein domain or localization sequence is juxtaposed within the genome, chromosome, or episome. Accordingly, a promoter operably ligated to a gene that is not operably ligated in its natural state (e.g., in the genome of an ungenetically engineered organism) is referred herein to as a “heterogeneous promoter,” even if the promoter could originate from the same species (or, in some cases, the same organism) as the gene to which it is ligated. Similarly, when referring to the protein localization sequence or protein domain of an engineered protein, “heterogeneous” means that the localization sequence or protein domain originates from a different protein than the one into which it was incorporated through genetic engineering.

[0073] As used herein, the terms “recombinant” or “manipulated” nucleic acid molecules refer to nucleic acid molecules that have been altered by human intervention. In a non-limiting example, cDNA is a recombinant DNA molecule, and similarly, any nucleic acid molecule produced by an in vitro polymerase reaction, to which a linker is attached, or incorporated into a vector such as a cloning vector, expression vector, or replicon. In a non-limiting example, a recombinant nucleic acid molecule is 1) synthesized or modified in vitro using chemical or enzymatic techniques of nucleic acid molecules (e.g., by using chemical nucleic acid synthesis, or by using enzymes for replication, polymerization, exonuclease digestion, endonuclease digestion, ligation, reverse transcription, transcription, base modification (e.g., including methylation), or recombination (including homologous and site-directed recombination)); 2) containing an inherently unbound nucleotide sequence; 3) manipulated using molecular cloning techniques to have one or more nucleotides deleted from a native nucleic acid molecular sequence; and / or 4) treated using molecular cloning techniques to have one or more sequence changes or rearrangements from a native nucleic acid sequence. As a non-limiting example, cDNA is a recombinant DNA molecule, and similarly, any nucleic acid molecule that is produced by an in vitro polymerase reaction, has a linker attached, is incorporated into a vector such as a cloning vector or expression vector, or is incorporated into an RNA replicon.

[0074] method The present invention also provides a method for administering nucleic acids to human, mammalian, or animal patients. The nucleic acids may be RNA sequences encoding proteins or peptides (which may be heterologous proteins or peptides). The method comprises the step of administering an RNA replicon described herein to a patient, where the protein or peptide encoded by the replicon is expressed (or transcribed) in the patient, which can be done using cellular components of the patient's body. In any of the (non-limiting) embodiments herein, the mammal may be a human, livestock, food animal, or companion animal. The animal may also be any bird, fish (e.g., of the Salmonidae family), poultry, or large poultry, such as chickens, ducks, geese, turkeys, ostriches, emus, swans, peacocks, pheasants, partridges, or guinea fowl. The replicon may be administered with a pharmaceutically acceptable carrier, such as saline, water, or another acceptable carrier.

[0075] As used herein, “pharmaceutically acceptable carrier” means any substance suitable for use in administration to an individual. For example, a pharmaceutically acceptable carrier may be a sterile aqueous solution such as phosphate-buffered saline (PBS) or water for injection. In some embodiments, a pharmaceutically acceptable carrier may be a buffer, preservative, isotonic agent, stabilizer, surfactant, wetting agent, emulsifier, antioxidant, bulking agent, or chelating agent. Naturally, such further components are required not to adversely affect the overall stability of the pharmaceutical formulation of the present invention.

[0076] Replicon can also be administered as a pharmaceutically acceptable salt. As used herein, “pharmaceutically acceptable salt” means a physiologically and pharmaceutically acceptable salt of a compound such as a nucleic acid compound or polynucleotide, i.e., a salt that retains the desired biological activity of the parent compound and does not impart any undesirable toxicological effects to it. Pharmacochemically acceptable acidic / anionic salts for use in the present invention include, but are not limited to, acetates, benzenesulfonates, benzoates, bicarbonates, bicarbonates, tartrates, bromides, calcium edetate, cansylates, carbonates, chlorides, citrates, dihydrochlorides, edetates, edisylates, estruates, esylates, fumarates, glyceptates, gluconates, glutamates, glycolyl arsanylates, hexylresorcinates, hydravamin, bromides. Examples of hydrochlorides include hydrochlorides, hydroxynaphthoates, iodides, isethions, lactates, lactobions, malates, maleates, mandelates, mesylates, methyl bromides, methyl nitrates, methyl sulfates, mucoates, napsylates, nitrates, pamoates, pantothenates, phosphates / diphosphates, polygalacturonic acids, salicylates, stearates, basic acetates, succinates, sulfates, tannates, tartrates, theoclates, tosylates, and triethiodies. Examples of organic or inorganic acids, though not limited to these, include hydroiodic acid, perchloric acid, sulfuric acid, phosphoric acid, propionic acid, glycolic acid, methanesulfonic acid, hydroxyethanesulfonic acid, oxalic acid, 2-naphthalenesulfonic acid, p-toluenesulfonic acid, cyclohexanesulfamic acid, saccharic acid, or trifluoroacetic acid.Pharmaceutically acceptable basic / cationic salts include, but are not limited to, aluminum, 2-amino-2-hydroxymethyl-propane-1,3-diol (also known as tris(hydroxymethyl)aminomethane, tromethane, or "TRIS"), ammonia, benzathine, t-butylamine, calcium, chloroprocaine, choline, cyclohexylamine, diethanolamine, ethylenediamine, lithium, L-lysine, magnesium, meglumine, N-methyl-D-glucamine, piperidine, potassium, procaine, quinine, sodium, triethanolamine, or zinc.

