Anti-galectin 3 antibodies and their use in epilepsy and related diseases

Abstract

Provided herein are antibodies that target Galectin-3. Such antibodies are used in methods of treating epilepsy and related neurological disorders, such as Alzheimer's disease (AD) and Parkinson's disease (PD).

Description

Title of Invention: ANTI-GALECTIN 3 ANTIBODIES AND THEIR USE IN EPILEPSY AND RELATED DISEASES [] CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application claims priority to International Application No. PCT / CN2024 / 080726, filed March 8, 2024, the disclosure of which is herein incorporated by reference in its entirety for all purposes. SEQUENCE LISTING

[0002] The instant application contains a Sequence Listing which has been submitted herewith and is hereby incorporated by reference in its entirety. Said . xml copy, created on March 4, 2025 is named 112130-1470321-000110WO, and is 452, 667 bytes in size. BACKGROUND

[0003] Epilepsy is a neurological disease characterized by recurrent spontaneous seizures. Despite the efficacy of current anti-epileptic drugs, almost 30%of patients with epilepsy are refractory to medical treatment, have progressive cognitive impairment, and may require neurosurgical resection of the epileptic focus to alleviate seizure recurrence. Although the exact cellular and molecular mechanisms of epileptogenesis are not clear, it is postulated that focal or systemic unregulated inflammatory processes lead to aberrant neural connectivity and the hyper-excitable neuronal network, which mediate the onset of epilepsy. Epileptogenesis is associated with an increased and persistent inflammatory state in the microenvironment of neural tissues, which can lead to the production of cytokines by glial cells and neurons. A safe and efficient treatment of epilepsy and / or related neurological disorders is highly needed. SUMMARY

[0004] In one aspect, provided herein is an antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a heavy chain variable (VH) region comprising: a HCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 1-21 and 370-389, a HCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 22-42 and 390-417, and / or a HCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 43-63 and 418-439, and / or a light chain variable (VL) region comprising: a LCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 169-189 and 440-462, a LCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 190-210 and 463-480, and / or a LCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 211-231 and 481-507. In some embodiments, the Galectin-3 is human Galectin-3.

[0005] In some embodiments, the antibody comprises: a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 1, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 22, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 43; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 169, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 190, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 211, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 2, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 23, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 44; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 170, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 191, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 212, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 3, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 24, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 45; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 171, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 192, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 213, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 25, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 46; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 172, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 193, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 214, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 5, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 26, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 47; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 173, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 194, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 215, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 6, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 27, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 48; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 174, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 195, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 216, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 7, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 28, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 49; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 175, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 196, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 217, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 8, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 29, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 50; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 176, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 197, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 218, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 9, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 30, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 51; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 177, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 198, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 219, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 10, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 31, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 52; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 178, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 199, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 220, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 11, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 32, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 53; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 179, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 200, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 221, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 12, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 33, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 54; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 180, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 201, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 222, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 13, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 34, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 55; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 181, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 202, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 223, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 14, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 35, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 56; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 182, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 203, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 224, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 15, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 36, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 57; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 183, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 204, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 225, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 16, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 37, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 58; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 184, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 205, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 226, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 17, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 38, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 59; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 185, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 206, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 227, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 18, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 39, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 60; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 186, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 207, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 228, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 19, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 40, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 61; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 187, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 208, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 229, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 20, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 41, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 62; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 188, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 209, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 230, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 21, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 42, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 63; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 189, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 210, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 231.

[0006] In some embodiments, the antibody comprises: a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 370, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 390, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 418; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 440, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 463, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 481, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 371, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 391, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 418; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 441, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 464, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 482, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 372, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 392, and a HCDR3 amino acid sequence at least 70% identical to DNL; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 442, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 465, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 483, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 373, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 393, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 419; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 443, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 466, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 484, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 374, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 394, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 420; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 444, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 467, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 485, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 375, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 395, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 421; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 445, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 468, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 486, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 376, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 396, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 422; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 446, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 469, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 487, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 373, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 393, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 419; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 447, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 484, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 449, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 450, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 398, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 424; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 489, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 490, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 398, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 491, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 399, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 424; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 489, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 424; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 400, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 451, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 473, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 492, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 401, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 473, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 493, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 402, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 473, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 493, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 379, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 403, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 380, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 403, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 380, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 403, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 381, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 404, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 381, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 404, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 495, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 381, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 405, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 406, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 427; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 496, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 407, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 475, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 496, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 428; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 454, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 497, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 429; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 455, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 476, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 498, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 429; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 454, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 468, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 497, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 430; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 454, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 477, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 497, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 383, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 409, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 431; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 456, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 499, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 383, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 409, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 431; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 456, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 478, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 499, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 384, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 410, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 431; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 457, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 500, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 384, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 410, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 432; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 458, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 500, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 385, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 411, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 433; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 459, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 501.

[0007] In some embodiments, the antibody comprises: a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 386, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 412, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 434; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 460, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 479, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 502, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 387, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 413, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 435; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 461, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 201, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 503, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 414, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 436; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 462, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 480, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 504, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 388, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 415, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 437; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 461, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 201, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 505, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 416, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 438; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 462, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 480, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 506, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 414, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 436; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 462, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 480, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 507.

[0008] In some embodiments, the antibody comprises: a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 389, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 417, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 439.

[0009] In some embodiments, the antibody comprises all six CDRs of an antibody selected from the group consisting of 1104SBC1068-033, 1104SBC1068-335, 1104SBC1068-365, 1104SBC1068-374, 1104SBC1068-378, 1220SBC1068-022, 1220SBC1068-035, 1220SBC1068-041, 1220SBC1068-056, 1220SBC1068-058, 1220SBC1068-063, 1220SBC1068-097, 1220SBC1068-098, 1220SBC1068-099, 1220SBC1068-129, 1220SBC1068-164, 1220SBC1068-186, 1220SBC1068-197, 1220SBC1068-210, 1220SBC1068-274 and 1220SBC1068-281.

[0009] In some embodiments, the antibody or the binding fragment thereof comprises: a VH region comprising a VH amino acid sequence at least 70% identity to any one of SEQ ID NOS: 148-168, 353, and 355; and / or a VL region comprising a VL amino acid sequence at least 70%identity to any one of SEQ ID NOS: 316-336, 354, and 356.

[0010] In some embodiments, the antibody or the binding fragment thereof comprises: a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 148, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 316; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 149, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 317; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 150, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 318; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 151, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 319; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 152, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 320; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 153, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 321; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 154, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 322; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 155, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 323; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 156, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 324; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 157, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 325; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 158, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 326; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 159, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 327; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 160, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 328; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 161, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 329; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 162, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 330; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 163, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 331; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 164, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 332; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 165, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 333; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 166, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 334; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 167, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 335; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 168, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 336; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 353, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 354; or a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 355, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 356.

[0011] In some embodiments, the antibody or the binding fragment thereof comprises both the VH and VL of an antibody selected from the group consisting of 1104SBC1068-033, 1104SBC1068-335, 1104SBC1068-365, 1104SBC1068-374, 1104SBC1068-378, 1220SBC1068-022, 1220SBC1068-035, 1220SBC1068-041, 1220SBC1068-056, 1220SBC1068-058, 1220SBC1068-063, 1220SBC1068-097, 1220SBC1068-098, 1220SBC1068-099, 1220SBC1068-129, 1220SBC1068-164, 1220SBC1068-186, 1220SBC1068-197, 1220SBC1068-210, 1220SBC1068-274, 1220SBC1068-281, SIF-001, SIF-002, and a variant thereof.

[0012] In some embodiments, the antibody is a humanized, chimeric, or human antibody.

[0013] In yet another aspect, provided herein is a polypeptide comprising a VH sequence and / or a VL sequence of an antibody described above. In some embodiments, provided herein is a polynucleotide encoding the polypeptide. In some embodiments, provided herein is an expression vector comprising the polynucleotide. In some embodiments, provided herein is a cell that comprises the expression vector of claim 11.

[0014] In some embodiments, provided herein is a kit that comprises an antibody, a polypeptide, a polynucleotide, an expression vector, and / or a cell of described above.

[0015] In some embodiments, provided herein is a pharmaceutical composition comprising an antibody described above and a pharmaceutically acceptable carrier.

[0016] In yet another aspect, provided herein is a method of treating epilepsy or a related neurological disorder (e.g., Alzheimer’s disease (AD) or Parkinson’s disease (PD)) in a subject in need thereof, comprising administering the subject an effective amount of the pharmaceutical composition above. In some embodiments, the effective amount is about 5-100 mg / kg of the antibody or the immunoconjugate per the subject’s body weight. In some embodiments, the effective amount is about 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, and 100 mg / kg of the antibody or the immunoconjugate per the subject’s body weight or an amount within a range defined by any of the two values above. In some embodiments, the pharmaceutical composition is administered intravenously into the subject. In some embodiments, the pharmaceutical composition is administered more than once, such as two, three, four, or more times. In some embodiments, each administration is at least 7 days apart. In some embodiments, each administration is at least 14 days apart. In some embodiments, each administration is at least four weeks apart.

[0017] In some embodiments, the method for treating epilepsy, an inflammatory or fibrotic disease, or a related neurological disorder (e.g., Alzheimer’s disease (AD) or Parkinson’s disease (PD)) in a subject in need thereof, comprising administering to the subject an antibody comprising a means for binding to Galectin-3, for example, a human Galectin-3. In some embodiments, the neurological disorder is Alzheimer’s disease (AD) or Parkinson’s disease (PD).

[0018] In some embodiments, the antibody is administered in combination with an additional therapeutic agent. In some embodiments, the antibody is administered intravenously into the subject. In some embodiments, the administration dosage of the antibody is between about 5-100 mg / kg per the subject’s body weight. In some embodiments, the administration dosage of the antibody is about 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, and 100 mg / kg of the antibody or the immunoconjugate per the subject’s body weight or a dosage within a range defined by any of the two values above.

[0019] In some embodiments, provided herein is an antibody or a binding fragment thereof for use in the treatment of epilepsy or a related neurological disorder (e.g., Alzheimer’s disease (AD) or Parkinson’s disease (PD)) in a subject, wherein the antibody comprises: a heavy chain variable (VH) region comprising: a HCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 1-21 and 481-507, a HCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 22-42 and 390-417, and / or a HCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 43-63 and 418-439, and / or a light chain variable (VL) region comprising: a LCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 169-189 and 440-462, a LCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 190-210 and 463-480, and / or a LCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 211-231 and 481-507.

[0020] In some embodiments, provided herein is an antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a heavy chain variable region comprising: a HCDR1 comprising a sequence NYGMN (SEQ ID NO: 4) , or a variant HCDR1 in which 1, 2, or 3 amino acids are substituted relative to the sequence; a HCDR2 comprising a sequence WINTYTGEPTYADDFKG (SEQ ID NO: 25) , or a variant HCDR2 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a HCDR3 comprising a sequence YAMDY (SEQ ID NO: 46) , or a variant HCDR3 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a light chain variable region comprising: a LCDR1 comprising a sequence RSSTGAVTTSNYAN (SEQ ID NO: 172), or a variant LCDR1 in which 1 amino acid is substituted relative to the sequence; a LCDR2 comprising a sequence GTSNRAP (SEQ ID NO: 193), or variant LCDR2 in which 1 amino acid is substituted relative to the sequence; and a LCDR3 comprising a sequence ALWYSTHYV (SEQ ID NO: 214) , or a variant LCDR3 in which 1 amino acid is substituted relative to the sequence, optionally, the substitution in HCDR1 is in any of the residue #1, and #3-#5, wherein the substitution in HCDR2 is in any of the residue #2, #4-#17, wherein the substitution in HCDR3 is in any of the residues #2-#4, wherein the substitution in LCDR1 is in any of the residues #1-#11 and #13-#14, and / or wherein the substitution in LCDR3 is in any of the residues #l-#2, #4-#7, and #9.

[0021] In some embodiments, the amino acid ( “aa” ) at position #2 residue in HCDR1 of the antibody above is Y, W, or F, wherein the aa at position #1 residue in HCDR2 is W, Y, or F, and aa at position #3 residue in HCDR1 is N or Q, wherein the aa at position #1 residue in HCDR3 is Y, wherein the aa at position #12 residue in LCDR1 is Y, W, or F, wherein the aa at position #3 in LCDR3 is Y, W, or F, and aa at position #8 residue in LCDR3 is Y, W, or F.

[0022] In some embodiments, disclosed herein is an antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a heavy chain variable region comprising: a HCDR1 comprising a sequence RFWMS (SEQ ID NO: 8), or a variant HCDR1 in which 1, 2, or 3 amino acids are substituted relative to the sequence; a HCDR2 comprising a sequence EISPDSNTIDLTPSLKD (SEQ ID NO: 29) , or a variant HCDR2 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a HCDR3 comprising a sequence PYYGYY (SEQ ID NO: 50), or a variant HCDR3 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a light chain variable region comprising: a LCDR1 comprising a sequence RSSQSLFNSTNQKNYLT (SEQ ID NO: 176) or RSSQSLFSSTNQKNYLT (SEQ ID NO: 369), or a variant LCDR1 in which 1 amino acid is substituted relative to the sequence; a LCDR2 comprising a sequence WASSRES (SEQ ID NO: 197), or variant LCDR2 in which 1 amino acid is substituted relative to the sequence; and a LCDR3 comprising a sequence QNDYTSPFT (SEQ ID NO: 218), or a variant LCDR3 in which 1 amino acid is substituted relative to the sequence.

[0023] In some embodiments, the substitution in HCDR1 in the antibody above is in any of the residue #1-2, and #4-#5, the substitution in HCDR2 is in any of the residue #2-#17, the substitution in HCDR3 is in any of the residues #l-#4 and #6, the substitution in LCDR1 is in any of the residues #1-#14 and #16-#17, and the substitution in LCDR3 is in any of the residues #l-#2, #4-#9.

[0024] In some embodiments, the aa at position #3 residue in HCDR1 is Y, W, or F, the aa at position #1 residue in HCDR2 is E or D, the aa at position #5 residue in HCDR3 is Y, W, or F, the aa at position #15 residue in LCDR1 is Y, W, or F, and / or the aa at position #3 in LCDR3 is Y.

[0025] In some embodiments, provided herein is an antibody competes for binding to GAL-3 with an antibody disclosed herein.

[0026] In some embodiments, provided herein is an antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of NX2GMN (SEQ ID NO: 357), wherein X2 is Y, W, or F, wherein the HCDR1 has zero or one aa substitution in rest of the residues relative to the HCDR1 sequence, a HCDR2 comprising a sequence of XJX^YTGEPTYADDFKG (SEQ ID NO:358), Where Xi is W, Y, or F, and wherein X3 is N or Q, wherein the HCDR2 has zero, one, two, three, or four aa substitutions in rest of the residues relative to the HCDR2 sequence, a HCDR3 comprising a sequence of YAMDY (SEQ ID NO: 359), wherein the HCDR3 has zero, one, or two aa substitutions relative to the HCDR3 sequence, a LCDR1 comprising a sequence of RSSTGAVTTSNX12AN (SEQ ID NO: 360), wherein Xn is Y, W, or F, wherein the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, a LCDR2 comprising a sequence of GTSNRAP (SEQ ID NO: 361), wherein the LCDR2 has zero, one, two, or three aa substitutions in the rest of the residues relative to the LCDR2 sequence, and a LCDR3 comprising a sequence of ALX3YSTHX8V (SEQ ID NO: 362), wherein X3 is Y, W, or F, wherein X8 is Y, W, or F, wherein the LCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the LCDR3 sequence.

[0027] In some embodiments, provided herein is an antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of NX2GMN (SEQ ID NO: 357), wherein X2 is Y, W, or F, a HCDR2 comprising a sequence of XiIX3TYTGEPTYADDFKG (SEQ ID NO: 358), Where Xi is W, Y, or F, and wherein X3 is N or Q, a HCDR3 comprising a sequence of YAMDY (SEQ ID NO: 359), a LCDR1 comprising a sequence of RSSTGAVTTSNX12AN (SEQ ID NO: 360), wherein Xi2 is Y, W, or F, a LCDR2 comprising a sequence of GTSNRAP (SEQ ID NO: 361), and a LCDR3 comprising a sequence of ALX3YSTHX8V (SEQ ID NO: 362), wherein X3 is Y, W, or F, wherein X8 is Y, W, or F; wherein the HCDR1 has zero or one aa substitution in rest of the residues relative to the HCDR1 sequence, the HCDR2 has zero, one, two, three, or four aa substitutions in rest of the residues relative to the HCDR2 sequence, the HCDR3 has zero, one, or two aa substitutions relative to the HCDR3 sequence, the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, the LCDR2 has zero, one, two, or three aa substitutions in the rest of the residues relative to the LCDR2 sequence, and / or the LCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the LCDR3 sequence.

[0028] In some embodiments, provided herein is an antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of RFX3MS (SEQ ID NO: 363), wherein X3 is Y, W, or F, and wherein the HCDR1 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR1 sequence, a HCDR2 comprising XJSPDSNTIDLTPSLKD (SEQ ID NO: 364), wherein X! is E or D, and wherein the HCDR2 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the HCDR2 sequence, a HCDR3 comprising PYYGX5Y (SEQ ID NO: 365), wherein X5 is Y, W, or F, wherein the HCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR3 sequence, a LCDR1 comprising RSSQSLFSSTNQKNX15LT (SEQ ID NO: 366) , wherein X15 is Y, W, or F, wherein the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, a LCDR2 comprising WASSRES (SEQ ID NO: 367) , wherein the LCDR2 has zero, one, two, or three aa substitutions relative to the LCDR2 sequence, and / or a LCDR3 comprising QNDYTSPFT (SEQ ID NO: 368), wherein the LCDR3 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR3 sequence.