[0077] The present invention also provides a method for administering a heterologous protein or peptide to a mammal, comprising the step of administering an RNA replicon described herein encoding the heterologous protein or peptide to the mammal, wherein the heterologous protein or peptide is expressed within the mammal. The method of the present invention allows for the administration of heterologous proteins or peptides to mammals in which the immune response from the mammal is lower or eliminated compared to the administration of naked heterologous proteins and peptides.

[0078] Embodiment Embodiment 1 is, RNA sequences encoding heterologous proteins or peptides; The 5' and 3' alphavirus untranslated regions; RNA sequences encoding amino acid sequences derived from the non-structural proteins nsP1, nsP2, and nsP4 of the New World Alphavirus; RNA sequences encoding amino acid sequences derived from the alphavirus nsP3 macrodomain; RNA sequence encoding an amino acid sequence derived from the central domain of alphavirus nsP3; a. Amino acid sequence derived from the Old World alphavirus nsP3 hypervariable domain; or b. Amino acid sequences containing portions derived from the New World Alphavirus nsP3 hypervariable domain and portions derived from the Old World Alphavirus nsP3 hypervariable domain RNA sequences encoding amino acid sequences derived from the alphavirus nsP3 hypervariable domain, including It is an RNA replicon that contains [the specified element].

[0079] Embodiment 2 is the RNA replicon described in Embodiment 1, wherein the alphavirus nsP3 macrodomain and the alphavirus nsP3 central domain are derived from New World Alphavirus.

[0080] Embodiment 3 is the RNA replicon described in Embodiment 1, wherein the alphavirus nsP3 macrodomain and the alphavirus nsP3 central domain are derived from Old World alphaviruses.

[0081] Embodiment 4 is an RNA replicon according to any one embodiment of Embodiments 1 to 3, wherein the alphavirus nsP3 hypervariable domain includes an amino acid sequence derived from the Old World alphavirus nsP3 hypervariable domain.

[0082] Embodiment 5 is an RNA replicon according to any one embodiment of Embodiments 1 to 4, wherein the Old World alphavirus is selected from the group consisting of CHIKV, SINV, and SFV.

[0083] Embodiment 6 is an RNA replicon according to any one embodiment of Embodiments 1 to 5, wherein the New World Alphavirus is Venezuelan Encephalitis Virus (VEEV).

[0084] Embodiment 7 is an RNA replicon according to any one embodiment of Embodiments 1 to 5, wherein the New World Alphavirus is Venezuelan Encephalitis Virus (EEEV).

[0085] Embodiment 8 is an RNA replicon according to any one embodiment of Embodiments 1 to 5, wherein the New World Alphavirus is selected from the group consisting of Venezuelan Equine Encephalitis Virus (VEEV), Western Equine Encephalitis Virus (WEEV), and Eastern Equine Encephalitis Virus (EEEV).

[0086] Embodiment 9 is an RNA replicon according to any one embodiment of Embodiments 1 to 8, wherein the Old World alphavirus is selected from the group consisting of Sindbis virus (SINV), Chikungunya virus (CHIKV), Semryki Forest virus (SFV), Ross River virus (RRV), Sagiyama virus (SAGV), Geta virus (GETV), Middleberg virus (MIDV), Beval virus (BEBV), Onyonnyon virus (ONNV), Nudum (NDUV), and Barma Forest virus (BFV).

[0087] Embodiment 10 is an RNA replicon according to any one embodiment of Embodiments 1 to 9, wherein the portion derived from the Old World Alphavirus nsP3 hypervariable domain includes a motif selected from the group consisting of FGDF (SEQ ID NO: 18) and FGSF (SEQ ID NO: 19).

[0088] Embodiment 11 includes a portion derived from the Old World Alphavirus nsP3 hypervariable domain, which comprises repeats selected from the group consisting of FGDF / FGDF (SEQ ID NO: 20), FGSF / FGSF (SEQ ID NO: 21), FGDF / FGSF (SEQ ID NO: 22), and FGSF / FGDF (SEQ ID NO: 23), and further, the repeat sequences are separated by at least 10 and 25 or fewer amino acids. This is an RNA replicon described in any one embodiment of Embodiments 1 to 10.

[0089] Embodiment 12 is the RNA replicon described in Embodiment 11, wherein the repeat sequences are separated by amino acid sequences derived from the group consisting of NEGEIESLSSELLT (SEQ ID NO: 6), SDGEIDELSRRVTTESEPVL (SEQ ID NO: 7), and DEHEVDALASGIT (SEQ ID NO: 8).

[0090] Embodiment 13 is a portion derived from the Old World Alphavirus hypervariable domain, CHIKV nsP3 HVD amino acids 479-482 or 497-500 or 479-500 or 335-517; or SFV nsP3 HVD amino acids 451-454 or 468-471 or 451-471; or SINV nsP3 HVD amino acids 490-493 or 513-516 or 490-516 or 335-538 This is an RNA replicon according to any one embodiment of Embodiments 1 to 12, including the above.

[0091] Embodiment 14 is a portion derived from the Old World Alphavirus hypervariable domain, CHIKV nsP3 HVD amino acids 479-500 or 335-517; or Amino acids 451-471 of SFV nsP3 HVD; or SINV nsP3 HVD amino acids 490-516 This is an RNA replicon according to any one embodiment of Embodiments 1 to 12, including the above.

[0092] Embodiment 15 is the RNA replicon described in Embodiment 13, wherein the New World Alphavirus is VEEV, and the portion derived from the New World Alphavirus hypervariable domain does not include amino acids 478-518 of the VEEV nsP3 hypervariable domain.