[0029] In some embodiments, provided herein is an antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of RFX3MS (SEQ ID NO: 363), wherein X3 is Y, W, or F, a HCDR2 comprising XJSPDSNTIDLTPSLKD (SEQ ID NO: 364), wherein X! is E or D, a HCDR3 comprising PYYGX5Y (SEQ ID NO: 365), wherein X5 is Y, W, or F, a LCDR1 comprising RSSQSLFSSTNQKNX15LT (SEQ ID NO: 366) , wherein X15 is Y, W, or F, a LCDR2 comprising WASSRES (SEQ ID NO: 367) , and a LCDR3 comprising QNDYTSPFT (SEQ ID NO: 368) ; and wherein the HCDR1 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR1 sequence, the HCDR2 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the HCDR2 sequence, the HCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR3 sequence, the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, the LCDR2 has zero, one, two, or three aa substitutions relative to the LCDR2 sequence, and / or the LCDR3 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR3 sequence.

[0030] In some embodiments, provided herein is an antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises a HCDR1 comprising a sequence of NYGMN (SEQ ID NO: 4), a HCDR2 comprising a sequence of WINTYTGEPTYADDFKG (SEQ ID NO: 25) , a HCDR3 comprising a sequence of YAMDY (SEQ ID NO: 46) , a LCDR1 comprising a sequence of RSST-GAVTTSNYAN (SEQ ID NO: 172), a LCDR2 comprising a sequence of GTSNRAP (SEQ ID NO: 193), and a LCDR3 comprising a sequence of ALWYSTHYV (SEQ ID NO: 214).

[0031] In some embodiments, provided herein is an antibody comprises a VH region comprising a sequence of SEQ ID NO: 353, and a VL region comprising a sequence of SEQ ID NO: 354.

[0032] In some embodiments, provided herein is an antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises a HCDR1 comprising a sequence of RFWMS (SEQ ID NO: 8) , a HCDR2 comprising a sequence of EISPDSNTIDLTPSLKD (SEQ ID NO: 29), a HCDR3 comprising a sequence of PYYGYY (SEQ ID NO: 50), a LCDR1 comprising a sequence of RSSQSLFNSTNQKNYLT (SEQ ID NO: 176) or RSSQSLFSSTNQKNYLT (SEQ ID NO: 369), a LCDR2 comprising a sequence of WASSRES (SEQ ID NO: 197), and a LCDR3 comprising a sequence of QNDYTSPFT (SEQ ID NO: 218).

[0033] In some embodiments, provided herein is an antibody comprises a VH region comprising a sequence of SEQ ID NO: 355, and a VL region comprising a sequence of SEQ ID NO: 356.

[0034] As disclosed herein, any of the embodiments described above can be combined with any other embodiments disclosed above, provided that the resulting combined em bodiment remains operable and feasible. Such resulting combined embodiments are also within the scope of the disclosure. BRIEF DESCRIPTION OF THE DRAWINGS

[0035] FIGS. 1A-1D depict a kinetics analysis of in vitro cross-species reactivity of SIF001 against GAL-3 in (A) human, (B) mouse, (C) rat, and (D) monkey samples.

[0036] FIG. 2 depicts the effect of SIF001 on TNFa release in microglia BV2 cells stimulated with LPS.

[0037] FIG. 3 depicts the effect of SIF001 on epilepsy model in microglia BV2 cells stimulated by KA via cell immunofluorescence assay.

[0038] FIG. 4A depicts a study schema of the evaluation SIF001 therapeutic effects in epilepsy model in C57BL / 6J mouse stimulated by KA. FIGS. 4B-4E depict the effects of SIF001 in epilepsy model in C57BL / 6J mouse stimulated by KA, as evaluated in (B) seizure occurring rate, (C) seizure frequency, (D) seizure severity, and (E) seizure duration.

[0039] FIG. 5 depicts the effects of SIF001 on the ionized calcium-binding adaptor molecule 1 (Ibal) in hippocampus in epilepsy model of C57BL / 6J mouse stimulated by KA.

[0040] FIG. 6 depicts the effects of SIF001 on the Glial fibrillary acidic protein (GFAP) in hippocampus in epilepsy model of C57BL / 6J mouse stimulated by KA.

[0041] FIG. 7 depicts the alanine scanning of SIF001 CDRs. (A) Alanine scanning of SIF001 heavy chain CDRs (SEQ ID Nos: 4, 25, and 46) indicates that the amino acid residues: Y32 and G33 in HCDR1, W50 and N52 in HCDR2; and Y99 in HCDR3 (respectively underlined in the CDR sequences in the table) are essential to the antibody SIF001 binding to the antigen GAL-3. (B) Alanine scanning of SIF001 light chain CDRs (SEQ ID Nos: 172, 193, and 214) indicates that the amino acid residues: Y34 in LCDR1, and W93 and Y98 in LCDR3 (respectively underlined in the CDR sequences in the table) are essential to the antibody SIF001 binding to the antigen GAL-3.

[0042] FIG. 8 depicts the antigen binding effects of anti-GAL-3 antibodies derived from SIF001 with one amino acid substitution in the CDR regions. (A) indicates that a Y32W, Y32F, W50T, W50F, or N53Q mutation in the HCDR regions (SEQ ID Nos: 358-359) of SIF001 heavy chain does not impact antibody binding to the antigen GAL-3. (B) indicates that a Y34W, Y34F, W93Y, W93F, Y98W, or Y98F mutation in the LCDR regions (SEQ ID Nos: 360-362) of SIF001 light chain does not impact antibody binding to the antigen GAL-3.

[0043] FIG. 9 depicts the alanine scanning of SIF002 CDRs. (A) Alanine scanning of SIF002 heavy chain CDRs (SEQ ID Nos: 8, 29, and 50) indicates that the amino acid residues: W33 in HCDR1, E50 in HCDR2; and Y103 in HCDR3 (respectively underlined in the CDR sequences in the table) are essential to the antibody SIF002 binding to the antigen GAL-3. (B) Alanine scanning of SIF002 light chain CDRs (SEQ ID Nos: 369, 197, and 218) indicates that the amino acid residues: Y38 in LCDR1, and D97 in LCDR3 (respectively underlined in the CDR sequences in the table) are essential to the antibody SIF002 binding to the antigen GAL-3.

[0044] FIG. 10 depicts the antigen binding effects of anti-GAL-3 antibodies derived from SIF002 with one amino acid substitution in the CDR regions. (A) indicates that a W33Y, W33F, E50D, Y103W, or Y103F mutation in the HCDR regions (SEQ ID Nos: 363-365) of SIF002 heavy chain does not impact antibody binding to the antigen GAL-3. (B) indicates that a Y38W, or Y38F mutation in the LCDR regions (SEQ ID Nos: 366-368) of SIF002 light chain does not impact antibody binding to the antigen GAL-3.

[0045] FIG. 11 depicts the antibody SIF001 prevents seizure occurring in a dose-dependent manner in mice, as measured in seizure frequency (A), seizure severity (B), and seizure duration (C).

[0046] FIG. 12 depicts SEC of the Gal3-e-Fab complex.

[0047] FIG. 13 depicts SDS-PAGE of Gal3-e-Fab complex.

[0048] FIG. 14 depicts local density map of Gal3-e, a Galectin-3 epitope sequence (SEQ ID NO: 508).

[0049] FIG. 15 depicts interface between Gal3-e and Fab.

[0050] FIG. 16 depicts interactions between Gal3-e (SEQ ID NO: 508) and Fab of the SIF001 antibody with HCDR1 (SEQ ID NO: 2), HCDR2 (SEQ ID NO: 25), HCDR3 (SEQ ID NO: 46), LCDR1 (SEQ ID NO: 172), LCDR2 (SEQ ID NO: 193), and LCDR3 (SEQ ID NO: 214). Bold amino acids of the Gal3-e sequence indicate these residues are essential for Fab binding. The boxed sequence of the Gal3-e sequence indicates these residues are traced in the density map. The trace lines represent weak interactions; the bolded trace lines represent stronger interactions, and the dashed trace lines represent potential interactions.

[0051] FIG. 17 depicts study design and dosing regimen of the mouse study to evaluate the therapeutic effects of mSIFOOl in the Parkinson’s disease mimic mouse model.

[0052] FIG. 18 depicts Galectin-3 intrinsically promotes oligomerization of Alpha synuclein (a-Synuclein).

[0053] FIG. 19 depicts stereotactic injection of a-Synuclein oligomers leads to locomotor dysfunction.

[0054] FIG. 20 depicts treatment with mSIFOOlsignificantly improved locomotor function as compared to the isotype control antibody treatment using rotarod.

[0055] FIG. 21 depicts treatment with SF001 Ab significantly reduced activated microglia probed with IBA-1 Ab (B) and aggregated a-Synuclein (C) in the PD mimic model in the selected region of substantia nigra in mouse brains (A).

[0056] FIG. 22 depicts study design and dosing regimen of the mouse study to evaluate the therapeutic effects of mSIFOOl in the Alzheimer’s disease mimic mouse model.

[0057] FIG. 23 depicts Galectin-3 intrinsically promotes oligomerization of A[342, as characterized by dot blot using a conformational oligomer specific antibody All (A) and an A[342 sequence-dependent antibody 6E10 (B). Gal-3 oligomerized A[342 peptide into high molecular weight oligomers in a dose dependent manner as characterized by Western blot probed with an A[3 sequence-dependent antibody 6E10 (C).

[0058] FIG. 24 depicts Galectin-3 intrinsically promotes oligomerization of Phospho Tau (396) (B) but not normal Tau (A) .

[0059] FIG. 25 depicts Galectin-3 intrinsically promotes oligomerization of APOE4 (A) but not APOE3 (B) .

[0060] FIG. 26 depicts SIFOOlAb dose-dependently dissolves A[342 oligomers induced by Gal-3 (A), while an iso-type control antibody had no effect (B).

[0061] FIG. 27 depicts the cognitive deficit of APP / PS1 mice in terms of latency to reach the platform (A) and number of crosses in the Morris water maze (B) as compared to age matched wild type mice.

[0062] FIG. 28 depicts dose dependent efficacy of SIF001 in Alzheimer’s mouse model APP / PS1 on hippocampal dependent spatial memory (Morris water maze training) in terms of latency to reach the platform (A) and number of crosses (B) .

[0063] FIG. 29 depicts the efficacy of SIF001 treatment in patient 1 during the epilepsy investigator-initiated trial (IIT).

[0064] FIG. 30 depicts the efficacy of SIF001 treatment in patient 2 during the epilepsy investigator-initiated trial (IIT).

[0065] FIG. 31 depicts the efficacy of SIF001 treatment in patient 3 during the epilepsy investigator-initiated trial (IIT).

[0066] FIG. 32 depicts the efficacy of SIF001 treatment in patient 4 during the epilepsy investigator-initiated trial (IIT).

[0067] FIG. 33 depicts the efficacy of SIF001 treatment in patient 5 during the epilepsy investigator-initiated trial (IIT), as measured by daily seizure frequency before and after SIF001 treatment.

[0068] FIG. 34 depicts the efficacy of SIF001 treatment in patient 5 during the epilepsy investigator-initiated trial (IIT), as measured by hourly seizure frequency during sleep through electroencephalogram (EEG) before and after SIF001 treatment.

[0069] FIG. 35 depicts a schematic drawing of LSA epitope binning workflow. DETAILED DESCRIPTION [] I. Introduction

[0070] The present disclosure provides compositions and methods for treating epilepsy and / or related diseases such as neurological disorders (e.g., AD). In particular, disclosed herein are anti-Galectin-3 antibodies and the use of these antibodies for epilepsy and / or related disease treatment.

[0071] Galectin-3 (GAL-3) plays a diverse role in biological processes including cell adhesion, proliferation, migration, apoptosis, tumor progression, and inflammation, especially in neuroinflammation. The inventor has discovered that anti-GAL-3 antibodies can significantly decrease pro-inflammatory cytokine (e.g., tumor necrosis factor-a (TNFa)), in LPS-stimulated microglia cells, and inhibit microglial activation in kainic acid (KA) -stimulated microglia BV2 cells, concluding that targeting GAL-3 with anti-GAL-3 antibodies may offer therapeutic benefits in epilepsy and related neurological disorders by suppressing neuroinflammation and reducing microglial activation. II. Definitions

[0072] Unless specifically indicated otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which this disclosure belongs. In addition, any method or material similar or equivalent to a method or material described herein can be used in the practice of the present disclosure. For purposes of the present disclosure, the following terms are defined.

[0073] The terms “a, ” “an, ” or “the” as used herein not only include aspects with one member, but also include aspects with more than one member. For instance, the singular forms “a, ” “an, ” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a cell” includes a plurality of such cells and reference to “the agent” includes reference to one or more agents known to those skilled in the art, and so forth.

[0074] The terms “about” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Typical, exemplary degrees of error are within 20 percent (%), preferably within 10%, and more preferably within 5% of a given value or range of values. Alternatively, and particularly in biological systems, the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably within 5-fold and more preferably within 2-fold of a given value. Numerical quantities given herein are approximate unless stated otherwise, meaning that the term “about” or “approximately” can be inferred when not expressly stated.

[0075] Numeric ranges recited within the specification are inclusive of the numbers within the defined range. Throughout this disclosure, various aspects of this disclosure are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the disclosure. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range (e.g., 1 to 5 includes 1, 1.5, 2, 2.75, 3, 3.80, 4, and 5).

[0076] Also, the words “comprise, ” “comprising, ” “contains, ” “containing, ” “include, ” “including, ” and “includes, ” when used in this specification and in the following claims, are intended to specify the presence of stated features, integers, components, or steps, but they do not preclude the presence or addition of one or more other features, integers, components, steps, acts, or groups.

[0077] The term “amino acid” refers to any monomeric unit that can be incorporated into a peptide, polypeptide, or protein. Amino acids include naturally occurring a-amino acids and their stereoisomers, as well as unnatural (non-naturally occurring) amino acids and their stereoisomers. “Stereoisomers” of a given amino acid refer to isomers having the same molecular formula and intramolecular bonds but different three-dimensional arrangements of bonds and atoms (e.g., an 1-amino acid and the corresponding d-amino acid).

[0078] The terms “identity, ” “substantial identity, ” “similarity, ” “substantial similarity, ” “homology” and the related terms and expressions used in the context of describing amino acid sequences refer to a sequence that has at least 60% sequence identity to a reference sequence. Examples include at least: 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, sequence identity, as compared to a reference sequence using the programs for comparison of amino acid sequences, such as BLAST using standard parameters. For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default (standard) program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. A “comparison window” includes reference to a segment of any one of the number of contiguous positions (from 20 to 600, usually about 50 to about 200, more commonly about 100 to about 150), in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known. Optimal alignment of sequences for comparison may be conducted, for example, by the local homology algorithm of Smith and Waterman, 1981, by the homology alignment algorithm of Needleman and Wunsch, 1970, by the search for similarity method of Pearson and Lipman, 1988, by computerized implementations of these algorithms (for example, BLAST), or by manual alignment and visual inspection.

[0079] Algorithms that are suitable for determining percent sequence identity and sequence similarity include BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., 1990, and Altschul et al., 1977, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (NCBI) web site. The algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold. These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word size (W) of 28, an expectation (E) of 10, M=l, N=-2, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word size (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (Henikoff and Henikoff, 1989). The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (Karlin and Altschul, 1993).

[0080] As disclosed herein, when referring to a range defined by “greater than a first minimum value, ” such range includes any subrange defined by a second minimum value that is greater than the first minimum value. This is to say, all values equal to or greater than the first minimum value are encompassed within the broader range. For example, when stating “at least 70%, ” this phrase inherently includes all percentages equal to or greater than 70%. It is equivalent to explicitly listing each percentage value, as follows: “at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%. ”

[0081] As used herein, the term “antibody” means an isolated or recombinant binding agent that comprises the necessary variable region sequences to specifically bind an antigenic epitope. Therefore, an “antibody” as used herein is any form of an antibody of any class or subclass or fragment thereof that exhibits the desired biological activity, e.g., binding a specific target antigen. Thus, it is used in the broadest sense and specifically covers a monoclonal antibody (including full-length monoclonal antibodies) , human antibodies, chimeric antibodies, nanobodies, diabodies, multispecific antibodies (e.g., bispecific antibodies) , antibody fragments, antigen-binding fragments including but not limited to scFv, Fab, and the like so long as they exhibit the desired biological activity.

[0082] “Antibody fragments” or “antigen-binding fragments” comprise a portion of an intact antibody, for example, the antigen-binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab’, F (ab’) 2, and Fv fragments; diabodies; linear antibodies (e.g., Zapata et al., Protein Eng. 8 (10) : 1057-1062 (1995)) ; single-chain antibody molecules (e.g., scFv) ; and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily. Pepsin treatment yields an F (ab’) 2 fragment with two antigen combining sites and is still capable of cross-linking antigen.

[0083] As used herein, “V-region” or “variable region” refers to an antibody variable region domain comprising the segments of Framework 1, CDR1, Framework 2, CDR2, and Framework 3, including CDR3 and Framework 4. The heavy chain V-region, VH, is a consequence of the rearrangement of a V-gene (HV), a D-gene (HD), and a J-gene (HJ) , in what is termed V (D) J recombination during B-cell differentiation. The light chain V-region, VL, is a consequence of the rearrangement of a V-gene (LV) and a J-gene(LJ).

[0084] As used herein, “complementarity-determining region (CDR) ” refers to the three hypervariable regions (HVRs) in each chain that interrupt the four “framework” regions established by the light and heavy chain variable regions. The CDRs are the primary contributors to binding to an epitope of an antigen. The CDRs of each chain are referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also identified by the chain in which the CDR is located. Thus, a VH CDR3 (HCDR3) is in the variable domain of the heavy chain of the antibody in which it is found, whereas a VL CDR3 (LCDR3) is the CDR3 from the variable domain of the light chain of the antibody in which it is located. The term “CDR” is used interchangeably with “HVR” when referring to CDR sequences.

[0085] The amino acid sequences of the CDRs and framework regions can be determined using various well-known definitions in the art, e.g., Kabat, Chothia, international ImMunoGeneTics database (IMGT), and AbM (see, e.g., Chothia & Lesk, 1987, Canonical structures for the hypervariable regions of immunoglobulins. J. Mol. Biol. 196, 901-917; Chothia C. et al., 1989, Conformations of immunoglobulin hypervariable regions. Nature 342, 877-883; Chothia C. et al., 1992, Structural repertoire of the human VH segments J. Mol. Biol. 227, 799-817; Al-Lazikani et al., J. Mol. Biol. 1997, 273 (4)). Definitions of antigen combining sites are also described in the following: Ruiz et al., IMGT, the international ImMunoGeneTics database. Nucleic Acids Res., 28, 219—221 (2000) ; and Lefranc, M. -P. IMGT, the international ImMunoGeneTics database. Nucleic Acids Res. Jan 1; 29 (1) : 207-9 (2001) ; MacCallum et al., Antibody-antigen interactions: Contact analysis and binding site topography, J. Mol. Biol., 262 (5), 732-745 (1996) ; and Martin et al, Proc. Natl Acad. Sci. USA, 86, 9268—9272 (1989) ; Martin et al., Methods Enzymol., 203, 121—153, (1991) ; Pedersen et al., Immunomethods, 1, 126, (1992) ; and Rees et al., In Sternberg M.J.E. (ed.), Protein Structure Prediction. Oxford University Press, Oxford, 141—172 1996). Reference to CDRs as determined by Kabat numbering is based, for example, on Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institute of Health, Bethesda, MD (1991)). Chothia CDRs are determined as defined by Chothia (see, e.g., Chothia and Lesk J. Mol. Biol. 196: 901-917 (1987)).

[0086] CDRs in this disclosure are defined by Kabat. As known in the art, numbering and placement of the CDRs can differ depending on the numbering system employed. It is understood that disclosure of a variable heavy and / or variable light sequence includes the disclosure of the associated CDRs, regardless of the numbering system employed.

[0087] An “Fc region” refers to the constant region of an antibody excluding the first constant region immunoglobulin domain. Thus, e.g., for human immunoglobulins, “Fc” refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N-terminal to these domains. For IgA and IgM, Fc may include the J chain. For IgG, Fc comprises immunoglobulin domains Cy2 and Cy3 and the hinge between Cyl and Cy2. It is understood in the art that the boundaries of the Fc region may vary, however, the human IgG heavy chain Fc region is usually defined to comprise residues C226 or P230 to its carboxyl-terminus, using the numbering according to the EU index as in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). The term “Fc region” may refer to this region in isolation or this region in the context of an antibody or antibody fragment. “Fc region” includes naturally occurring allelic variants of the Fc region as well as modified Fc regions, e.g., that are modified to modulate effector function or other properties such as pharmacokinetics, stability or production properties of an antibody. Fc regions also include variants that do not exhibit alterations in biological function. For example, one or more amino acids can be deleted from the N-terminus or C-terminus of the Fc region of an immunoglobulin without substantial loss of biological function. Such variants can be selected according to general rules known in the art to have minimal effect on activity (see, e.g., Bowie et al., Science 247: 306-1310, 1990). For example, for IgG4 antibodies, a single amino acid substitution (S228P according to Kabat numbering; designated IgG4Pro) may be introduced to abolish the heterogeneity observed in recombinant IgG4 antibodies (see, e.g., Angal et al., Mol Immunol 30: 105-108, 1993).

[0088] An “EC50” as used herein refers to the half-maximal effective concentration, which is the concentration of an antibody that induces a response (signal generated in engagement assay) halfway between the baseline and maximum after a specified exposure time. In some embodiments, the “fold over EC50” is determined by dividing the EC50 of a reference antibody by the EC50 of the test antibody.

[0089] The term “equilibrium dissociation constant” abbreviated (KD), refers to the dissociation rate constant (kd, time ') divided by the association rate constant (ka, time 1 M '). Equilibrium dissociation constants can be measured using any method. Thus, in some embodiments antibodies of the present disclosure have a KD of less than about 50 nM, typically less than about 25 nM, or less than 10 nM, e.g., less than about 5 nM or than about 1 nM and often less than about 10 nM as determined by surface plasmon resonance analysis using a biosensor system such as a Biacore® system performed at 37°C. In some embodiments, an antibody of the present disclosure has a KD of less than 5 x 105 M, less than 105 M, less than 5 x 106 M, less than 106 M, less than 5 x 107 M, less than 107 M, less than 5 x 108 M, less than 108 M, less than 5 x 109 M, less than 10 9 M, less than 5 xlO 10 M, less than 10 10 M, less than 5 x 10 11 M, less than 10 11 M, less than 5 x 10 12 M, less than 10 12 M, less than 5 x 10 13 M, less than 10 13 M, less than 5 x 10 14 M, less than 10 14 M, less than 5 x 10 15 M, or less than 10 15 M or lower as measured as a bivalent antibody. In the context of the present invention, an “improved” KD refers to a lower KD. In some embodiments, an antibody of the present disclosure has a KD of less than 5 x 105 M, less than 105 M, less than 5 x 106 M, less than 106 M, less than 5 x 107 M, less than 107 M, less than 5 x 108 M, less than 108 M, less than 5 x 109 M, less than 109 M, less than 5 xlO 10 M, less than 10 10 M, less than 5 x 1011 M, less than 10 11 M, less than 5 x 10 12 M, less than 10 12 M, less than 5 x 10 13 M, less than 10 13 M, less than 5 x 10 14 M, less than 10 14 M, less than 5 x 10 15 M, or less than 10 15 M or lower as measured as a monovalent antibody, such as a monovalent Fab. In some embodiments, an anti-GAL-3 antibody of the present disclosure has KD less than 100 pM, e.g., or less than 75 pM, e.g., in the range of 1 to 100 pM, when measured by surface plasmon resonance analysis using a biosensor system such as a Biacore® system performed at 37°C. In some embodiments, an anti-GAL-3 antibody of the present disclosure has KD of greater than 100 pM, e.g., in the range of 100-1000 pM or 500-1000 pM when measured by surface plasmon resonance analysis using a biosensor system such as a Biacore®system performed at 37°C.

[0090] The terms “nucleic acid” and “polynucleotide” are used interchangeably and as used herein refer to both sense and anti-sense strands of RNA, cDNA, genomic DNA, and synthetic forms and mixed polymers of the above. In particular embodiments, a nucleotide refers to a ribonucleotide, deoxynucleotide or a modified form of either type of nucleotide, or combinations thereof. The terms also include, but is not limited to, single- and double-stranded forms of DNA. In addition, a polynucleotide, e.g., a cDNA or mRNA, may include either or both naturally occurring and modified nucleotides linked together by naturally occurring and / or non-naturally occurring nucleotide linkages. The nucleic acid molecules may be modified chemically or biochemically or may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those of skill in the art. Such modifications include, for example, labels, methylation, the substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, and the like), charged linkages (e.g., phosphorothioates, phosphorodithioates, and the like), pendent moieties (e.g., polypeptides), intercalators (e.g., acridine, psoralen, and the like), chelators, alkylators, and modified linkages (e.g., alpha anomeric nucleic acids, and the like). The above term is also intended to include any topological conformation, including single-stranded, double-stranded, partially duplexed, triplex, hairpinned, circular and padlocked conformations. A reference to a nucleic acid sequence encompasses its complement unless otherwise specified. Thus, a reference to a nucleic acid molecule having a particular sequence should be understood to encompass its complementary strand, with its complementary sequence. The term also includes codon-optimized nucleic acids that encode the same polypeptide sequence.

[0091] The terms “vector” and “expression vector” refer to a nucleic acid construct, generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular polynucleotide sequence in a host cell. An expression vector may be part of a plasmid, viral genome, or nucleic acid fragment. Typically, an expression vector includes a polynucleotide to be transcribed, operably linked to a promoter. The term “promoter” is used herein to refer to an array of nucleic acid control sequences that direct transcription of a nucleic acid. As used herein, a promoter includes necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element. A promoter also optionally includes distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. Other elements that may be present in an expression vector include those that enhance transcription (e.g., enhancers) and terminate transcription (e.g., terminators).

[0092] An “expression cassette” refers to a nucleic acid construct that, when introduced into a host cell, results in transcription and / or translation of an RNA or polypeptide, respectively.

[0093] The term “operably linked” refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.

[0094] The term “promoter, ” as used herein, refers to a polynucleotide sequence capable of driving transcription of a coding sequence in a cell. Thus, promoters can include cisacting transcriptional control elements and regulatory sequences that are involved in regulating or modulating the timing and / or rate of transcription of a gene. For example, a promoter can be a cis-acting transcriptional control element, including an enhancer, a promoter, a transcription terminator, an origin of replication, a chromosomal integration sequence, 5’ and 3’ untranslated regions, or an intronic sequence, which are involved in transcriptional regulation. These cis-acting sequences typically interact with proteins or other biomolecules to carry out (turn on / off, regulate, modulate, etc.) gene transcription.

[0095] The phrase “percent identical” or equivalents used in the context of two nucleic acids or polypeptides, refers to a sequence that has at least a specified level of identity, e.g., at least 50%sequence identity with a reference sequence (e.g., any SEQ ID NO included herein). Alternatively, percent identity can be any integer from 50% to 100%. Some embodiments include at least: 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, compared to a reference sequence using the programs described herein, e.g., BLAST using standard parameters, as described below.

[0096] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.

[0097] A “comparison window, ” as used herein, includes reference to a segment of any one of the numbers of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2: 482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48: 443 (1970), by the search for similarity method of Pearson & Lipman, Proc. NatT. Acad. Sci. USA 85: 2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection.

[0098] Algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (NCBI) web site.

[0099] A “substitution” denotes the replacement of one or more amino acids or nucleotides by different amino acids or nucleotides, respectively.

[0100] An “isolated” nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.

[0101] “Isolated nucleic acid encoding an antibody or fragment thereof’ refers to one or more nucleic acid molecules encoding antibody heavy or light chains (or fragments thereof), including such nucleic acid molecule (s) in a single vector or separate vectors, and such nucleic acid molecule (s) present at one or more locations in a host cell.

[0102] The terms “host cell, ” “host cell line, ” and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Thus, a host cell is a recombinant host cell and includes the primary transformed cell and progeny derived therefrom without regard to the number of passages.

[0103] A polypeptide “variant” is a polypeptide that typically differs from one or more polypeptide sequences specifically disclosed herein in one or more substitutions, deletions, additions, and / or insertions.

[0104] A “therapeutic agent” refers to an agent that when administered to a patient suffering from a disease, in a therapeutically effective dose, will cure, or at least partially arrest the symptoms of the disease and complications associated with the disease.

[0105] A “variant” of a reference antibody refers to an antibody that typically differs from the reference antibody in one or more substitutions, deletions, additions, and / or insertions in the amino acid sequence of the heavy and / or light chain.

[0106] As used herein, the term “internalize, ” or “internalization” refer to the phenomenon that an antibody molecule crosses the cell membrane and reaches the cytoplasm and / or the nucleus.

[0107] The terms “therapy, ” “treatment, ” and “amelioration” refer to any reduction in the severity of symptoms. For example, in the case of treating cancer, treatment can refer to reducing the number of cancer cells or growth rate or cell death of non-cancer cells, etc. As used herein, the terms “treat” and “prevent” are not intended to be absolute terms. Treatment and prevention can refer to any delay in onset, amelioration of symptoms, improvement in patient survival, increase in survival time or rate, etc. Treatment and prevention can be complete (no detectable symptoms remaining) or partial, such that symptoms are less frequent of severe than in a patient without the treatment described herein. The effect of treatment can be compared to an individual or pool of individuals not receiving the treatment, or to the same patient prior to treatment or at a different time during treatment. In some aspects, the severity of disease is reduced by at least 10%, as compared, e.g., to the individual before administration or to a control individual not undergoing treatment. In some aspects the severity of disease is reduced by at least 25%, 50%, 75%, 80%, or 90%, or in some cases, no longer detectable using standard diagnostic techniques.

[0108] The terms “effective amount, ” “effective dose, ” “therapeutically effective amount, ” etc. refer to that amount of the therapeutic agent sufficient to ameliorate a disorder, as described above. For example, for the given parameter, a therapeutically effective amount will show an increase or decrease of therapeutic effect at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%. Therapeutic efficacy can also be expressed as “-fold” increase or decrease. For example, a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.

[0109] As used herein, the term “pharmaceutically acceptable” is used synonymously with physiologically acceptable and pharmacologically acceptable. A pharmaceutical composition will generally comprise agents for buffering and preservation in storage, and can include buffers and carriers for appropriate delivery, depending on the route of administration.

[0110] The terms “dose” and “dosage” are used interchangeably herein. A dose refers to the amount of active ingredient given to an individual at each administration. The dose will vary depending on a number of factors, including frequency of administration; size and tolerance of the individual; severity of the condition; risk of side effects; the route of administration; and the imaging modality of the detectable moiety (if present). One of skill in the art will recognize that the dose can be modified depending on the above factors or based on therapeutic progress. The term “dosage form” refers to the particular format of the pharmaceutical and depends on the route of administration. For example, a dosage form can be in a liquid, e.g., a saline solution for injection.

[0111] “Subject, ” “patient, ” “individual” and like terms are used interchangeably and refer to, except where indicated, mammals such as humans and non-human primates, as well as rabbits, rats, mice, goats, pigs, dogs, cats, and other mammalian species. The term does not necessarily indicate that the subject has been diagnosed with a particular disease but typically refers to an individual under medical supervision. A patient can be an individual that is seeking treatment, monitoring, adjustment or modification of an existing therapeutic regimen, etc. III. Detailed Description of the Embodiments

[0112] The present disclosure is directed to compositions and methods to prevent and treat metabolic epilepsy and / or related neurological disorders through targeting Galectin-3 with anti-GAL-3 antibodies. Galectin-3 (GAL-3)

[0113] The galectin family comprises at least fifteen [3-galactoside-binding lectins, playing pivotal roles in growth and development, and contributing to the advancement of several diseases. Galectin-3 (GAL-3) , a monomer but can form a multimer (dimer or pentamer) at higher concentrations ll7J , is one of the most studied members of the galectin family l2,18J.

[0114] All galectins, including GAL-3, bind to [3-galactoside, but they exhibit slight variations in their carbohydrate-binding abilities. Typically, galectins show a preference for N-acetyllactosamine, binding it significantly stronger than lactose. N-glycans rich in N-acetyllactosamine serve as effective ligands for most galectins. Notably, GAL-3’s interaction with the TF-disaccharide found in O-glycans is distinct from that of galectin-1, displaying a much higher affinity in isothermal titration calorimetry (ITC) assays l22J. These differences in binding properties among galectins can be attributed to their unique three-dimensional structures. 122 24

[0115] GAL-3 interacts with both intracellular and extracellular molecules. Unlike other galectins, GAL-3 is secreted without a conventional signal peptide l25J , existing within the cytosol and the extracellular matrix (ECM)l26’27J. Known extracellular ligands include ECM and cell surface glycoproteins like laminin l28’29J , fibronectin l30J, CD29 l31J, CD66 l32J, a 1 [31 integrin l30J, and Mac-2 binding protein l33J. Intracellularly, GAL-3 binds to ligands such as gemin 4 l34J, Bcl-2 l34J, nucling l35J , synexin l36J, and [3-catenin l37,38J through various protein-carbohydrate and protein-protein interactions.

[0116] GAL-3 functions in various biological capacities, both inside cells, within the nucleus or cytoplasm, and outside, on the cell surface or in the extracellular space l3,4,17J. It connects with [3-galactose- rich glycoconjugates or glycolipids on the cell membrane, influencing key cellular processes such as proliferation, apoptosis, adhesion, invasion, angiogenesis, and metastasis. These functions are critical during normal development and also play a role in the progression of diseases associated with chronic inflammation, such as cancer, fibrosis, and type 2 diabetes, etc. Studies have also shown that galectins, a family of 15 glycan-binding proteins that have been conserved throughout evolution, in modulating neuroinflammation and potentially influencing neurodegeneration l41,42J.

[0117] Galectin-3 (GAL-3) plays a diverse role in biological processes including cell adhesion, proliferation, migration, apoptosis, tumor progression, and inflammation 143 43. It is also involved in the modulation of both the innate and adaptive immune systems. The function of GAL-3, whether pro-inflammatory or anti-inflammatory, is influenced by several factors including the specific brain region, the nature of the injury, and the stage of the disease l45J.

[0118] In normal brain tissue, GAL-3 is constitutively expressed across a wide range of neuronal tissues, including neurons and glial cells in various brain regions l46J . Detailed studies, particularly those using immunohistochemistry techniques in adult rats, have mapped the presence of GAL-3 in numerous brain areas such as parts of the telencephalon (including certain areas of the cerebral cortex, olfactory region, amygdaloid nucleus, stria terminalis, and the vascular organ of the lamina terminalis), the diencephalon (encompassing the thalamus and hypothalamus), as well as in the brain stem and cerebellum (including the inferior colliculus, lateral parabrachial nucleus, pontine nucleus, cochlear nucleus, and the fibers of the cerebellar peduncles) .

[0119] Under neuroinflammatory conditions within the central nervous system, GAL-3 expression is in glia, astrocytes, and oligodendrocytes. However, it is primarily expressed by microglia and astrocytes when studied in vitro l47J. This distribution and expression pattern highlight the potential roles of GAL-3 in normal brain function and its reactive upregulation in response to neuroinflammatory conditions, pointing to its significance in both the healthy and diseased states of the nervous system.