[0093] Embodiment 16 is the RNA replicon described in Embodiment 13, wherein the New World Alphavirus is VEEV, and the portion derived from the New World Alphavirus hypervariable domain does not include amino acids 478-545 of the VEEV nsP3 hypervariable domain.

[0094] Embodiment 17 is the RNA replicon described in Embodiment 13, wherein the New World Alphavirus is VEEV, and the portion derived from the New World Alphavirus hypervariable domain does not include amino acids 335-518 of the VEEV nsP3 hypervariable domain.

[0095] Embodiment 18 is the RNA replicon described in Embodiment 14, wherein the Old World alphavirus is CHIKV, and the portion derived from the Old World alphavirus hypervariable domain contains amino acids 335-517 of CHIKV nsP3.

[0096] Embodiment 19 is the RNA replicon described in Embodiment 14, wherein the Old World alphavirus is a SINV, and the portion derived from the Old World alphavirus hypervariable domain contains amino acids 335-538 of SINV nsP3.

[0097] Embodiment 20 is the RNA replicon described in Embodiment 13, wherein the New World Alphavirus is EEEV, and the portion derived from the New World Alphavirus hypervariable domain does not include amino acids 531-547 of the EEEV nsP3 hypervariable domain.

[0098] Embodiment 21 is an EEEV in which the new world alphavirus is an EEEV, and the portion derived from the new world alphavirus hypervariable domain does not contain amino acids 531-547 of the EEEV nsP3 hypervariable domain, and the portion derived from the old world alphavirus hypervariable domain is CHIKV nsP3 HVD amino acids 479-500; Amino acids 451-471 of SFV nsP3 HVD; or SINV nsP3 HVD amino acids 490-516 This is an RNA replicon according to Embodiment 20, which includes the above.

[0099] Embodiment 22 is the RNA replicon described in Embodiment 13, wherein the New World Alphavirus is WEEV, and the portion derived from the New World Alphavirus hypervariable domain does not include amino acids 504-520 of the WEEV nsP3 hypervariable domain.

[0100] Embodiment 23 is a New World Alphavirus, and the portion derived from the New World Alphavirus hypervariable domain does not contain amino acids 504-520 of the WEEV nsP3 hypervariable domain, and the portion derived from the Old World Alphavirus hypervariable domain is CHIKV nsP3 HVD amino acids 479-500; or Amino acids 451-471 of SFV nsP3 HVD; or SINV nsP3 HVD amino acids 490-516 This is an RNA replicon according to Embodiment 22, which includes the above.

[0101] Embodiment 24 is an RNA replicon according to any one embodiment of Embodiments 1 to 23, further comprising a subgenome promoter operably ligated to an RNA sequence encoding a heterologous protein and regulating the translation of the RNA sequence.

[0102] Embodiment 25 is an RNA replicon according to any one embodiment of Embodiments 1 to 24, further comprising a 5' cap and a 3' poly-A tail.

[0103] Embodiment 26 is an RNA replicon according to any one embodiment of Embodiments 1 to 25, comprising a positive sense single-stranded RNA.

[0104] Embodiment 27 is an RNA replicon according to any one embodiment of Embodiments 1 to 26, comprising 10 to 12 kb of RNA and having a diameter of 30 to 50 nm.

[0105] Embodiment 28 is an RNA replicon according to any one embodiment of Embodiments 1 to 27, wherein the heterologous protein is a protein or peptide of a biological product.

[0106] Embodiment 29 is an RNA replicon according to any one embodiment of Embodiments 1 to 28, wherein the heterologous protein is an antibody.

[0107] Embodiment 30 is the RNA replicon according to Embodiment 1, wherein the new world alphavirus is VEEV, and the alphavirus nsP3 hypervariable domain comprises a portion derived from the new world alphavirus nsP3 hypervariable domain that does not contain amino acids 335-518 of the VEEV nsP3 hypervariable domain, and a portion derived from the old world alphavirus nsP3 hypervariable domain that contains amino acids 490-493 or 513-516 or 490-516 or 335-538 of the SINV nsP3 HVD.

[0108] Embodiment 31 is the RNA replicon described in Embodiment 30, wherein the portion derived from the Old World Alphavirus nsP3 hypervariable domain contains amino acids 490-516 of SINV nsP3 HVD.

[0109] Embodiment 32 is the RNA replicon described in Embodiment 30, wherein the Old World alphavirus is a SINV, and the portion derived from the Old World alphavirus nsP3 hypervariable domain contains amino acids 335-538 of the SINV nsP3 HVD.

[0110] Embodiment 33 is an RNA replicon according to any one embodiment of Embodiments 1 to 32, wherein RNA sequences encoding heterologous proteins or peptides are operably linked to RNA sequences encoding nsP1, nsP2, and nsP4.

[0111] Embodiment 34 is a method for administering a heterologous protein or peptide to a mammal, comprising the step of administering an RNA replicon according to any one embodiment of Embodiments 1 to 33 that encodes a heterologous protein or peptide, wherein the heterologous protein or peptide is expressed in the mammal.

[0112] Embodiment 35 is the method according to Embodiment 34, wherein the New World Alphavirus is VEEV and the RNA replicon is the replicon described in Embodiment 14.

[0113] Embodiment 36 is the method according to Embodiment 34, wherein the RNA replicon is the replicon described in Embodiment 19.