[0120] Microglia, in their activated state, undergo proliferation, morphological changes, migrate to damaged sites, and produce cytokines l48J, acting as primary effectors in CNS inflammation l49J. Their functional plasticity allows them to exhibit dual phenotypes-proinflammatory Ml and anti- inflammatory M2-enabling them to adapt to various microenvironments and maintain tissue homeostasis l50J.

[0121] GAL-3’s involvement extends to regulating microglial polarization, influenced by the context of brain damage, through lectin-glycan interactions l42J. Its expression and activity, which can be upregulated by factors like IFN-y, play a significant role in the proinflammatory response by activating the Ml phenotype and promoting cytokine production through pathways like JAK / STAT l51J. However, GAL-3’s function in neuroinflammation is complex, displaying both protective and detrimental effects depending on the disease context, stages, and severity 152 M . For instance, in conditions like traumatic brain injury, GAL-3 exacerbates proinflammatory responses l55J, whereas in autoimmune diseases like EAE (Experimental Autoimmune Encephalomyelitis) , it can contribute to neuroprotection by facilitating debris clearance and promoting regeneration and remyelination l56J. This dual nature underscores the nuanced role of GAL-3 in neuroinflammatory processes, offering potential therapeutic targets for modulating microglial activity in neurological diseases.

[0122] Several GAL-3 inhibitors or antagonists, either small-molecule carbohydrates or large-molecule products, are being developed by private and public companies for therapeutic applications in various diseases. l57J

[0123] The terms “GAL-3 inhibitor” or “GAL-3 antagonist” or “GAL-3 blocker” or the like include any substance that decreases the expression, ligand binding (e.g., binding to GAL-3), or any biological activity of GAL-3 (e.g., regulating microglial polarization) , that would elicit a biological or medical response of a tissue, system, subject or patient that is being sought by the administrator (such as a researcher, doctor or veterinarian) which includes any measurable alleviation of the signs, symptoms and / or clinical indicia of epilepsy and related neurological disorders, and / or the prevention, slowing or halting of progression of epilepsy and related neurological disorders. GAL-3 inhibitors include both small-molecule carbohydrates or large-molecule natural or unnatural products. Several Gal-3 inhibitors or antagonists, including smallmolecule inhibitors and large molecule products, are undergoing clinical development in various diseases associated with Gal-3. A summary of the small molecule and large molecule therapies are presented in Table 1 and Table 2, respectively.

[0124] Anti-Gal-3 inhibitors that have been explored further in nonclinical and clinical development of neurological diseases include, for example, TD139, a small molecule Gal-3 inhibitor as described in Hirani, Nikhil et al. “Target inhibition of galectin-3 by inhaled TD139 in patients with idiopathic pulmonary fibrosis. ” The European respiratory journal vol. 57, 5 2002559.27 May. 2021, and TB006, an anti-Gal-3 antibody as described in Rasool, S., Patel, P., Johansson, J., Voloboueva, L., Lee, S., Sun, J., Lan, X., Ahmed, T. and Sun, D. (2022), Potential Reversal of Alzheimer’s Disease pathology by Antibody TB006 Targeting Galectin-3, the Root Cause of Oligomerization of Amyloid Proteins. Alzheimer’s Dement., 18: e060393; each of which is hereby incorporated by reference in its entirety. Small-Molecular GAL-3 Targeted Inhibitors

[0125] Small molecule anti-GAL-3 inhibitors offer several benefits compared to the large molecule counterparts, including the ability to create a compact structure with desired traits like suitable polar surface area and biostability which enabled the oral formulation development, that can be manufactured consistently on a large scale and is straightforward to characterize, and facilitate pharmacokinetic studies. Nonetheless, synthetic molecules may pose toxicity risks at elevated dosages. Table 1 lists a summary of clinical trials of small molecule Gal-3 inhibitors. Table 1. Overview of Clinical Trials of Small Molecule Gal-3 Inhibitors Sponsor   Compound Indication   Phase Trial# Status Galecto Bio GB0139 IPF 2 NCT03832946 Active, not rec (n = 426) TD139 IPF l / 2a NCT02257177 Completed (n = 60) TD139 COVID-19 1,2 NCT04473053 Active, not rec (n = 200) GB1211 Healthy Adults 1 NCT03809052 Completed (n = 78) NASH lb NCT04607655 Withdrawn Hepatic Impairment 1 NCT05009680 Active, not rec (n = 54) NSCLC 1 NCT05009680 Recruiting (n = 102) Galecto Bio, Galecto Biotech; IPF, Idiopathic pulmonary fibrosis; NASH, Nonalcoholic steatohepatitis; NSCLC, Non-small cell lung cancer; not rec, not recruiting. Large-Molecular GAL-3 Targeted Inhibitors

[0126] Pectins, sourced or modified from plants, represent large molecule antagonists of GAL-3 that have undergone clinical examination for a range of conditions, as documented on www. clinicaltrials. gov (retrieved on 20 February 2023). However, these pectins do not target a specific galectin and exhibit weak binding to GAL-3, with affinities ranging 2.6 to 10 pM. Table 2 lists a summary of clinical trials of large molecule Gal-3 inhibitors. Table 2. Overview of Clinical Trials of Large Molecule Gal-3 Inhibitors Sponsor Compound Indication Phas e Trial# Status TrueBindi ng TB006 Healthy Adults 1 NCT049207 86 Unknown AD lb / 2 a NCT050744 98 Completed (n = 154) COVID-19 1 NCT048010 56 Withdrawn Acute ischemic stroke 2 NCT051568 27 Withdrawn Autism spectrum disorder 2 NCT065006 37 Recruiting EcoNugeni cs MCP Prostatic neoplasm 2 NCTO 16818 23 Completed (n = 60) MGH MCP Osteoarthritis 3 NCT028006 29 Unknown La Jolla GCS-100 CKD 1 NCT017172 48 Completed (n = 29) CLL 2 NCT005146 96 Completed (n = 12) CKD ----------------------------------------------------------■ NCTO 18437 90 Completed (n = 120). — NCT021556 73     _ Completed (n = 92) 2a NCT023339 55 Withdrawn Multiple myeloma 1 / 2 NCT006098 17 Terminated B           cell lymphoma 1 / 2 NCT007768 02 Withdrawn Gal Thera GM-CT-01 Solid tumors 1 NCT000549 77 Completed (n = 40) GM-CT-01+ 5-FU Colorectal Cancer 2 NCT001107 21 Terminated GM-CT-01 in comb Colorectal Cancer 2 NCT003887 00 Withdrawn GM-CT-01 Metastatic melanoma 2 NCTO 17238 13 Terminated Sponsor Compound Indication Phas e Trial# Status Bile duct and Gall Bladder cancer 2 NCT003865 16 Withdrawn GR-MD-02 NASH    and fibrosis 1 NCTO 18998 59 Completed (n = 31) NASH    and fibrosis 2 NCT024210 94 Completed (n = 30) NASH cirrhosis and Portal hypertension 2 NCT024629 67 Completed (n = 162) NASH cirrhosis and Esophageal varices 2b / 3 NCT043658 68 Recruiting Psoriasis 2 NCT024070 41 Completed (n = 5) Prov Med GR-MD-02+ Ipilumumab Metastatic melanoma 1 NCT021173 62 Completed (n = 8) GR-MD-02+ Pembrolizu mab Melanoma, NSCLC 1 NCT025754 04 Active, not rec GR-MD-02+ Pembrolizu mab Metastatic melanoma 2 NCT049879 96 Suspended BioXyTra n Prolectin-M COVID-19 WA NCT045120 27 Completed (n = 10) COVID-19 lb / 2 a NCT05733.7 80 Not        yet recruiting COVID-19 3 NCT050960 52 Not         yet recruiting AD, Alzheimer’s disease; MCP, Modified citrus pectin; MGH, Massachusetts General Hospital; CKD, Chronic Kidney disease; CLL, Chronic lymphocytic leukemia; Gal Thera, Galectin Therapeutics; GM-CT- 01 in comb, GM-CT-01 in combination with 5-flu-orouracil, Avastin, and Leucovorin; Prov Med, Providence Portland Medical Center; NSCLC, Non-small cell lung cancer; not rec, not recruiting; NA, Not applicable.

[0127] In some embodiments, the anti-GAL-3 antibodies disclosed herein can be used in combination with any of the aforementioned small- or large-molecule GAL-3 targeted inhibitors, for treating epilepsy or a neurological disorder in a subject in need thereof. In some embodiments, the anti-GAL-3 antibodies disclosed herein can be used to treat patients who have not responded to treatment with any of the aforementioned small- or large-molecule GAL-3 targeted inhibitors. GAL-3 Targeted Inhibitors for Treatment of Neurological Disorders

[0128] Recently, anti-GAL-3 inhibitors for the treatment of neurological disorders such as Alzheimer’s disease (AD) have been studied in clinical trials as disclosed on https: II clinical trials, gov / (NCT05074498, NCT05476783, NCT05156827). Anti-GAL-3 antibodies

[0129] As disclosed herein, the GAL-3 inhibitor can be an anti-GAL-3 antibody or antigenbinding fragment thereof that binds specifically to GAL-3 (e.g., human GAL-3) or any soluble fragment thereof (e.g., monoclonal antibodies (e.g., fully human monoclonal antibodies), polyclonal antibodies, bispecific antibodies, Fab antibody fragments, F (ab) 2 antibody fragments, Fv antibody fragments (e.g., VH or VL), single chain Fv antibody fragments, dsFv antibody fragments, humanized antibodies or chimeric antibodies.

[0130] In some instances, the anti-GAL-3 antibody specifically binds to human Galectin-3. In other instances, the anti-GAL-3 antibody binds to both human Galectin-3 and Galectin-3 from other species such as mouse, rat, monkey, etc. As disclosed herein, the anti-GAL-3 antibody can be any humanized, chimeric, or human antibody that binds to Galectin-3. In some embodiments, the anti-GAL-3 antibody is generated from other species but humanized to bind human Galectin-3. In some embodiments, the anti-GAL-3 antibody is a chimeric antibody. In some embodiments, the anti-GAL-3 antibody is a human antibody.

[0132] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable (VH) region comprising a heavy chain CDR 1 (HCDR1), HCDR2, and HCDR3 and a light chain variable (VL) region comprising light chain CDR 1 (LCDR1), LCDR2, and LCDR3. In some embodiments, the VH region comprises a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 1-21 and 481-507, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to any one of SEQ ID NOS: 22-42 and 390-417, and / or a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 43-63 and 418-439. In some embodiments, the VL region comprises a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 169-189 and 440-462, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to any one of SEQ ID NOS: 190-210 and 463-480, and / or a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to any one of SEQ ID NOS: 211-231 and 481-507. The exemplary heavy chain CDRs and light chain CDRs are listed in Tables 3 and 4, respectively.

[0131] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 1, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 22, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 43; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 169, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 190, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 211. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 1, a HCDR2 amino acid sequence of SEQ ID NO: 22, a HCDR3 amino acid sequence of SEQ ID NO: 43, a LCDR1 amino acid sequence of SEQ ID NO: 169, a LCDR2 amino acid sequence of SEQ ID NO: 190, and a LCDR3 amino acid sequence of SEQ ID NO: 211.

[0132] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 2, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 23, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 44; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 170, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 191, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 212. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 2, a HCDR2 amino acid sequence of SEQ ID NO: 23, a HCDR3 amino acid sequence of SEQ ID NO: 44, a LCDR1 amino acid sequence of SEQ ID NO: 170, a LCDR2 amino acid sequence of SEQ ID NO: 191, and a LCDR3 amino acid sequence of SEQ ID NO: 212.

[0133] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 3, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 24, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 45; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 171, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 192, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 213. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 3, a HCDR2 amino acid sequence of SEQ ID NO: 24, a HCDR3 amino acid sequence of SEQ ID NO: 45, a LCDR1 amino acid sequence of SEQ ID NO: 171, a LCDR2 amino acid sequence of SEQ ID NO: 192, and a LCDR3 amino acid sequence of SEQ ID NO: 213.

[0134] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 25, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 46; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 172, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 193, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 214. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 4, a HCDR2 amino acid sequence of SEQ ID NO: 25, a HCDR3 amino acid sequence of SEQ ID NO: 46, a LCDR1 amino acid sequence of SEQ ID NO: 172, a LCDR2 amino acid sequence of SEQ ID NO: 193, and a LCDR3 amino acid sequence of SEQ ID NO: 214.

[0135] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 5, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 26, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 47; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 173, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 194, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 215. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 5, a HCDR2 amino acid sequence of SEQ ID NO: 26, a HCDR3 amino acid sequence of SEQ ID NO: 47, a LCDR1 amino acid sequence of SEQ ID NO: 173, a LCDR2 amino acid sequence of SEQ ID NO: 194, and a LCDR3 amino acid sequence of SEQ ID NO: 215.

[0136] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 7, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 28, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 49; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 174, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 195, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 216. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 6, a HCDR2 amino acid sequence of SEQ ID NO: 27, a HCDR3 amino acid sequence of SEQ ID NO: 48, a LCDR1 amino acid sequence of SEQ ID NO: 174, a LCDR2 amino acid sequence of SEQ ID NO: 195, and a LCDR3 amino acid sequence of SEQ ID NO: 216.

[0137] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 7, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 28, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 49; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 175, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 196, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 217. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 7, a HCDR2 amino acid sequence of SEQ ID NO: 28, a HCDR3 amino acid sequence of SEQ ID NO: 49, a LCDR1 amino acid sequence of SEQ ID NO: 175, a LCDR2 amino acid sequence of SEQ ID NO: 196, and a LCDR3 amino acid sequence of SEQ ID NO: 217.

[0138] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 8, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 29, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 50; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 176 or 369, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 197, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 218. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 8, a HCDR2 amino acid sequence of SEQ ID NO: 29, a HCDR3 amino acid sequence of SEQ ID NO: 50, a LCDR1 amino acid sequence of SEQ ID NO: 176 or 369, a LCDR2 amino acid sequence of SEQ ID NO: 197, and a LCDR3 amino acid sequence of SEQ ID NO: 218.

[0139] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 9, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 80, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 51; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 177, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 198, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 219. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 9, a HCDR2 amino acid sequence of SEQ ID NO: 30, a HCDR3 amino acid sequence of SEQ ID NO: 51, a LCDR1 amino acid sequence of SEQ ID NO: 177, a LCDR2 amino acid sequence of SEQ ID NO: 198, and a LCDR3 amino acid sequence of SEQ ID NO: 219.

[0140] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 10, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 31, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 52; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 178, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 199, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 220. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 10, a HCDR2 amino acid sequence of SEQ ID NO: 31, a HCDR3 amino acid sequence of SEQ ID NO: 52, a LCDR1 amino acid sequence of SEQ ID NO: 178, a LCDR2 amino acid sequence of SEQ ID NO: 199, and a LCDR3 amino acid sequence of SEQ ID NO: 220.

[0141] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 11, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 32, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 53; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 179, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 200, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 221. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 11, a HCDR2 amino acid sequence of SEQ ID NO: 32, a HCDR3 amino acid sequence of SEQ ID NO: 53, a LCDR1 amino acid sequence of SEQ ID NO: 179, a LCDR2 amino acid sequence of SEQ ID NO: 200, and a LCDR3 amino acid sequence of SEQ ID NO: 221.

[0142] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 12, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 33, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 54; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 180, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 201, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 222. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 12, a HCDR2 amino acid sequence of SEQ ID NO: 33, a HCDR3 amino acid sequence of SEQ ID NO: 54, a LCDR1 amino acid sequence of SEQ ID NO: 180, a LCDR2 amino acid sequence of SEQ ID NO: 201, and a LCDR3 amino acid sequence of SEQ ID NO: 222.

[0143] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 13, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 34, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 55; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 181, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 202, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 223. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 13, a HCDR2 amino acid sequence of SEQ ID NO: 34, a HCDR3 amino acid sequence of SEQ ID NO: 55, a LCDR1 amino acid sequence of SEQ ID NO: 181, a LCDR2 amino acid sequence of SEQ ID NO: 202, and a LCDR3 amino acid sequence of SEQ ID NO: 223.

[0144] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 14, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 35, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 56; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 182, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 203, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 224. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 14, a HCDR2 amino acid sequence of SEQ ID NO: 35, a HCDR3 amino acid sequence of SEQ ID NO: 56, a LCDR1 amino acid sequence of SEQ ID NO: 182, a LCDR2 amino acid sequence of SEQ ID NO: 203, and a LCDR3 amino acid sequence of SEQ ID NO: 224.

[0145] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 15, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 36, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 57; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 183, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 204, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 225. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 15, a HCDR2 amino acid sequence of SEQ ID NO: 36, a HCDR3 amino acid sequence of SEQ ID NO: 57, a LCDR1 amino acid sequence of SEQ ID NO: 183, a LCDR2 amino acid sequence of SEQ ID NO: 204, and a LCDR3 amino acid sequence of SEQ ID NO: 225.

[0146] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 16, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 37, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 58; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 184, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 205, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 226. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 16, a HCDR2 amino acid sequence of SEQ ID NO: 37, a HCDR3 amino acid sequence of SEQ ID NO: 58, a LCDR1 amino acid sequence of SEQ ID NO: 184, a LCDR2 amino acid sequence of SEQ ID NO: 205, and a LCDR3 amino acid sequence of SEQ ID NO: 226.

[0147] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 17, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 38, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 59; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 185, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 206, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 227. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 17, a HCDR2 amino acid sequence of SEQ ID NO: 38, a HCDR3 amino acid sequence of SEQ ID NO: 59, a LCDR1 amino acid sequence of SEQ ID NO: 185, a LCDR2 amino acid sequence of SEQ ID NO: 206, and a LCDR3 amino acid sequence of SEQ ID NO: 227.

[0148] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 18, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 39, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 60; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 186, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 207, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 228. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 18, a HCDR2 amino acid sequence of SEQ ID NO: 39, a HCDR3 amino acid sequence of SEQ ID NO: 60, a LCDR1 amino acid sequence of SEQ ID NO: 186, a LCDR2 amino acid sequence of SEQ ID NO: 207, and a LCDR3 amino acid sequence of SEQ ID NO: 228.

[0149] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 19, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 40, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 61; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 187, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 208, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 229. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 19, a HCDR2 amino acid sequence of SEQ ID NO: 40, a HCDR3 amino acid sequence of SEQ ID NO: 61, a LCDR1 amino acid sequence of SEQ ID NO: 187, a LCDR2 amino acid sequence of SEQ ID NO: 208, and a LCDR3 amino acid sequence of SEQ ID NO: 229.

[0150] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 20, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 41, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 62; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 188, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 209, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 230. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 20, a HCDR2 amino acid sequence of SEQ ID NO: 41, a HCDR3 amino acid sequence of SEQ ID NO: 64, a LCDR1 amino acid sequence of SEQ ID NO: 188, a LCDR2 amino acid sequence of SEQ ID NO: 209, and a LCDR3 amino acid sequence of SEQ ID NO: 230.

[0151] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 21, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 42, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 63; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 189, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 220, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 231. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 21, a HCDR2 amino acid sequence of SEQ ID NO: 42, a HCDR3 amino acid sequence of SEQ ID NO: 63, a LCDR1 amino acid sequence of SEQ ID NO: 189, a LCDR2 amino acid sequence of SEQ ID NO: 210, and a LCDR3 amino acid sequence of SEQ ID NO: 231.

[0152] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 370, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 390, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 418; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 440, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 463, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 481. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 370, a HCDR2 amino acid sequence of SEQ ID NO: 390, a HCDR3 amino acid sequence of SEQ ID NO: 418, a LCDR1 amino acid sequence of SEQ ID NO: 440, a LCDR2 amino acid sequence of SEQ ID NO: 463, and a LCDR3 amino acid sequence of SEQ ID NO: 481.

[0153] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 370, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 390, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 418; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 440, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 463, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 481. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 370, a HCDR2 amino acid sequence of SEQ ID NO: 390, a HCDR3 amino acid sequence of SEQ ID NO: 418, a LCDR1 amino acid sequence of SEQ ID NO: 440, a LCDR2 amino acid sequence of SEQ ID NO: 463, and a LCDR3 amino acid sequence of SEQ ID NO: 481.

[0154] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 371, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 391, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 418; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 441, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 464, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 482. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 371, a HCDR2 amino acid sequence of SEQ ID NO: 391, a HCDR3 amino acid sequence of SEQ ID NO: 418, a LCDR1 amino acid sequence of SEQ ID NO: 441, a LCDR2 amino acid sequence of SEQ ID NO: 464, and a LCDR3 amino acid sequence of SEQ ID NO: 482.

[0155] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 372, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 392, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to DNL; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 442, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 465, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 483. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 372, a HCDR2 amino acid sequence of SEQ ID NO: 392, a HCDR3 amino acid sequence of DNL, a LCDR1 amino acid sequence of SEQ ID NO: 442, a LCDR2 amino acid sequence of SEQ ID NO: 465, and a LCDR3 amino acid sequence of SEQ ID NO: 483.

[0156] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 373, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 393, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 419; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 443, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 466, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 484. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 373, a HCDR2 amino acid sequence of SEQ ID NO: 393, a HCDR3 amino acid sequence of SEQ ID NO: 419, a LCDR1 amino acid sequence of SEQ ID NO: 443, a LCDR2 amino acid sequence of SEQ ID NO: 466, and a LCDR3 amino acid sequence of SEQ ID NO: 484.

[0157] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 374, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 394, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 420; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 444, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 467, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 485. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 374, a HCDR2 amino acid sequence of SEQ ID NO: 394, a HCDR3 amino acid sequence of SEQ ID NO: 420, a LCDR1 amino acid sequence of SEQ ID NO: 444, a LCDR2 amino acid sequence of SEQ ID NO: 467, and a LCDR3 amino acid sequence of SEQ ID NO: 485.

[0158] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 375, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 395, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 421; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 445, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 468, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 486. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 375, a HCDR2 amino acid sequence of SEQ ID NO: 395, a HCDR3 amino acid sequence of SEQ ID NO: 421, a LCDR1 amino acid sequence of SEQ ID NO: 445, a LCDR2 amino acid sequence of SEQ ID NO: 468, and a LCDR3 amino acid sequence of SEQ ID NO: 486.

[0159] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 376, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 396, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 422; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 446, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 469, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 487. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 376, a HCDR2 amino acid sequence of SEQ ID NO: 396, a HCDR3 amino acid sequence of SEQ ID NO: 422, a LCDR1 amino acid sequence of SEQ ID NO: 446, a LCDR2 amino acid sequence of SEQ ID NO: 469, and a LCDR3 amino acid sequence of SEQ ID NO: 487.

[0160] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 373, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 393, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 419; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 447, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 484. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 373, a HCDR2 amino acid sequence of SEQ ID NO: 393, a HCDR3 amino acid sequence of SEQ ID NO: 419, a LCDR1 amino acid sequence of SEQ ID NO: 447, a LCDR2 amino acid sequence of SEQ ID NO: 470, and a LCDR3 amino acid sequence of SEQ ID NO: 484.

[0161] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 488. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 397, a HCDR3 amino acid sequence of SEQ ID NO: 423, a LCDR1 amino acid sequence of SEQ ID NO: 448, a LCDR2 amino acid sequence of SEQ ID NO: 471, and a LCDR3 amino acid sequence of SEQ ID NO: 488.

[0162] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 449, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 488. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 397, a HCDR3 amino acid sequence of SEQ ID NO: 423, a LCDR1 amino acid sequence of SEQ ID NO: 449, a LCDR2 amino acid sequence of SEQ ID NO: 472, and a LCDR3 amino acid sequence of SEQ ID NO: 488.

[0163] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 450, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 488. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 397, a HCDR3 amino acid sequence of SEQ ID NO: 423, a LCDR1 amino acid sequence of SEQ ID NO: 450, a LCDR2 amino acid sequence of SEQ ID NO: 471, and a LCDR3 amino acid sequence of SEQ ID NO: 488.

[0164] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 398, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 488. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 398, a HCDR3 amino acid sequence of SEQ ID NO: 423, a LCDR1 amino acid sequence of SEQ ID NO: 448, a LCDR2 amino acid sequence of SEQ ID NO: 471, and a LCDR3 amino acid sequence of SEQ ID NO: 488.

[0165] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 424; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 489. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 397, a HCDR3 amino acid sequence of SEQ ID NO: 424, a LCDR1 amino acid sequence of SEQ ID NO: 448, a LCDR2 amino acid sequence of SEQ ID NO: 472, and a LCDR3 amino acid sequence of SEQ ID NO: 489.

[0166] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 488. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 397, a HCDR3 amino acid sequence of SEQ ID NO: 423, a LCDR1 amino acid sequence of SEQ ID NO: 448, a LCDR2 amino acid sequence of SEQ ID NO: 472, and a LCDR3 amino acid sequence of SEQ ID NO: 488.

[0167] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 490. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 397, a HCDR3 amino acid sequence of SEQ ID NO: 423, a LCDR1 amino acid sequence of SEQ ID NO: 448, a LCDR2 amino acid sequence of SEQ ID NO: 471, and a LCDR3 amino acid sequence of SEQ ID NO: 490.

[0168] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 398, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 491. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 398, a HCDR3 amino acid sequence of SEQ ID NO: 423, a LCDR1 amino acid sequence of SEQ ID NO: 448, a LCDR2 amino acid sequence of SEQ ID NO: 471, and a LCDR3 amino acid sequence of SEQ ID NO: 491.

[0169] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 399, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 424; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 489. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 399, a HCDR3 amino acid sequence of SEQ ID NO: 424, a LCDR1 amino acid sequence of SEQ ID NO: 448, a LCDR2 amino acid sequence of SEQ ID NO: 472, and a LCDR3 amino acid sequence of SEQ ID NO: 489.

[0170] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 424; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 488. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 377, a HCDR2 amino acid sequence of SEQ ID NO: 397, a HCDR3 amino acid sequence of SEQ ID NO: 424, a LCDR1 amino acid sequence of SEQ ID NO: 448, a LCDR2 amino acid sequence of SEQ ID NO: 471, and a LCDR3 amino acid sequence of SEQ ID NO: 488.

[0171] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 400, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 451, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 473, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 492. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 378, a HCDR2 amino acid sequence of SEQ ID NO: 400, a HCDR3 amino acid sequence of SEQ ID NO: 425, a LCDR1 amino acid sequence of SEQ ID NO: 451, a LCDR2 amino acid sequence of SEQ ID NO: 473, and a LCDR3 amino acid sequence of SEQ ID NO: 492.

[0172] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 401, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 473, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 493. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 378, a HCDR2 amino acid sequence of SEQ ID NO: 401, a HCDR3 amino acid sequence of SEQ ID NO: 425, a LCDR1 amino acid sequence of SEQ ID NO: 452, a LCDR2 amino acid sequence of SEQ ID NO: 473, and a LCDR3 amino acid sequence of SEQ ID NO: 493.

[0173] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 402, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 473, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 493. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 378, a HCDR2 amino acid sequence of SEQ ID NO: 402, a HCDR3 amino acid sequence of SEQ ID NO: 425, a LCDR1 amino acid sequence of SEQ ID NO: 452, a LCDR2 amino acid sequence of SEQ ID NO: 473, and a LCDR3 amino acid sequence of SEQ ID NO: 493.

[0174] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 379, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 403, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 494. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 379, a HCDR2 amino acid sequence of SEQ ID NO: 403, a HCDR3 amino acid sequence of SEQ ID NO: 426, a LCDR1 amino acid sequence of SEQ ID NO: 453, a LCDR2 amino acid sequence of SEQ ID NO: 470, and a LCDR3 amino acid sequence of SEQ ID NO: 494.

[0175] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 380, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 403, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 494. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 380, a HCDR2 amino acid sequence of SEQ ID NO: 403, a HCDR3 amino acid sequence of SEQ ID NO: 426, a LCDR1 amino acid sequence of SEQ ID NO: 453, a LCDR2 amino acid sequence of SEQ ID NO: 470, and a LCDR3 amino acid sequence of SEQ ID NO: 494.

[0176] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 380, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 403, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 494. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 380, a HCDR2 amino acid sequence of SEQ ID NO: 403, a HCDR3 amino acid sequence of SEQ ID NO: 426, a LCDR1 amino acid sequence of SEQ ID NO: 453, a LCDR2 amino acid sequence of SEQ ID NO: 474, and a LCDR3 amino acid sequence of SEQ ID NO: 494.

[0177] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 381, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 404, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 494. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 381, a HCDR2 amino acid sequence of SEQ ID NO: 404, a HCDR3 amino acid sequence of SEQ ID NO: 426, a LCDR1 amino acid sequence of SEQ ID NO: 453, a LCDR2 amino acid sequence of SEQ ID NO: 470, and a LCDR3 amino acid sequence of SEQ ID NO: 494.

[0178] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 381, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 404, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 495. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 381, a HCDR2 amino acid sequence of SEQ ID NO: 404, a HCDR3 amino acid sequence of SEQ ID NO: 426, a LCDR1 amino acid sequence of SEQ ID NO: 453, a LCDR2 amino acid sequence of SEQ ID NO: 470, and a LCDR3 amino acid sequence of SEQ ID NO: 495.

[0179] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 381, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 405, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 494. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 381, a HCDR2 amino acid sequence of SEQ ID NO: 405, a HCDR3 amino acid sequence of SEQ ID NO: 426, a LCDR1 amino acid sequence of SEQ ID NO: 453, a LCDR2 amino acid sequence of SEQ ID NO: 470, and a LCDR3 amino acid sequence of SEQ ID NO: 494.

[0180] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 406, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 427; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 496. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 378, a HCDR2 amino acid sequence of SEQ ID NO: 406, a HCDR3 amino acid sequence of SEQ ID NO: 427, a LCDR1 amino acid sequence of SEQ ID NO: 452, a LCDR2 amino acid sequence of SEQ ID NO: 470, and a LCDR3 amino acid sequence of SEQ ID NO: 496.

[0181] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 407, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 475, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 496. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 378, a HCDR2 amino acid sequence of SEQ ID NO: 407, a HCDR3 amino acid sequence of SEQ ID NO: 425, a LCDR1 amino acid sequence of SEQ ID NO: 452, a LCDR2 amino acid sequence of SEQ ID NO: 475, and a LCDR3 amino acid sequence of SEQ ID NO: 496.

[0182] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 428; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 454, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 497. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 382, a HCDR2 amino acid sequence of SEQ ID NO: 408, a HCDR3 amino acid sequence of SEQ ID NO: 428, a LCDR1 amino acid sequence of SEQ ID NO: 454, a LCDR2 amino acid sequence of SEQ ID NO: 471, and a LCDR3 amino acid sequence of SEQ ID NO: 497.

[0183] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 429; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 455, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 476, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 498. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 382, a HCDR2 amino acid sequence of SEQ ID NO: 408, a HCDR3 amino acid sequence of SEQ ID NO: 429, a LCDR1 amino acid sequence of SEQ ID NO: 455, a LCDR2 amino acid sequence of SEQ ID NO: 476, and a LCDR3 amino acid sequence of SEQ ID NO: 498.

[0184] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 429; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 454, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 468, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 497. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 382, a HCDR2 amino acid sequence of SEQ ID NO: 408, a HCDR3 amino acid sequence of SEQ ID NO: 429, a LCDR1 amino acid sequence of SEQ ID NO: 454, a LCDR2 amino acid sequence of SEQ ID NO: 468, and a LCDR3 amino acid sequence of SEQ ID NO: 497.

[0185] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 430; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 454, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 477, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 497. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 382, a HCDR2 amino acid sequence of SEQ ID NO: 408, a HCDR3 amino acid sequence of SEQ ID NO: 430, a LCDR1 amino acid sequence of SEQ ID NO: 454, a LCDR2 amino acid sequence of SEQ ID NO: 477, and a LCDR3 amino acid sequence of SEQ ID NO: 497.

[0186] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 383, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 409, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 431; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 456, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 499. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 383, a HCDR2 amino acid sequence of SEQ ID NO: 409, a HCDR3 amino acid sequence of SEQ ID NO: 431, a LCDR1 amino acid sequence of SEQ ID NO: 456, a LCDR2 amino acid sequence of SEQ ID NO: 474, and a LCDR3 amino acid sequence of SEQ ID NO: 499.

[0187] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 383, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 409, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 431; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 456, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 478, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 499. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 383, a HCDR2 amino acid sequence of SEQ ID NO: 409, a HCDR3 amino acid sequence of SEQ ID NO: 431, a LCDR1 amino acid sequence of SEQ ID NO: 456, a LCDR2 amino acid sequence of SEQ ID NO: 478, and a LCDR3 amino acid sequence of SEQ ID NO: 499.

[0188] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 384, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 410, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 431; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 457, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 500. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 384, a HCDR2 amino acid sequence of SEQ ID NO: 410, a HCDR3 amino acid sequence of SEQ ID NO: 431, a LCDR1 amino acid sequence of SEQ ID NO: 457, a LCDR2 amino acid sequence of SEQ ID NO: 474, and a LCDR3 amino acid sequence of SEQ ID NO: 500.

[0189] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 384, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 410, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 432; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 458, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 500. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 384, a HCDR2 amino acid sequence of SEQ ID NO: 410, a HCDR3 amino acid sequence of SEQ ID NO: 432, a LCDR1 amino acid sequence of SEQ ID NO: 458, a LCDR2 amino acid sequence of SEQ ID NO: 474, and a LCDR3 amino acid sequence of SEQ ID NO: 500.

[0190] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 385, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 411, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 433; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 459, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 501. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 385, a HCDR2 amino acid sequence of SEQ ID NO: 411, a HCDR3 amino acid sequence of SEQ ID NO: 433, a LCDR1 amino acid sequence of SEQ ID NO: 459, a LCDR2 amino acid sequence of SEQ ID NO: 470, and a LCDR3 amino acid sequence of SEQ ID NO: 501.

[0191] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 386, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 412, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 434; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 460, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 479, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 502. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 386, a HCDR2 amino acid sequence of SEQ ID NO: 412, a HCDR3 amino acid sequence of SEQ ID NO: 434, a LCDR1 amino acid sequence of SEQ ID NO: 460, a LCDR2 amino acid sequence of SEQ ID NO: 479, and a LCDR3 amino acid sequence of SEQ ID NO: 502.

[0192] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 387, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 413, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 435; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 461, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 201, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 503. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 387, a HCDR2 amino acid sequence of SEQ ID NO: 413, a HCDR3 amino acid sequence of SEQ ID NO: 435, a LCDR1 amino acid sequence of SEQ ID NO: 461, a LCDR2 amino acid sequence of SEQ ID NO: 201, and a LCDR3 amino acid sequence of SEQ ID NO: 503.

[0193] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 414, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 436; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 462, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 480, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 504. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 4, a HCDR2 amino acid sequence of SEQ ID NO: 414, a HCDR3 amino acid sequence of SEQ ID NO: 436, a LCDR1 amino acid sequence of SEQ ID NO: 462, a LCDR2 amino acid sequence of SEQ ID NO: 480, and a LCDR3 amino acid sequence of SEQ ID NO: 504.