[0114] Embodiment 37 is the method of Embodiment 34, wherein the RNA replicon is the replicon described in Embodiment 22.

[0115] Embodiment 38 is the method of Embodiment 34, wherein the RNA replicon is the replicon described in Embodiment 25.

[0116] Embodiment 39 is, RNA sequences encoding heterologous proteins or peptides; RNA sequences encoding amino acid sequences derived from the non-structural proteins nsP1, nsP2, and nsP4 of the New World Alphavirus; An RNA replicon comprising an RNA sequence encoding an amino acid sequence derived from the nsP3 protein of an Old World alphavirus, wherein the first 1 to 6 amino acids at the N-terminus and / or C-terminus of the nsP3 protein are derived from the New World alphavirus sequence.

[0117] Embodiment 40 has the following arrangement from the 5' end to the 3' end: (1) The alphavirus 5' untranslated sequence for inducing replication of the alphavirus replicon; (2) RNA sequences encoding the alphavirus non-structural proteins nsP1, nsP2, nsP3, and nsP4; (3) Alphavirus subgenome promoter sequence and; (4) RNA sequences encoding one or more heterologous proteins or peptides; (5) Alphavirus 3' untranslated sequence and Alphavirus replicon RNA containing, nsP1, nsP2, and nsP4 originate from one or more New World Alphaviruses. nsP3 consists of a macrodomain, a central domain, and a hypervariable domain (HVD), in the order from the amino terminus to the carboxyl terminus. The macrodomain and central domain are derived from one or more New World alphaviruses and / or Old World alphaviruses; HVD originates from Old World Alphavirus, or HVD includes a portion of HVD from New World Alphavirus and a portion of HVD from Old World Alphavirus. This is alphavirus replicon RNA.

[0118] Embodiment 41 is an alphavirus replicon RNA according to Embodiment 40, wherein nsP1, nsP2, and nsP4 are derived from one or more New World alphaviruses selected from the group consisting of Venezuelan horse encephalitis virus (VEEV), Western equine encephalitis virus (WEEV), and Eastern equine encephalitis virus (EEEV).

[0119] Embodiment 42 is the alphavirus replicon RNA described in Embodiment 40, wherein nsP1, nsP2, and nsP4 are derived from Venezuelan encephalitis virus (VEEV).

[0120] Embodiment 43 is an alphavirus replicon RNA according to any one embodiment of Embodiments 40 to 42, wherein the Old World alphavirus is selected from the group consisting of Sindbis virus (SINV), Chikungunya virus (CHIKV), Semryki Forest virus (SFV), Ross River virus (RRV), Sagiyama virus (SAGV), Geta virus (GETV), Middleberg virus (MIDV), Beval virus (BEBV), Onyonnyon virus (ONNV), Ndum (NDUV), and Barma Forest virus (BFV).

[0121] Embodiment 44 is the alphavirus replicon RNA described in Embodiment 43, wherein the Old World alphavirus is Sindbis virus (SINV), Chikungunya virus (CHIKV), or Semryki Forest virus (SFV).

[0122] Embodiment 45 is an alphavirus replicon RNA according to any one embodiment of Embodiments 40 to 44, wherein the macrodomain and central domain are derived from one or more Old World alphaviruses.

[0123] Embodiment 46 is an alphavirus replicon RNA according to any one embodiment of Embodiments 40 to 44, wherein the macrodomain and central domain are derived from one or more New World alphaviruses.

[0124] Embodiment 47 is an alphavirus replicon RNA according to Embodiment 40, wherein nsP1, nsP2 and nsP4, the macrodomain and the central domain are from Venezuelan encephalitis virus (VEEV), and the HVD is a portion of the HVD from VEEV and a portion of the HVD from an Old World alphavirus selected from the group consisting of Sindobis virus (SINV), Chikungunya virus (CHIKV), and Semryki forest virus (SFV).

[0125] Embodiment 48 is the alphavirus replicon RNA described in Embodiment 47, except that amino acid residues 335-538 of nsP3 of VEEV are substituted with amino acid residues 335-538 of nsP3 of SINV, the HVD is the same as the HVD from VEEV.

[0126] Embodiment 49 is the alphavirus replicon RNA described in Embodiment 47, except that amino acid residues 335-518 of VEEV's nsP3 are substituted with amino acid residues 335-517 of CHIKV's nsP3, the HVD is derived from VEEV. [Examples]

[0127] [Example 1] Immunogenicity of VEEV-based replicas A VEEV-based alphavirus replicon encoding mutant nsP3 was constructed by replacing the nucleotide sequence encoding amino acids 335-518 of VEEV nsP3 with the nucleotide sequence encoding amino acids 335-517 of chikungunya (CHIKV) nsP3, thereby creating a VEEV-based replicon expressing a VEEV / CHIKV nsP3 chimera (SEQ ID NO: 30). This substitution removed the first motif of the repeat sequence from VEEV and replaced it (at amino acids 479-482 and 497-500) with an FGDF / FGDF (SEQ ID NO: 20) repeat sequence from the CHIKV genome. In parallel experiments, amino acids 335–538 of VEEV nsP3 (HVD region) were replaced with amino acids 335–538 of the Sindbisvirus (SINV) nsP3 (HVD region) to generate a replicon encoding a VEEV / SINV nsP3 chimera (SEQ ID NO: 31) (see Figures 2 and 7). This substitution removed a repeat sequence from VEEV and replaced it with an FGSF / FGSF (SEQ ID NO: 21) repeat sequence from SINV. Replicons containing WT, VEEV / CHIKV, or VEEV / SINV chimeric nsP3 and expressing a red-emitting firefly luciferase (rFF) reporter from subgenomic RNA (SGIα-rFF) were delivered to BHK-21 cells three times by electroporation. After electroporation, a portion of the cells were plated into one well of a 6-well plate and one well of a 96-well plate and allowed to recover for 20 hours. Electroporated cells were stained for the presence of dsRNA, and the frequency of dsRNA-positive cells was determined by flow cytometry to serve as an indicator of replicon amplification. Replicons containing mutant nsP3 were found to replicate to the same level as replicons containing WT nsP3 (Figure 2B). Analysis of luciferase activity revealed no difference between WT-containing replicons and the nsP3 mutant types shown (Figure 2C).