[0194] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 388, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 415, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 437; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 461, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 201, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 505. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 388, a HCDR2 amino acid sequence of SEQ ID NO: 415, a HCDR3 amino acid sequence of SEQ ID NO: 437, a LCDR1 amino acid sequence of SEQ ID NO: 461, a LCDR2 amino acid sequence of SEQ ID NO: 201, and a LCDR3 amino acid sequence of SEQ ID NO: 505.

[0195] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 416, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 438; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 462, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 480, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 506. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 4, a HCDR2 amino acid sequence of SEQ ID NO: 416, a HCDR3 amino acid sequence of SEQ ID NO: 438, a LCDR1 amino acid sequence of SEQ ID NO: 462, a LCDR2 amino acid sequence of SEQ ID NO: 480, and a LCDR3 amino acid sequence of SEQ ID NO: 506.

[0196] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 414, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 436; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 462, a LCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 480, and a LCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 507. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 4, a HCDR2 amino acid sequence of SEQ ID NO: 414, a HCDR3 amino acid sequence of SEQ ID NO: 436, a LCDR1 amino acid sequence of SEQ ID NO: 462, a LCDR2 amino acid sequence of SEQ ID NO: 480, and a LCDR3 amino acid sequence of SEQ ID NO: 507.

[0197] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 389, a HCDR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to SEQ ID NO: 417, and a HCDR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to SEQ ID NO: 439. In a particular embodiment, the anti-GAL-3 antibody comprises a HCDR1 amino acid sequence of SEQ ID NO: 389, a HCDR2 amino acid sequence of SEQ ID NO: 417, a HCDR3 amino acid sequence of SEQ ID NO: 439.

[0198] In some embodiments, the anti-GAL-3 antibody comprises all six CDRs of an antibody selected from the group consisting of 1104SBC1068-033, 1104SBC1068-335, 1104SBC1068-365, 1104SBC1068-374, 1104SBC1068-378, 1220SBC1068-022, 1220SBC1068-035, 1220SBC1068-041, 1220SBC1068-056, 1220SBC1068-058, 1220SBC1068-063, 1220SBC1068-097, 1220SBC1068-098, 1220SBC1068-099, 1220SBC1068-129, 1220SBC1068-164, 1220SBC1068-186, 1220SBC1068-197, 1220SBC1068-210, 1220SBC1068-274, 1220SBC1068-281, 20240628SBC1080-002, 20240628SBC1080-003, 20240628SBC1080-004, 20240628SBC1080-005, 20240628SBC1080-006, 20240628SBC1080-007, 20240628SBC1080-008, 20240628SBC1080-009, 20240903SBC1093-015, 20240903SBC1093-020, 20240903SBC1093-021, 20240903SBC1093-025, 20240903SBC1093-030, 20240903SBC1093-182, 20240903SBC1093-183, 20240903SBC1093-184, 20240903SBC1093-185, 20240903SBC1093-230, 20240903SBC1093-033, 20240903SBC1093-034, 20240903SBC1093-035, 20240903SBC1093-044, 20240903SBC1093-054, 20240903SBC1093-055, 20240903SBC1093-056, 20240903SBC1093-057, 20240903SBC1093-059, 20240903SBC1093-219, 20240903SBC1093-228, 20240903SBC1093-023, 20240903SBC1093-036, 20240903SBC1093-037, 20240903SBC1093-220, 20240903SBC1093-074, 20240903SBC1093-075, 20240903SBC1093-193, 20240903SBC1093-194, 20240903SBC1093-099, 20240929SBC1205-022, 20241223SBC1205-061, 20241223SBC1205-063, 20241223SBC1205-119, 20241223SBC1205-130, 20241223SBC1205-131, and ANbl361-hGal-3-LP3R3 P2-69, as the Hv and HL CDR amino acid sequences of the antibodies listed in Tables 3 and 4, respectively. Table 3. Heavy chain CDR sequences Antibody ID HCDR1 HCDR2 HCDR3 1104SBC1068-033 SDYAWN (SEQ ID NO: 1) YISYSGSTSYNPSLKS (SEQ ID NO: 22) EGGRGGTEGYYFDY (SEQ ID NO: 43) 1104SBC1068-335 NYGMN (SEQ ID NO: 2) WINTYSGEPTYVDDFKG (SEQ ID NO: 23) GTVVGFDY (SEQ ID NO: 44) U04SBC1068-365 NYGMN (SEQ ID NO: 3) WINTNTGEPTYSEEFKG (SEQ ID NO: 24) SSYYAMDY (SEQ ID NO: 45) 1104SBC1068-374 NYGMN (SEQ ID NO: 4) WTNTYTGEPTYADDFKG (SEQ ID NO: 25) YAMDY (SEQ ID NO: 46) SIF001 NYGMN (SEQ ID NO: 4) WTNTYTGEPTYADDFKG (SEQ ID NO: 25) YAMDY (SEQ ID NO: 46) 1104SBC1068-378 NYGMN (SEQ ID NO: 5) WTNTYTGEPTYADDFKG (SEQ ID NO: 26) WDDYDGFAY (SEQ ID NO: 47) 1220SBC1068-022 DYGMA (SEQ ID NO: 6) FISNLAYSVYYADTVTG (SEQ ID NO: 27) DRGLRESMDY (SEQ ID NO: 48) 1220SBC1068-035 GYTMN (SEQ ID NO: 7) L1SPYSGGTNYNQRFKG (SEQ ID NO: 28) SGFUTGVPTNFDV (SEQ ID NO: 49) 1220SBC1068-041 RFWMS (SEQ ID NO: 8) ETSPDSNTTDLTPSLKD (SEQ ID NO: 29) PYYGYY (SEQ ID NO: 50) SIF002 RFWMS (SEQ ID NO: 8) EISPDSNTIDLTPSLKD (SEQ ID NO: 29) PYYGYY (SEQ ID NO: 50) 1220SBC1068-056 DYGMA (SEQ ID NO: 9) FISNLAYSVYYADTVTG (SEQ ID NO: 30) DRGLRESMDY (SEQ ID NO: 51) 122OSBC1068-058 DYGMA (SEQ ID NO: 10) FISNLAYSVYYADTVTG (SEQ ID NO: 31) DRGLRETMDY (SEQ ID NO: 52) 1220SBC1068-063 RFWMS (SEQ ID NO: 11) EISPNSST1HQTPSLKD (SEQ ID NO: 32) PYYGYY (SEQ ID NO: 53) 1220SBC1068-097 RYWMS (SEQ ID NO: 12) EINPDSSTIDLTPSLKD (SEQ ID NO: 33) PYHGYY (SEQ ID NO: 54) 1220SBC1068-098 RYWMS (SEQ ID NO: 13) EISPDSSTIDLTPSLKD (SEQ ID NO: 34) PYHGYY (SEQ ID NO: 55) 1220SBC1068-099 RYWMT (SEQ ID NO: 14) EINPHSSTITYTPSLKD (SEQ ID NO: 35) PYYGYY (SEQ ID NO: 56) 1220SBC1068-129 RFWMS (SEQ ID NO: 15) EINPDSSTrrYTPSLKD (SEQ ID NO: 36) PYYGYY (SEQ ID NO: 57) 1220SBC1068-164 RYWMS (SEQ ID NO: 16) EISPDSSTINYTASLKD (SEQ ID NO: 37) PYYGYY (SEQ ID NO: 58) 1220SBC1068-186 GYTMN (SEQ ID NO: 17) LISPYSGGTNYNQKFKG (SEQ ID NO: 38) SGFITTGVATNFDV (SEQ ID NO: 59) 1220SBC1068-197 RFWMS (SEQ EISPNSSTIHQTPSLKD (SEQ PYYGYY (SEQ ID NO: ID NO: 18) ID NO: 39) 60) 1220SBC1068-210 RYWMS (SEQ ID NO: 19) EINPDSSTIDLTPSLKD (SEQ ID NO: 40) PYYGYY (SEQ ID NO: 61) 1220SBC1068-274 RYWMS (SEQ ID NO: 20) EISPDSNTIDLTPSLKD (SEQ ID NO: 41) PYYGYY (SEQ ID NO: 62) 1220SBC1068-281 DFGMA (SEQ ID NO: 21) FISNLAYNIYYSDTVTG (SEQ ID NO: 42) DRGLRETMDY (SEQ ID NO: 63) 2O240628SBC1080-002 NHHIN (SEQ ID NO: 370) IISASGSAYYANWAKG(SEQ ID NO:390) ESWMDL(SEQ     ID NO:418) 20240628SBC1080-003 NIII UN (SEQ ID NO: 371) 11S N GGS A Y Y A N W AKG(S E Q ID NO:391) ESWMDL(SEQ     ID NO:418) 20240628SBC1080- 004 NNAMT(SEQ ID NO:372 Y1W RGGET Y Y A S W A K G(S E Q ID NO:392) DNL 20240628SBC1080-005 RYGVS(SEQ ID NO:373) YIYIGDGSTYYASWVNG(SE QIDNO:393) SYLSSGWGVDL(SEQ ID NO:419) 20240628SBC1O8O-006 YYAMG(SEQ ID NO :374) IIDTNNVTYYASWAKG(SEQ ID NO:394) GGLDL(SEQ ID NO:420) 2024O628SBC1080-007 HYAMG(SEQ IDNO:375) YITFGGIAYYANWAKG(SE Q ID NO:395) YADFAYNL(SEQ   ID NO:421) 2024O628SBC1080- 008 NNHMG(SEQ ID NO:376) FINGNGVGSAFYANWAKG( SEQ ID NO:396) GPGYGCFDL(SEQ ID NO:422) 2024O628SBC1080-009 RYGVS(SEQ ID NO:373) YIYIGDGSTYYASWVNG(SE Q ID NO:393) SYESSGWGVDL(SEQ ID NO :419) 20240903SBC1093- 015 SYWMI(SEQ ID NO:377) GISTIDNTYYASWAKG(SEQ ID NO:397) NFDT(SEQ ID NO:423) 2024O903SBC1093- 020 SYWMI(SEQ ID NOG 77) GISTIDNTYYASWAKG(SEQ ID NO:397) NFDT(SEQ ID NO:423) 2024O903SBC1093- 021 SYWMI(SEQ ID NO :3 77) GISTIDNTYYASWAKG(SEQ ID NO:397) NFDT(SEQ ID NO:423) 20240903SBC1093- 025 SYWMI(SEQ ID NO:377) GISTIDNTYYATWAKG(SEQ ID NO:398) NFDT(SEQ ID NO:423) 20240903SBC1093- 030 SYWMI(SEQ ID NO:377) GISTIDNTYYASWAKG(SEQ ID NO:397) NFDI(SEQ ID NO:424) 2024O903SBC1093- 182 SYWMI(SEQ ID NO:377) GISTIDNTYYASWAKG(SEQ ID NO:397) NFDT(SEQ ID NO:423) 2024O903SBC1093- 183 SYWMI(SEQ ID NO:377) GISTIDNTYYASWAKG(SEQ ID NO:397) NFDT(SEQ ID NO:423) 20240903SBC1093- 184 SYWMI(SEQ ID NO:377) GISTIDNTYYATWAKG(SEQ ID NO:398) NFDT(SEQ ID NO:423) 2024O903SBC1093- 185 SYWMI(SEQ ID NOG77) GISTIDNTYYSTWAKG(SEQ ID NO:399) NFDI(SEQ ID NO:424) 2024O903SBC1093- 230 SYWMI(SEQ ID NO :3 77) GISTIDNTYYASWAKG(SEQ ID NO:397) NFDI(SEQ ID NO:424) 20240903SBC1093- 033 DYAVF(SEQ ID NO:378) FISSIGSTYYASWAKG(SEQ ID NO:400) WNLDI(SEQ ID NO:425) 2024O903SBC1093- 034 DYAVF(SEQ ID NO:378) FISSVGTTFYASWAKG(SEQ ID NO:401) WNLDI(SEQ ID NO:425) 20240903SBC1093- DYAVF(SEQ ID FISSVGTTFYATWAKG(SEQ WNLDI(SEQ ID NO:425) 035 NO:378) ID NO:402) 20240903SBC1093- 044 KYAVN(SEQ ID NO:379) FIDAVGDTYYARWAKG(SE Q ID NO:403) WNTDI(SEQ ID NO:426) 20240903SBC1093-054 NYAVN(SEQ ID NO:380) F1D A VGDT Y YA R W A KG(S E Q ID NO:403) \\M !)l(SI Q ID NO:426) 20240903SBC1093- 055 NYAVN(SEQ ID NO:380) FIDAVGDTYYARWAKG(SE Q ID NO:403) WNTDI(SEQ ID NO:426) 2Q24O903SBC1093- 056 NYAVY(SEQ ID NO:381) FIDAVGNTYYARWAKG(SE Q ID NO:404) WNTDI(SEQ ID NO;426) 20240903SBC1093-057 NYAVY(SEQ ID NO:381) FIDAVGNTYYARWAKG(SE Q ID NO:404) WXTDKSFQ ID NO:426) 202409O3SBC1O93-059 NYAVY(SEQ ID NO:381) FIDAVGSTYYARWAKG(SE Q ID NO:405) WNTDI(SEQ ID NO:426) 2024O903SBC1093- 219 DYAVF(SEQ ID