[0128] [Example 2] Expression of heterologous proteins from replicons In this example, we investigated the in vivo expression of recombinant firefly luciferase (rFF) from a replicon encoding the mutant nsP3 shown in Figure 2A (Example 1). Replicon RNA 1 or 10 micrograms in physiological saline were delivered intramuscularly (IM) to the quadriceps femoris muscle of BALB / c mice. At the indicated time points, luciferase activity was monitored in vivo using a commercially available in vivo imaging system and reported as total flux (Figures 3A and 3B). The data indicate that the replicon expressing the mutant form of nsP3 exhibited similar levels of luciferase activity in vivo compared to the replicon containing wild-type nsP3 from VEEV.

[0129] [Example 3] immunogenicity In this example, the immunogenicity of VEEV-based replicons encoding the VEEV / CHIKV chimeric form of nsP3 (from Example 1) was investigated compared to the immunogenicity of replicons containing wild-type (WT) VEEV nsP3. Each replicon encoded and expressed hemagglutinin (HA) from the influenza H5N1 strain as a heterologous protein. 2.0 μg or 0.2 μg of RNA in physiological saline was intramuscularly delivered to the quadriceps femoris muscle of BALB / c mice on day 0, and boosted with the same replicon RNA and dose on day 28. Two weeks after boosting (day 42 post-priming), spleen and serum were collected. Serum was analyzed for HA-specific antibodies by ELISA (Figure 4). The data showed that replicons encoding the VEEV / CHIKV nsP3 chimeric form had significantly lower HA-specific IgG titers compared to replicons containing wild-type nsP3.

[0130] In contrast, analysis of short-lived effector and memory precursor effector CD8+ T cells showed no difference in the frequency of HA-specific cells among the different replicons tested (Figures 5A and 5B). Figure 5A shows that the frequencies of HA-specific short-lived effector CD8+ T cells were similar among the wild-type, VEEV / SINV nsP3, and VEEV / CHIKV nsP3 RNA replicons. Figure 5B shows similar results for memory effector CD8+ T cells.

[0131] Those skilled in the art will readily understand that various substitutions and modifications can be made to the invention disclosed herein without departing from the scope and spirit of the invention.

[0132] All patents and publications referenced herein represent the level of expertise of those skilled in the art to which the present invention pertains.

[0133] The inventions described herein exemplary can be adequately implemented without any elements (singular or plural) or limitations (singular or plural) not specifically disclosed herein. Therefore, for example, in each example herein, any of the terms “includes,” “essentially consists of,” and “consistes of” can be replaced with any of the other two terms. The terms and expressions used are for illustrative purposes only and not limitations. In using such terms and expressions, it is not intended to exclude any equivalents of the exemplary and described features or parts thereof, and it is understood that various modifications are possible within the scope of the claimed invention. In addition, where features or aspects of the invention are described in terms of the Markush group, a person skilled in the art will recognize that the invention also thereby describes any individual member or subgroup of the members of the Markush group. For example, where it is stated that X is selected from the group consisting of bromine, chlorine, and iodine, the claim that X is bromine and the claim that X is bromine and chlorine are also fully described. Other embodiments are within the scope of the following claims. Various embodiments of the present invention are shown below. 1. RNA sequences encoding heterologous proteins or peptides; The 5' and 3' alphavirus untranslated regions; RNA sequences encoding amino acid sequences derived from the non-structural proteins nsP1, nsP2, and nsP4 of the New World Alphavirus; RNA sequences encoding amino acid sequences derived from the alphavirus nsP3 macrodomain; RNA sequence encoding an amino acid sequence derived from the central domain of alphavirus nsP3; a. Amino acid sequence derived from the Old World alphavirus nsP3 hypervariable domain; or b. Amino acid sequences containing portions derived from the New World Alphavirus nsP3 hypervariable domain and portions derived from the Old World Alphavirus nsP3 hypervariable domain RNA sequences encoding amino acid sequences derived from the alphavirus nsP3 hypervariable domain (HVD), including RNA replicons containing this substance. From the 2.5' end to the 3' end, in the following order: (1) an alphavirus 5' untranslated sequence for inducing replication of the alphavirus replicon; (2) RNA sequences encoding the alphavirus non-structural proteins nsP1, nsP2, nsP3, and nsP4; (3) Alphavirus subgenome promoter sequence and; (4) RNA sequences encoding one or more heterologous proteins or peptides; (5) Alphavirus 3' untranslated sequence and Alphavirus replicon RNA containing, The aforementioned nsP1, nsP2, and nsP4 are derived from one or more New World Alpha Viruses. The aforementioned nsP3 comprises, from the amino terminus to the carboxyl terminus, the following in order: alphavirus nsP3 macrodomain, alphavirus nsP3 central domain, and alphavirus nsP3 hypervariable domain (HVD): The macrodomain and the central domain are derived from one or more New World alphaviruses and / or Old World alphaviruses; The HVD includes HVD from Old World Alphavirus, or the HVD includes a portion of HVD from New World Alphavirus and a portion of HVD from Old World Alphavirus. Alphavirus replicon RNA. 3. The RNA replicon described in 1 or 2 above, wherein the alphavirus nsP3 macrodomain and the alphavirus nsP3 central domain are derived from New World Alphavirus. 4. The RNA replicon described in 1 or 2 above, wherein the alphavirus nsP3 macrodomain and the alphavirus nsP3 central domain are derived from Old World alphaviruses. 5. The RNA replicon according to any one of items 1 to 4 above, wherein the alphavirus nsP3 contains an amino acid sequence derived from or the amino acid sequence thereof from the Old World alphavirus nsP3 hypervariable domain. 6. The RNA replicon described in any of items 1 to 5 above, wherein the Old World alphavirus is selected from the group consisting of CHIKV, SINV, and SFV. 7. The RNA replicon described in any of items 1 to 6 above, wherein the New World Alphavirus is Venezuelan Encephalitis Virus (VEEV). 8. The RNA replicon according to any one of 1 to 6 above, wherein the New World alphavirus is selected from the group consisting of Venezuelan horse encephalitis virus (VEEV), Western equine encephalitis virus (WEEV), and Eastern equine encephalitis virus (EEEV). 9. The RNA replicon described in 8 above, wherein the Old World alphavirus is selected from the group consisting of Sindbis virus (SINV), Chikungunya virus (CHIKV), Semryki forest virus (SFV), Ross River virus (RRV), Sagiyama virus (SAGV), Geta virus (GETV), Middleberg virus (MIDV), Beval virus (BEBV), Onyonnyon virus (ONNV), Ndum (NDUV), and Barma forest virus (BFV). 10. The RNA replicon according to any one of 1 to 9 above, wherein the hypervariable domain includes a portion derived from the Old World alphavirus nsP3 hypervariable domain having a motif selected from the group consisting of FGDF (SEQ ID NO: 18) and FGSF (SEQ ID NO: 19). 11. The RNA replicon according to 10, wherein the portion derived from the Old World Alphavirus nsP3 hypervariable domain includes repeats selected from the group consisting of FGDF / FGDF (SEQ ID NO: 20) repeats, FGSF / FGSF (SEQ ID NO: 21) repeats, FGDF / FGSF (SEQ ID NO: 22) repeats, and FGSF / FGDF (SEQ ID NO: 23) repeats, and further, the repeat sequences are separated by at least 10 and 25 or fewer amino acids. 12. The RNA replicon according to 11, wherein the repeat sequence is separated by amino acid sequences derived from the group consisting of NEGEIESLSSELLT (SEQ ID NO: 6), SDGEIDELSRRVTTESEPVL (SEQ ID NO: 7), and DEHEVDALASGIT (SEQ ID NO: 8). 13. The portion derived from the hypervariable domain of the Old World Alpha Virus is a. Amino acids 479-482 or 497-500 or 479-500 or 335-517 of CHIKV nsP3 HVD; or b. Amino acids 451-454 or 468-471 or 451-471 of SFV nsP3 HVD; or c. SINV nsP3 HVD amino acids 490-493 or 513-516 or 490-516 or 335-538 RNA replicons as described in item 10 above, including the above. 14. The portion derived from the Old World Alphavirus hypervariable domain is a. Amino acids 479-500 or 335-517 of CHIKV nsP3 HVD; or b. Amino acids 451-471 of SFV nsP3 HVD; or c. SINV nsP3 HVD amino acids 490-516 RNA replicons as described in item 11 above, including the above. 15. The RNA replicon described in any of items 10 to 14 above, wherein the New World Alphavirus is VEEV, and the portion derived from the New World Alphavirus hypervariable domain does not contain amino acids 478 to 518 of the VEEV nsP3 hypervariable domain. 16. The RNA replicon described in any of items 10 to 14 above, wherein the New World Alphavirus is VEEV, and the portion derived from the New World Alphavirus hypervariable domain does not contain amino acids 478 to 545 of the VEEV nsP3 hypervariable domain. 17. The RNA replicon described in any of 1 to 14 above, wherein the New World Alphavirus is VEEV, and the portion derived from the New World Alphavirus hypervariable domain does not contain amino acids 335-518 of the VEEV nsP3 hypervariable domain. 18. The RNA replicon described in 17 above, wherein the Old World alphavirus is CHIKV, and the portion derived from the Old World alphavirus hypervariable domain contains amino acids 335-517 of CHIKV. 19. The RNA replicon described in 17 above, wherein the Old World alphavirus is a SINV, and the portion derived from the Old World alphavirus hypervariable domain contains amino acids 335-538 of the SINV. 20. The RNA replicon described in any of items 10 to 14 above, wherein the New World Alphavirus is EEEV, and the portion derived from the New World Alphavirus hypervariable domain does not contain amino acids 531-547 of the EEEV nsP3 hypervariable domain. 21. The New World Alphavirus is EEEV, and the portion derived from the New World Alphavirus hypervariable domain does not contain amino acids 531-547 of the EEEV nsP3 hypervariable domain, and the portion derived from the Old World Alphavirus hypervariable domain, a. Amino acids 479-500 of CHIKV nsP3 HVD; b. Amino acids 451-471 of SFV nsP3 HVD; or c. SINV nsP3 HVD amino acids 490-516 RNA replicons as described in item 20 above, including the RNA replicons described in item 20 above. 22. The RNA replicon described in any of items 10 to 14 above, wherein the New World Alphavirus is WEEV, and the portion derived from the New World Alphavirus hypervariable domain does not contain amino acids 504-520 of the WEEV nsP3 hypervariable domain. 23. The New World Alphavirus is WEEV, and the portion derived from the New World Alphavirus hypervariable domain does not contain amino acids 504-520 of the WEEV nsP3 hypervariable domain, and the portion derived from the Old World Alphavirus hypervariable domain, a. Amino acids 479-500 of CHIKV nsP3 HVD; b. Amino acids 451-471 of SFV nsP3 HVD; or c. SINV nsP3 HVD amino acids 490-516 RNA replicons as described in item 22 above, including the RNA replicons described in item 22 above. 24. The RNA replicon according to any one of 1 to 23 above, further comprising a subgenome promoter operably ligated to the RNA sequence encoding the heterologous protein and regulating the translation of the RNA sequence. An RNA replicon according to any one of items 1 to 24 above, further comprising a 25.5' cap and a 3' poly-A tail. 26. An RNA replicon as described in any of items 1 to 25 above, containing positive sense single-stranded RNA. An RNA replicon according to any of the above 1 to 26, containing RNA of 27.10 to 12 kb and having a diameter of 30 to 50 nm. 28. The RNA replicon according to any one of items 1 to 27 above, wherein the heterologous protein is a protein or peptide of a biological preparation. 29. An RNA replicon according to any of items 1 to 28 above, wherein the heterologous protein is an antibody. 30. The RNA replicon according to 1 or 2 above, wherein the new world alphavirus is VEEV, and the HVD comprises a portion derived from the new world alphavirus nsP3 hypervariable domain that does not contain amino acids 335-518 of the VEEV nsP3 hypervariable domain, and a portion derived from the old world alphavirus nsP3 hypervariable domain having amino acids 490-493 or 513-516 or 490-516 or 335-538 of the SINV nsP3 HVD. 31. The RNA replicon described in 30 above, wherein the portion derived from the Old World alphavirus nsP3 hypervariable domain contains amino acids 490-516 of SINV nsP3 HVD. 32. The RNA replicon according to 30, wherein the Old World alphavirus is a SINV, and the portion derived from the Old World alphavirus nsP3 hypervariable domain contains amino acids 335-538 of the SINV nsP3 HVD. 33. The RNA replicon according to 1 or 2 above, wherein the RNA sequence encoding a heterogeneous protein or peptide is operably linked to the RNA sequences encoding nsP1, nsP2, and nsP4. 34. A method for administering a heterologous protein or peptide to a mammal, comprising the step of administering an RNA replicon according to any of items 1 to 33 above that encodes the heterologous protein or peptide, wherein the heterologous protein or peptide is expressed in the mammal. 35. The method according to 34, wherein the New World Alphavirus is VEEV and the RNA replicon is the replicon described in 14 above. 36. The method according to 34, wherein the RNA replicon is the replicon described in 19 above. 37. The method according to 34, wherein the RNA replicon is the replicon described in 22 above. 38. The method according to 34, wherein the RNA replicon is the replicon described in 25 above. 39. RNA sequences encoding heterologous proteins or peptides; RNA sequences encoding amino acid sequences derived from the non-structural proteins nsP1, nsP2, and nsP4 of the New World Alphavirus; An RNA replicon comprising an RNA sequence encoding an amino acid sequence derived from the nsP3 protein of an Old World alphavirus, wherein the first 1 to 6 amino acids at the N-terminus and / or C-terminus of the nsP3 protein are derived from the New World alphavirus sequence.