NO:378) FISSVGTKFYASWAKG(SEQ ID NO:406) WNMDI(SEQ ID NO:427) 2024O903SBC1093- 228 DYAVF(SEQ ID NO:378) FIS SVGTT Y Y AP W AKG( SEQ ID NO:407) WNLD1(SEQ ID NO:425) 20240903SBC1093- 023 DYNFQ(SEQ ID NO:382) TIGIGTDTYYATWAIG(SEQ ID NO :408) DLYGGDSV(SEQ   ID NO:428) 20240903SBC1093- 036 DYNFQ(SEQ ID NO:382) TIGIGTDTYYATWAIG SEQ ID NO:408) DLYGGDSI(SEQ    ID NO:429) 2024O903SBC1093- 037 DYNFQ(SEQ ID NO :3 82) riGIG ID 1’YYA I'WAIG SEQ IDNO:408) DLYGGDSI(SEQ    ID NO:429) 2024O903SBC1093- 220 DYNFQ(SEQ ID NO:382) TIGIGTDTYYATWAIG SEQ ID NO:408) DLYGGDNI(SEQ    ID NO:430) 2024O903SBC1093-074 NYYMN(SEQ IDNO:383) FINTGGSAYYASWAKG(SE Q ID NO:409) FAVVAGLNI(SEQ ID NO:431) 2024O903SBC1093- 075 NYYMN(SEQ ID NO:383) FINTGGSAYYASWAKG(SE Q ID NO-409) FAVVAGLNI(SEQ ID NO:431) 20240903SBC1093- 193 SYYMN(SEQ ID NO :3 84) FIDTGGSAYFASWAKG(SE Q ID NO:410) FAVVAGLNI(SEQ ID NO:431) 2024O903SBC1093- 194 SYYMN(SEQ ID NO:384) FID'rGGSAYFASWAKG(SE Q ID NO:410) FAVVGGLM(SEQ ID NO :432) 2O24O903SBC1093- 099 RYYMS(SEQ ID NO:385) SITTGGKGYYASWAKG(SE Q ID NO:411) WDYLTDFDI(SEQ ID NO:433) 20240929SBC1205- 022 RYVMH(SEQ ID NO:386) YINPYNHDTKYNEKFKG(S EQIDNO:412) LDGYYAMDY(SEQ ID NO:434) 20241223 SBC1205-061 DYIML(SEQ ID NO:387) NINPYYGSTSYNLKFKGfSE QIDNO:413) DGNEKYGRFAY(SEQ ID NO:435) 20241223SBC1205- 063 NYGMNISEQ ID NO:4) WINTYTGEPTYVDDFKG(S EQ ID NO:414) YGDYYGNSYRGFDY(S EQ ID NO:436) 20241223SBC1205- 119 GYFMN(SEQ ID NO:388) RINHYNGDTFYNQKFKG(S EQIDNO:415) AEIH YD YDD AMD Y( SE Q ID NO:437) 20241223 SBC 1205130 NYGMN(SEQ ID NO :4) WINTYTGEPTYSDDFKG(SE Q ID NO:416) YGDYYGSSYRGFDY(SE Q ID NO:438) 20241223 SBCT 205131 NYGMN(SEQ ID NO:4) WINTYTGEPTYVDDFKG(S EQ ID NO:414) YGDYYGNSYRGFDY(S EQIDNO:436) ANbl361-hGal-3- HYSIG(SEQ ID CISTSDGSTYYADSVKG(SE GKGSRCHGDLDA(SEQ | LP3R3 P2-69       NO:389)       |QIDNO:417)               IDNO:439) Table 4. Light chain CDR sequences Antibody ID LCDR1 LCDR2 LCDR3 1104SBC1068- 033 RASES VDSYGNSFMH (SEQ ID NO: 169) LASNLES (SEQ ID NO: 190) QQNNEDPLT (SEQ ID NO: 211) 1104SBC1068- 335 KSSQSLLDSDGKTYLN (SEQ ID NO: 170) LVSKLDS (SEQ ID NO: 191) WQGTHFPQT (SEQ ID NO: 212) 1104SBC1068- 365 KSSQSLLDSDGKTYLN (SEQ ID NO: 171) LVSKLDS (SEQ ID NO: 192) WQATHFPQT (SEQ ID NO: 213) 1104SBC1068- 374 RSSTGAVTTSNYAN (SEQ ID NO: 172) GTSNRAP (SEQ ID NO: 193) ALWYSTHYV (SEQ ID NO: 214) S1F001 RSSTGAVTTSNYAN (SEQ ID NO: 172) GTSNRAP (SEQ ID NO: 193) ALWYSTHYV (SEQ ID NO: 214) 1104SBC1068- 378 RASQS1SNNLH (SEQ ID NO: 173) YASQS1S (SEQ ID NO: 194) QQSNSWPLT (SEQ ID NO: 215) 1220SBC1068- 022 RSSKSLLHNNGNTYLC (SEQ ID NO: 174) RMSDLAS (SEQ ID NO: 195) MQHLEYPYT (SEQ ID NO: 216) 1220SBC1068- 035 KASQDVSTAVA (SEQ ID NO: 175) SASYRYT (SEQ ID NO: 196) QQHYTTPRT (SEQ ID NO: 217) 1220SBC1068-041 RSSQSLFNSTNQKNYL T (SEQ ID NO: 176) WASSRES (SEQ ID NO: 197) QNDYTSPFT (SEQ ID NO: 218) SIF002 RSSQSLFSSTNQKNYLT (SEQ ID NO: 369) WASSRES (SEQ ID NO: 197) QNDYTSPFT (SEQ ID NO: 218) 1220SBC1068-056 GSSKSLLHKNGNTYLC (SEQ ID NO: 177) RMSNLAS (SEQ ID NO: 198) MQHLEYPYT (SEQ ID NO: 219) 1220SBC1068-058 RSSKSLLHNNGNTYLC (SEQ ID NO: 178) RMSNLAS (SEQ ID NO: 199) MQHLEYPYT (SEQ ID NO: 220) 1220SBC1068- 063 KSSQSLLSSINQKNYLT (SEQ ID NO: 179) WATSRES (SEQ ID NO: 200) HNDYSYPFT (SEQ ID NO: 221) 1220SBC1068- 097 RSSQSLLNSTNQKNYL T (SEQ ID NO: 180) WASTRES (SEQ ID NO: 201) QNDYTSPFT (SEQ ID NO: 222) 1220SBC1068- 098 RSSQSLLNSTNQKNYL T (SEQ ID NO: 181) WASTKES (SEQ ID NO: 202) QNDYTSPFT (SEQ ID NO: 223) 1220SBC1068- 099 KS SQSLLNSGNQKIYLT (SEQ ID NO: 182) WASIRES (SEQ ID NO: 203) QNDYSSPFT (SEQ ID NO: 224) 1220SBC1068- 129 KSSQSLLNSTNQKNYL T (SEQ ID NO: 183) WASTRDS (SEQ ID NO: 204) HNDYISPFT (SEQ ID NO: 225) 1220SBC1068- 164 KSSQSLFNSGNQKNYL T (SEQ ID NO: 184) WAYTRES (SEQ ID NO: 205) I1NDYTSPFT (SEQ ID NO: 226) 1220SBC1068- 186 KASQDVSTAVA (SEQ ID NO: 185) SASNRY'T (SEQ ID NO: 206) QQHYSTPRT (SEQ ID NO: 227) 1220SBC1068-197 KSSQSLLNSINQKNYLT (SEQ ID NO: 186) WATFRES (SEQ ID NO: 207) IINDYSYPFT (SEQ ID NO: 228) 1220SBC1068- RSSQSLLNSTNQKNYL WASTRES (SEQ ID QNDYTSPFT (SEQ ID 210 T(SEQ ID NO: 187) NO: 208) NO: 229) 1220SBC1068- 274 RSSQSLLNSTNQKNYL T(SEQ ID NO: 188) WASTRES (SEQ ID NO: 209) QNDYTSPFT (SEQ ID NO: 230) 1220SBC1068- 281 RSNKSLLHSNGNAYLS (SEQ ID NO: 189) RVSDLAS (SEQ ID NO: 210) MQHLEFPYT (SEQ ID NO: 231) 20240628SBC1 080-002 QASQSVGGNNDLA(SE Q ID NO:440) KASNLAS(SEQ ID NO :463) QGYYPGWIRA(SEQ ID NO:481) 20240628SBC1 080-003 QSSQSVGNNNDLA(SE QIDNO:441) R!SNLAP(SEQ ID NO :464) LAYYPDW1RG(SEQ ID NO:482) 20240628SBC1 080-004 QSSQRVYNNWLS(SEQ ID NO:442) EASKLAS(SEQ ID NO:465) LGTYDCSSADCGA(SE QIDNO:483) 20240628SBC1 080-005 QASESIDNALA(SEQ ID NO:443) LASTLVP(SEQ    ID NO :466) QQGYSISNVDNV(SEQ ID NO:484) 20240628SBC1 080-006 QSSQSVYNYNWLS(SE Q ID N 0:444) SVSTLAS(SEQ ID NO:467) LGIYDCVSADCYG(SEQ 1DNO:485) 20240628SBC1 080-007 QASQSVYSDNRLA(SE Q ID NO:445) RASTLAS(SEQ   ID NO:468) LGEYSDSGEDT(SEQ ID NO:486) 20240628SBC1 080-008 QSSQSVYNNNLLA(SE Q ID NO:446) STSTLAS(SEQ    ID NO:469)      ’ Q AF YNDDM W V(SEQ ID NO:487) 20240628SBC1 080-009 QANETTGNALA(SEQ ID NO:447) LASTLAS(SEQ    ID NO :470) QQGYSTSNVDNV(SEQ ID NO :484) 2024O903SBC1 093-015 QSSQSVGSNNRLS(SEQ ID NO:448) GASNLAS(SEQ ID NO:471) LGSYNCADGDCNA(SE Q ID NO:488) 20240903SBC1 093-020 QSSIISVGSNNRLS(SEQ ID NO :449) GAFNLAS(SEQ ID NO:472) LGSYNCADGDCNA(SE Q ID NO:488) 20240903SBC1 093-021 QSSQSVGNNKRLS(SEQ ID NO:450) GASNLAS(SEQ ID NO :471) LGSYNCADGDCNA(SE Q ID NO:488) 202409O3SBC1 093-025 QSSQSVGSNNRLS(SEQ ID NO :448) GASNLAS(SEQ ID NO:471) LGSYNCADGDCNA(SE Q ID NO:488) 20240903SBC1 093-030 QSSQSVGSNNRLS(SEQ ID NO-448) GAFNLAS(SEQ ID NO:472) LGSYNCANGDCNA(SE Q ID NO:489) 20240903SBC1 093-182 QSSQSVGSNNRLS(SEQ ID NO:448) GAFNLAS(SEQ ID NO :472) LGSYNCADGDCNA(SE Q ID NO:488) 20240903SBC1 093-183 QSSQSVGSNNRLS(SEQ ID NO :448) GASNLAS(SEQ ID NO:471) LGSYNCADGDCNT(SE Q ID NO:490) 20240903SBC1 093-184 QSSQSVGSNNRLS(SEQ ID NO:448) GASNLAS(SEQ ID NO:471) LGSYNCAEGDCNA(SE Q ID NO:491) 20240903SBC1 093-185 QSSQSVGSNNRLS(SEQ ID NO:448) GAFNLAS(SEQ ID NO :472) LGSYNCANGDCNA(SE Q ID NO:489) 20240903SBC1 093-230 QSSQSVGSNNRLS(SEQ ID NO :448) GASNLAS(SEQ ID NO:471) LGSYNCADGDCNA(SE Q ID NO:488) 20240903SBC1 093-033 QSSQTIWDNNWLA(SE Q ID NO:451) LASKLAS(SEQ ID NO:473) AGTYSDNIYS(SEQ ID NO:492) 20240903SBC1 093-034 QSSQSIWDNNWLA(SE Q ID NO:452) LASKLAS(SEQ ID NO :473) AGTYSDNVYT(SEQ ID NO:493) 20240903SBC1 093-035 QSSQSIWDNNWLA(SE Q ID NO:452) LASKLAS(SEQ ID NO:473) AGTYSDNVYT(SEQ ID NO:493) 20240903SBC1 HSSHS1YDNN WLS( SEQ LASTLAS(SEQ    ID AGTYSYN1YT(SEQ ID 093-044 ID NO:453) NO:470) NO:494) 20240903SBC1 093-054 HSSHSIYDNNWLS(SEQ ID NO:453) LASTLAS(SEQ ID N0:470) AGTYSYNIYT(SEQ ID NO:494) 20240903SBC1 093-055 HSSHSTYDNNWLS(SEQ ID NO:453) SASTLAS(SEQ    ID NO :474) AGTYSYNTYT(SEQ ID NO:494) 20240903SBC1 093-056 HSSHSIYDNNWLS(SEQ ID NO:453) LASTLAS(SEQ    ID NO:470) AGTYSYNIYT(SEQ ID NO :494) 20240903SBC1 093-057 IISSIISIYDNNWLS(SEQ ID NO:453) LASTLAS(SEQ ID NO:470) AGTYTYNIYT(SEQ ID NO:495) 20240903SBC1 093-059 HSSHSIYDNNWLS(SEQ ID NO-453) LASTLASfSEQ    ID NO:470) AGTYSYNIYT(SEQ ID NO:494) 20240903SBC1 093-219 QSSQS1WDNNWLA(SE Q ID NO:452) LASTLAS(SEQ    ID NO:470) AGTYSDN1YT(SEQ ID NO:496) 20240903 SBC! 093-228 QSSQSIWDNNWLA(SE Q ID NO:452) LASKLAT(SEQ ID NO:475) AGTYSDNIYT(SEQ ID NO:496) 20240903 SBC 1 093-023 QSSESVWQNNRLS(SE Q ID NO:454) GASNLAS(SEQ ID NO:471) AGLKAWNDDDDG(SE Q ID NO:497) 20240903SBC1 093-036 QASQSVWQNNRLS(SE Q ID NO:455) TASTLAS(SEQ    ID NO:476) AGLRA WN DDDDG( SE Q ID NO:498) 20240903SBC1 093-037 QSSESVWQNNRLS(SE Q ID NO:454) RASTLAS(SEQ   ID NO:468) AGLKAWNDDDDG(SE Q ID NO :497) 20240903 SBC 1 093-220 QSSESVWQNNRLS(SE Q ID NO:454) QASKLAS(SEQ ID NO:477) AGLKAWNDDDDG(SE Q ID NO :497) 20240903SBC1 093-074 QSSQSVYNNNWLS(SE Q ID NO:456) SASTLAS(SEQ    ID NO:474) AGDYSVGIYT(SEQ id NO:499) 20240903SBC1 093-075 QSSQSVYNNNWLS(SE Q ID NO:456) YASTLAS(SEQ ID NO:478) AGDYSVGIYT(SEQ id NO :499) 20240903SBC1 093-193 QSSESVYSDWLS(SEQ ID NO:457) SASTLAS(SEQ    ID NO:474) AGDYSVGIYA(SEQ ID NO :5 00) 202409O3SBC1 093-194 QSSQSVYSDWLS(SEQ 1DNO:458) SASTLAS(SEQ ID NO:474) AGDYSVGIYA(SEQ id NO:500) 20240903SBC1 093-099 QASESVYNNNFLS(SEQ IDNO;459) LASTLAStSEQ    ID NO:470) AGVKSDSTDGL4(SEQ ID NO: 501) 20240929SBC1 205-022 SASQAISNYLN(SEQ ID NO:460) YTSSLYSfSEQ    ID NO:479) QQYIKLPRT(SEQ ID NO:502) 20241223SBC1 205-061 KSSQSLLYSSNQKNYL A(SEQ ID NO:461) WASTRES(SEQ ID NO :201) QQYYSYPT(SEQ ID NO:503) 20241223 SBC1 205-063 KASQDVGTVVA(SEQ ID NO:462) WASTRHT(SEQ ID NO:480) QQYSSYPLT(SEQ ID NO:504) 20241223SBC1 205-119 KSSQSLLYSSNQKNYL A(SEQ ID NO:461) WASTRES(SEQ ID NO:201) QQYYNYPLT(SEQ ID NO:505) 20241223 SBC 1 205-130 KASQDVGTVVA(SEQ ID NO:462) WASTRHT(SEQ ID NO:480) QQYSRYPLT(SEQ ID NO:506) 20241223SBC1 205-131 KASQDVGTVVA(SEQ ID NO:462) WASTRHT(SEQ ID NO:480) QQYSSFPLT(SEQ ID NO:507)