Claims

1. It is an RNA replicon, (i) an RNA sequence encoding a heterologous protein or peptide; (ii) 5' and 3' alphavirus untranslated regions; (iii) Includes RNA sequences encoding nsP1, nsP2, nsP3, and nsP4, the amino acid sequences of nsP1, nsP2, and nsP4 are derived from non-structural proteins of the New World Alphavirus, and nsP3 is a non-structural protein, with the amino terminus to the carboxyl terminus in the following order: (a) Amino acid sequence derived from the alphavirus nsP3 macrodomain; (b) an amino acid sequence derived from the central domain of alphavirus nsP3; and (c) Amino acid sequence derived from an alphavirus nsP3 hypervariable domain (HVD) containing at least a portion of an alphavirus nsP3 hypervariable domain (HVD) containing an FGDF (SEQ ID NO: 18) or FGSF (SEQ ID NO: 19) motif The former world alphavirus nsP3HVD includes, a. An amino acid sequence derived from the Old World Alphavirus nsP3 hypervariable domain, which includes the portion of the Old World Alphavirus nsP3HVD; or b. Amino acid sequences containing the portion derived from the New World Alphavirus nsP3 hypervariable domain and the portion of the Old World Alphavirus nsP3 hypervariable domain. Includes, The portion derived from the Old World Alphavirus nsP3 hypervariable domain includes amino acids 335-517 of CHIKV nsP3 HVD consisting of the amino acid sequence described in SEQ ID NO: 26, or amino acids 335-538 of SINV nsP3 HVD consisting of the amino acid sequence described in SEQ ID NO: 25, and the region derived from the New World Alphavirus nsP3 hypervariable domain, including the FXR binding site, is replaced by the portion derived from the Old World Alphavirus nsP3 hypervariable domain. The replicon does not encode at least one of proteins C and E1. RNA replicon.

2. It is an RNA replicon, From the 5' end to the 3' end, in the following order: (1) an alphavirus 5' untranslated sequence for inducing replication of the RNA replicon; (2) RNA sequences encoding the alphavirus non-structural proteins nsP1, nsP2, nsP3, and nsP4; (3) Alphavirus subgenome promoter sequence and; (4) RNA sequences encoding one or more heterologous proteins or peptides; (5) Alphavirus 3' untranslated sequence and Includes, The aforementioned nsP1, nsP2, and nsP4 are derived from one or more New World Alphaviruses, The aforementioned nsP3 comprises, from the amino terminus to the carboxyl terminus, an alphavirus nsP3 macrodomain, an alphavirus nsP3 central domain, and an alphavirus nsP3 hypervariable domain (HVD), in the following order: The macrodomain and the central domain are derived from one or more New World alphaviruses and / or Old World alphaviruses; The HVD includes an HVD of Old World Alphavirus, or the HVD includes a portion of an HVD from New World Alphavirus and a portion of an HVD from Old World Alphavirus, and the replicon does not encode at least one of proteins C and E1. The portion derived from the Old World Alphavirus nsP3 hypervariable domain includes amino acids 335-517 of CHIKV nsP3 HVD consisting of the amino acid sequence described in SEQ ID NO: 26, or amino acids 335-538 of SINV nsP3 HVD consisting of the amino acid sequence described in SEQ ID NO: 25, and the region derived from the New World Alphavirus nsP3 hypervariable domain, including the FXR binding site, is replaced by the portion derived from the Old World Alphavirus nsP3 hypervariable domain. An RNA replicon in which the portion of the HVD from the aforementioned Old World Alphavirus contains an FGDF (SEQ ID NO: 18) or FGSF (SEQ ID NO: 19) motif.

3. The RNA replicon according to claim 1 or 2, wherein the alphavirus nsP3 macrodomain and the alphavirus nsP3 central domain are derived from New World Alphavirus.

4. The RNA replicon according to claim 1 or 2, wherein the alphavirus nsP3 macrodomain and the alphavirus nsP3 central domain are derived from Old World alphaviruses.

5. The RNA replicon according to any one of claims 1 to 4, wherein the New World alphavirus is Venezuelan encephalitis virus (VEEV).

6. The RNA replicon according to any one of claims 1 to 4, wherein the New World alphavirus is selected from the group consisting of Venezuelan horse encephalitis virus (VEEV), Western equine encephalitis virus (WEEV), and Eastern equine encephalitis virus (EEEV).

7. The RNA replicon according to any one of claims 1 to 5, wherein the new world alphavirus is VEEV, and the portion derived from the old world alphavirus substituted amino acids 478 to 518 of the VEEV nsP3 hypervariable domain, which consists of the amino acid sequence described in SEQ ID NO:

27.

8. The RNA replicon according to any one of claims 1 to 5, wherein the new world alphavirus is VEEV, and the portion derived from the old world alphavirus substituted amino acids 478 to 545 of the VEEV nsP3 hypervariable domain, which consists of the amino acid sequence described in SEQ ID NO:

27.

9. The RNA replicon according to any one of claims 1 to 5, wherein the new world alphavirus is VEEV, and the portion derived from the old world alphavirus substituted amino acids 335 to 518 of the VEEV nsP3 hypervariable domain, which consists of the amino acid sequence described in SEQ ID NO:

27.

10. The RNA replicon according to claim 9, wherein the Old World alphavirus is CHIKV, and the portion derived from the Old World alphavirus nsP3 hypervariable domain comprises amino acids 335 to 517 of the CHIKV nsP3 hypervariable domain, which consists of the amino acid sequence described in SEQ ID NO:

26.

11. The RNA replicon according to claim 9, wherein the Old World alphavirus is SINV, and the portion derived from the Old World alphavirus nsP3 hypervariable domain comprises amino acids 335 to 538 of the SINV nsP3 hypervariable domain consisting of the amino acid sequence described in SEQ ID NO:

25.

12. The RNA replicon according to any one of claims 1 to 11, further comprising a subgenome promoter operably ligated to the RNA sequence encoding the heterologous protein and regulating the translation of the RNA sequence.

13. The RNA replicon according to any one of claims 1 to 12, further comprising a 5' cap and a 3' poly-A tail.

14. An RNA replicon according to any one of claims 1 to 13, comprising RNA of 10 to 12 kb and having a diameter of 30 to 50 nm.

15. The RNA replicon according to any one of claims 1 to 14, wherein the heterologous protein is a protein or peptide of a biological product.

16. The RNA replicon according to any one of claims 1 to 15, wherein the heterologous protein is an antibody.

17. The RNA replicon according to claim 1 or 2, wherein the RNA sequence encoding the heterogeneous protein or peptide is operably linked to the RNA sequences encoding nsP1, nsP2, and nsP4.

18. A composition for use in a method of administering a heterologous protein or peptide to a mammal, comprising an RNA replicon according to any one of claims 1 to 17 that encodes the heterologous protein or peptide, wherein the heterologous protein or peptide is expressed in the mammal.

Citation Information

Patent Citations

  • Chimeric alphavirus replicon particles

    JP2005515755A

  • Alphavirus vectors for respiratory pathogen vaccines

    JP2008500399A

  • Recombinant virus replicon systems and uses thereof

    WO2018075235A1