[0199] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable (VH) region further comprising a heavy chain framework 1 (HFR1), HFR2, HFR3, and HFR4 and a light chain variable (VL) region comprising light chain FR 1 (LFR1), LFR2, LFR3, and LFR4. In some embodiments, the VH region comprises a HFR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 64-84, 337, and 341, a HFR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 85-105, 338, and 342, a HFR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 106-126, 339, and 343, and / or a HFR4 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 137-157, 340, and 344. In some embodiments, the VL region comprises a LFR1 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 232-252, 345, and 349, a LFR2 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 253-273, 346, and 350, a LFR3 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 274-294, 347, and 351, and / or a LFR4 amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 295-315, 348, and 352. The exemplary heavy chain FR and light chain FR amino acid sequences are listed in Tables 5 and 6, respectively.

[0200] In some embodiments, the anti-GAL-3 antibody comprises all CDRs and FRs of an antibody selected from the group consisting of 1104SBC1068-033, 1104SBC1068-335, 1104SBC1068-365, 1104SBC1068-374, 1104SBC1068-378, 1220SBC1068-022, 1220SBC1068-035, 1220SBC1068-041, 1220SBC1068-056, 1220SBC1068-058, 1220SBC1068-063, 1220SBC1068-097, 1220SBC1068-098, 1220SBC1068-099, 1220SBC1068-129, 1220SBC1068-164, 1220SBC1068-186, 1220SBC1068-197, 1220SBC1068-210, 1220SBC1068-274, 1220SBC1068-281, SIF-001, and SIF-002. The Hv CDR, HL CDR, Hv FR, and HL FR amino acid sequences of the antibodies are listed in Tables 3-6, respectively. Table 5. Heavy chain framework sequences Antibo dylD HFR1 HFR2 HFR3 HFR4 1104SB Cl 068033 DVQLQESGPGLVKPS QSLSLTCTVTGYSIT (SEQ ID NO: 64) WIRQFPGNKLE WMG (SEQ ID NO: 85) RISITRDASKNQFFLQL NSVTTEDTATYYCAR (SEQ ID NO: 106) WGQGTTLTV SS (SEQ ID NO: 127) 1104SB C1068-335 QIQLVQSGPELKKPG ETVKISCKASGYIFT (SEQ ID NO: 65) WVKQAPGKGL KWMG (SEQ ID NO: 86) RFVFSLETSASTAYLQI NNLKNEDMATYFCAR (SEQ ID NO: 107) WGQGTTLTV SS (SEQ ID NO: 128) 1104SB C1068- 365 QIQLVQSGPELKKPG ETVKISCKASGYTFT (SEQ ID NO: 66) WVKQAPGKGL KWMG (SEQ ID NO: 87) RFAFSLETSASTAYLQI NNLKNEDTATYFCGR (SEQ ID NO: 108) WGQGTSVTV SS (SEQ ID NO: 129) 1104SB C1068- 374 QIQLVQSGPELKKPG ETVKISCKASGYTFT (SEQ ID NO: 67) WVKQAPGKGL KWMG (SEQ ID NO: 88) RFAFSLETSASTAYLQI NNLKNEDMATYFCAR (SEQ ID NO: 109) WGQGTSVTV SS (SEQ ID NO: 130) 1104SB C1068-378 QIQLVQSGPELKKPG ETVKISCKASGYTFT (SEQ ID NO: 68) WVKQAPGKGL KWMG (SEQ ID NO: 89) RFAFSLETSASTAYLQI NNLKNEDTATYFCAR (SEQ ID NO: 110) WGQGTLVT VSA (SEQ ID NO: 131) 1220SB C1068-022 EVKLVESGGGLVQP GGSRKLSCAASGFTF S (SEQ ID NO: 69) WFRQAPGKGP EWVA (SEQ ID NO: 90) RFTISRENAKNTLFLEM sslrsedtAiyyctr (SEQ ID NO: 111) WGQGTSVTV SS (SEQ ID NO: 132) 1220SB C1068- 035 EVQLQQSGPELVKPG ASMK1SCKASGYAFT (SEQ ID NO: 70) WVKQSHGKNL EWIG (SEQ ID NO: 91) KATFTVDKSSSTAYME LLSLTSEDSGV Y YCAR (SEQ ID NO: 112) WGAGTTVT VSS (SEQ ID NO: 133) 1220SB C1068-041 EVKLLESGGGLVQPG GSLKLSCAASGFDFS (SEQ ID NO: 71) WVRQAPGKGL EWIG (SEQ ID NO: 92) NFHSRDNAKNALFLQ MSKVRSEDTALYYCTR (SEQ ID NO: 113) WGQGTLVT VSA (SEQ ID NO: 134) 1220SB C1068- 056 EVKLVESGGGLVQP GGSRKLSCAASGFTF S (SEQ ID NO: 72) WFRQAPGKGP EWVA (SEQ ID NO: 93) RFTISRENAKNTLYLE MSSLRSEDTAIYYCTR (SEQ ID NO: 114) WGQGTSVTV SS (SEQ ID NO: 135) 1220SB Cl 068058 EVKLVESGGGLVQP GGSRKLSCAASGFTF S (SEQ ID NO: 73) WFRQAPGKGP EWVA (SEQ ID NO: 94) RFTISRENAKNTLYLE MN SLRSED TAI Y Y CTR (SEQ ID NO: 115) WGQGTSVTV SS (SEQ ID NO: 136) 1220SB C1068-063 EVNLLESGGGLVQPG GSLKLSCEASGFDFS (SEQ ID NO: 74) WVRQTPGEGL EWIG (SEQ ID NO: 95) RF11SRDNAKNTLFLQM TKVTSDDSALYYCAR (SEQ ID NO: 116) WGHGTLVT VSA (SEQ ID NO: 137) 1220SB C1068- 097 EVKLLESGGGLVQPG GSLKLSCAASGFDFS (SEQ ID NO: 75) WVRQAPGKGL EWIG (SEQ ID NO: 96) NFIISRDNAKNALYLQ MSKVKSEDTALYYCTR (SEQ ID NO: 117) WGQGTLVT VSA (SEQ ID NO: 138) 1220SB Cl 068098 EVKLLESGGGLVQPG GSLKLSCAASGFDFS (SEQ ID NO: 76) WVRQAPGKGL EWIG (SEQ ID NO: 97) NFIISRDNAKNALYLQ MSKVKSEDTALYYCTR (SEQ ID NO: 118) WGQGTLVT VSA (SEQ ID NO: 139) 1220SB C1068-099 EVKLLESGGGLVQPG GSLKLSCAASGFDFS (SEQ ID NO: 77) WVRQAPGKGL EWIG (SEQ ID NO: 98) KFIISRDNAKNTLYLQ MSKVSSEDTALYYCAR (SEQ ID NO: 119) WGQGTLVT VSA (SEQ ID NO: 140) 1220SB C1068- EVKLLESGGDLVQPG GSLKLSCAASGFDFS WVRQAPGKGL EWIG (SEQ ID KFTISRDNAKSSLYLQM SKVTSEDTALYYCAR WGQGTLVT VSA (SEQ ID 129 (SEQIDNO: 78) NO: 99) (SEQ ID NO: 120) NO: 141) 1220SB Cl 068164 EVKLLESGGGLVQPG GSLKLSCAASGFDFS (SEQ ID NO: 79) WVRQAPGKGL EWIG (SEQ ID NO: 100) KFNISRDNAKNTLYLQ MSKVRSEDTALYYCA R (SEQ ID NO: 121) WGQGTLVT VSE (SEQ ID NO: 142) 1220SB Cl 068186 EVQLQQSGPELVKPG ASMKMSCKASGYSF I (SEQ ID NO: 80) WVKQSHGKNL EWTG (SEQ ID NO: 101) KATLTVDKSSSTAYME VFSLTSEDSGVYYCAR (SEQ ID NO: 122) WGAGTTVT VSS (SEQ ID NO: 143) 1220SB C1068-197 EVNLLESGGGLVQPG GSLKLSCEASGFDFS (SEQIDNO: 81) WVRQTPGEGL EWIG (SEQ ID NO: 102) KFFISRDNAKSTLFLQM TNVTSEDSALYYCAR (SEQ ID NO: 123) WGIIGTLVT VSA (SEQ ID NO: 144) 1220SB Cl 068210 EVKLLESGGGLVQPG GSLKLSCAASGFDFS (SEQ ID NO: 82) WVRQAPGKGL EWIG (SEQ ID NO: 103) NFIISRDNAKNALYLQ MSKVRSEDTALYYCTR (SEQ ID NO: 124) WGQGTLVT VSA (SEQ ID NO: 145) 1220SB Cl 068274 EVKLLESGGGLVQPG GSLKLSCAASGFDFS (SEQIDNO: 83) WVRQAPGKGL EWIG (SEQ ID NO: 104) NFIISRDNAKNALYLQ MSKLRSEDTALYYCTR (SEQ ID NO: 125) WGQGTLVT VSA (SEQ ID NO: 146) 1220SB Cl 068281 EVKLVESGGGLVQS GGSRKLSCAASGFTF S (SEQ ID NO: 84) WVRQAPGKGP EWVA (SEQ ID NO: 105) RFTISRENAKNTLYLE MS SLRSEDTA V Y Y CTR (SEQ ID NO: 126) WGQGTSVTV SS (SEQ ID NO: 147) SIF001 QVQLVQSGSELKKP GASVKVSCKASGYT FT (SEQ ID NO: 337) WVRQAPGQGL EWMG (SEQ ID NO: 338) RFVFSLDTSVSTAYLQI SSLKNEDMAVYFCAR (SEQ ID NO: 339) WGQGTLVT VSS (SEQ ID NO: 340) SJF002 EVQLLESGGGLVQPG GSLRLSCAASGFTFS (SEQ ID NO: 341) WVRQAPGKGL EWVS (SEQ ID NO: 342) RFTISRDNSKNTLYLQ MNSLRAEDTAVYYCA K (SEQ ID NO: 343) WGQGTLVT VSS (SEQ ID NO: 344) Table 6. Light chain framework sequences Antibod y ID LFR1 LFR2 LFR3 LFR4 1104 SBC 1068-033 NIVLTQSPASLAV SLGQRATISC (SEQ ID NO: 232) WYQQKPGQPP KLLIY (SEQ ID NO: 253) GVPARFSGSGSRTDFTL TIDPVEADDAATYYC (SEQ ID NO: 274) FGAGTKLEL K (SEQ ID NO: 295) 1104 SBC 1068-335 DVVMTQTPLTLS VTIGQPASISC (SEQ ID NO: 233) WLLQRPGQSPK RLIY (SEQ ID NO: 254) GVPDRFTGSGSGTDFTL KISRVEAEDLGVYYC (SEQ ID NO: 275) FGGGTKLEIK (SEQ ID NO: 296) 1104 SBC 1068-365 DVVMTQTPLTLS VTIGQPASISC (SEQ ID NO: 234) WLLQRPGQSPK RLIY (SEQ ID NO: 255) GVPDRFTGSGSGTDFTL KISRVEAEDLGVYYC (SEQ ID NO: 276) FGGGTKLEIK (SEQ ID NO: 297) 1104SBC 1068-374 QAVVTQESALTT SPGGTVILTC (SEQ ID NO: 235) WVQEKPDHLFT GLIG (SEQ ID NO: 256) GVPVRFSGSLIGDKAAL TITGAQTEDDAMYFC (SEQ ID NO: 277) FGGGTKVTV L (SEQ ID NO: 298) 1104 SBC 1068-378 DTVLTQSPATLSV TPGDSVSLSC (SEQ ID NO: 236) WYQQKSHESPR LLIK (SEQ ID NO: 257) GTPSRFSGSGSGTDFTLSI NSVETEDFGMYFC (SEQ ID NO: 278) FGAGTKLEL K (SEQ ID NO: 299) 1220 SBC 1068-022 DIVMTQAAPSVP VTPGESVSISC WFLQRPGQSPQ LLIY (SEQ ID GVPDRFSGSGSGTAFTL RI SRVEAED VGVYYC FGGGTKLEIK (SEQ ID NO: (SEQ ID NO: 237) NO: 258) (SEQ ID NO: 279) 300) 1220SBC 1068-035 DIVMTQSHKFMS TSVGDGVNITC (SEQ ID NO: 238) WYQQKPGQSP RLLIY (SEQ ID NO: 259) GVPDRFTGSGSGTDFTF TISSMQAEDLAVYYC (SEQ ID NO: 280) FGGGTKLEIK (SEQ ID NO: 301) 1220 SBC 1068-041 DIVMTQSPSSLTV TAGEKVTMNC (SEQ ID NO: 239) WYQQKPGQPP KLLIY (SEQ ID NO: 260) GVPDRFTGSGSGTDFTL T1STVQTEDLAVYYC (SEQ ID NO: 281) FGSGTRLEIK (SEQ ID NO: 302) 1220SBC 1068-056 DTVMTQAAPSVP VTPGESVSISC (SEQ ID NO: 240) WFLQRPGQSPQ LLIY (SEQ ID NO: 261) GVPDRFSGSGSGTAFTL RISSVEAEDVG1YYC (SEQ ID NO: 282) FGGGTKLEIK (SEQ ID NO: 303) 1220 SBC 1068-058 DTVMTQAAPSVP VTPGESVSISC (SEQ ID NO: 241) WFLQRPGQSPQ LLIY (SEQ ID NO: 262) GVPDRFSGSGSGTAFTL RISRVEAEDVGVYYC (SEQ ID NO: 283) FGGGTKLEIK (SEQ ID NO: 304) 1220 SBC 1068-063 DIVMTQSPSSLTV TAGEKVTMSC (SEQ ID NO: 242) WYQQKPGQPP KLLIY (SEQ ID NO: 263) GVPDRFTGSGSGTDFTL TISSLQAEDLAVYYC (SEQ ID NO: 284) FGSGTRLEIK (SEQ ID NO: 305) 1220 SBC 1068-097 DIVMTQSPSSLTV TAGEKVTMNC (SEQ ID NO: 243) WYQQKPGQPP KLLIY (SEQ ID NO: 264) GVPDRFTGSGSGTDFTL T1NTVQAEDLA1YYC (SEQ ID NO: 285) FGSGTKLEIK (SEQ ID NO: 306) 1220SBC 1068-098 DIVMTQSPSSLTV TAGEKVTMNC (SEQ ID NO: 244) WYQQKPGQPP KLLIY (SEQ ID NO: 265) GVPDRFTGSGSGTDFTL TINTVQAEDLAVYYC (SEQ ID NO: 286) FGSGTKLEIK (SEQ ID NO: 307) 1220SBC 1068-099 DIVMTQSPSSLTV TAGEKVTMSC (SEQ ID NO: 245) WYQQKPGQPP KLLIY (SEQ ID NO: 266) GVPDRFTGSGSGTDFTL TISSVQAEDLAVYYC (SEQ ID NO: 287) FGSGTKLEIK (SEQ ID NO: 308) 1220SBC 1068-129 DIVMTQSPSSLTV TAGKEVTMSC (SEQ ID NO: 246) WYQQKPGQSP KLLIY (SEQ ID NO: 267) GVPDRFTGSGSGTDFTL T1SSVQAEDLAIYYC (SEQ ID NO: 288) FGSGTKLEIK (SEQ ID NO: 309) 1220 SBC 1068-164 DIVMTQSPSSLTV TAGEKVTMSC (SEQ ID NO: 247) WYQQKPGQPP KLLIY (SEQ ID NO: 268) GVPDRFTGSGSGTDFTL TIHGVQAEDLAVYYC (SEQ ID NO: 289) FGSGTKLEM K (SEQ ID NO: 310) 1220 SBC 1068-186 DTVMTQSHKFMS TSVGDRVSITC (SEQ ID NO: 248) WYQQRPGQSP KLLIY (SEQ ID NO: 269) GVPDRFTGSGSGTDFTF TISSMQAEDLAIYYC (SEQ ID NO : 290) FGGGTKLEIK (SEQ ID NO: 311) 1220SBC 1068-197 DIVMTQSPSSLTV TAGEKVTMSC (SEQ ID NO: 249) WYQQKPGQPP KLLIY (SEQ ID NO: 270) GVPDRFTGSGSGTDFTL TISGLQAEDLAVYYC (SEQ ID NO: 291) FGSGTRLEIK (SEQ ID NO: 312) 1220SBC 1068-210 DIVMTQSPSSLTV TAGEKVTMNC (SEQ ID NO: 250) WYQQRPGQPP KLLIY (SEQ ID NO: 271) GVPDRFTGSGSGTDFTL TISTVQAEDLAVYYC (SEQ ID NO: 292) FGSGTKLEIK (SEQ ID NO: 313) 1220 SBC 1068-274 DIVMTQSPSSLTV TAGEKVTMNC (SEQ ID NO: 251) WYQQKPGQPP KLLIY (SEQ ID NO: 272) GVPDRFTGSGSGSDFTL TISTVQAEDLAVYYC (SEQ ID NO: 293) FGSGTKLEIK (SEQ ID NO: 314) 1220SBC 1068-281 DTVMTQAAPSVP VTPGESVSISC (SEQ ID NO: 252) WFLQRPGQSPQ LLIY (SEQ ID NO: 273) GVPDRF SGSGSGT AFTL RISRVEAEDVGIYYC (SEQ ID NO: 294) FGGGTKLEIK (SEQ ID NO: 315) S1F001 EAVVTQEPSLTVS PGGTVTLTC (SEQ ID NO: 345) WVQQKPGQAF TGLIG (SEQ ID NO: 346) GTPARFSGSLLGDKAAL TLLGAQPEDEAEYFC (SEQ ID NO: 347) FGGGTKLTV L (SEQ ID NO: 348) S1F002 DIVMTQSPDSLA VSLGERATMNC (SEQ ID NO: 349) WYQQKPGQPP KLLIY (SEQ ID NO: 350) GVPDRFSGSGSGTDFTL TISSLQAEDVAVYYC (SEQ ID NO: 351) FGQGTRLEIK (SEQ ID NO: 352)

[0201] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable (VH) region comprising a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 148-168, 353, and 355, and a VL region comprising a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 316-336, 354, and 356.

[0202] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 148, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 316. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 148 and a VL amino acid sequence of SEQ ID NO: 316 (e.g., the antibody 1104SBC1068-033).

[0203] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 149, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 317. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 149 and a VL amino acid sequence of SEQ ID NO: 317 (e.g., the antibody 1104SBC1068-035).

[0204] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 150, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 318. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 150 and a VL amino acid sequence of SEQ ID NO: 318 (e.g., the antibody 1104SBC1068-065).

[0205] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 151, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 319. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 151 and a VL amino acid sequence of SEQ ID NO: 319 (e.g., the antibody 1104SBC1068-074).

[0206] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 152, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 320. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 152 and a VL amino acid sequence of SEQ ID NO: 320 (e.g., the antibody 1104SBC1068-078).

[0207] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 153, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 321. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 153 and a VL amino acid sequence of SEQ ID NO: 321 (e.g., the antibody 1220SBC1068-022).

[0208] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 154, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 322. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 154 and a VL amino acid sequence of SEQ ID NO: 322 (e.g., the antibody 1220SBC1068-035).

[0209] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 155, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 323. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 155 and a VL amino acid sequence of SEQ ID NO: 323 (e.g., the antibody 1220SBC1068-041).

[0210] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 156, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 324. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 156 and a VL amino acid sequence of SEQ ID NO: 324 (e.g., the antibody 1220SBC1068-056).

[0211] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 157, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 325. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 157 and a VL amino acid sequence of SEQ ID NO: 325 (e.g., the antibody 1220SBC1068-058).

[0212] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 158, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 326. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 158 and a VL amino acid sequence of SEQ ID NO: 326 (e.g., the antibody 1220SBC1068-063).

[0213] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 159, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 327. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 159 and a VL amino acid sequence of SEQ ID NO: 327 (e.g., the antibody 1220SBC1068-097).

[0214] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 160, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 328. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 160 and a VL amino acid sequence of SEQ ID NO: 328 (e.g., the antibody 1220SBC1068-098).

[0215] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 161, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 329. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 161 and a VL amino acid sequence of SEQ ID NO: 329 (e.g., the antibody 1220SBC1068-099).

[0216] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 162, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 330. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 162 and a VL amino acid sequence of SEQ ID NO: 330 (e.g., the antibody 1220SBC1068-129).

[0217] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 163, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 331. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 163 and a VL amino acid sequence of SEQ ID NO: 331 (e.g., the antibody 1220SBC1068-164).

[0218] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 164, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 332. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 164 and a VL amino acid sequence of SEQ ID NO: 332 (e.g., the antibody 1220SBC1068-186).

[0219] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 165, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 333. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 165 and a VL amino acid sequence of SEQ ID NO: 333 (e.g., the antibody 1220SBC1068-197).

[0220] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 166, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 334. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 166 and a VL amino acid sequence of SEQ ID NO: 334 (e.g., the antibody 1220SBC1068-210).

[0221] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 167, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 335. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 167 and a VL amino acid sequence of SEQ ID NO: 335 (e.g., the antibody 1220SBC1068-274).

[0222] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 168, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 336. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 168 and a VL amino acid sequence of SEQ ID NO: 336 (e.g., the antibody 1220SBC1068-281).

[0223] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 353, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 354. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 353 and a VL amino acid sequence of SEQ ID NO: 354 (e.g., the antibody SIF-001) .

[0224] In some embodiments, the anti-GAL-3 antibody comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 355, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 356. In a particular embodiment, the anti-GAL-3 antibody comprises a VH amino acid sequence of SEQ ID NO: 355 and a VL amino acid sequence of SEQ ID NO: 356 (e.g., the antibody SIF-002) .

[0225] In some embodiments, the anti-GAL-3 antibody comprises a Hv and HL amino acid sequence of an antibody selected from the group consisting of 1104SBC1068-033, 1104SBC1068-335, 1104SBC1068-365, 1104SBC1068-374, 1104SBC1068-378, 1220SBC1068-022, 1220SBC1068-035, 1220SBC1068-041, 1220SBC1068-056, 1220SBC1068-058, 1220SBC1068-063, 1220SBC1068-097, 1220SBC1068-098, 1220SBC1068-099, 1220SBC1068-129, 1220SBC1068-164, 1220SBC1068-186, 1220SBC1068-197, 1220SBC1068-210, 1220SBC1068-274, 1220SBC1068-281, SIF-001, and SIF002. The Hv and HL amino acid sequence of the antibodies are listed in Table 7. Table 7. Heavy and Light variable region sequences Ant ibo dy ID HV LV 110 4S BC 106 8 033 DVQLQESGPGLVKPSQSLSLTCTVTGYSITSD YAWNWIRQFPGNKLEWMGYISYSGSTSYNP SLKSRISITRDASKNQFFLQLNSVTTEDTATY YCAREGGRGGTEGY YFD YWGQGTTLT VS S (SEQ ID NO: 148) NIVLTQSPASLAVSLGQRATISCRASESV DSYGNSFMHWYQQKPGQPPKLLIYLAS NLESGVPARFSGSGSRTDFTLTIDPVEAD DAATYYCQQNNEDPLTFG AGTKLELK (SEQ ID NO: 316) no 4S BC 106 8 335 QIQLVQSGPELKKPGETVKISCKASGYIFTNY GMNWVKQAPGKGLKWMGWINTYSGEPTY VDDFKGRFVFSLETSASTAYLQINNLKNEDM ATYFCARGTVVGFDYWGQGTTLTVSS (SEQ ID NO: 149) DVVMTQTPLTLSVTIGQPASISCKSSQSL LDSDGKTYLNWLLQRPGQSPKRLIYLVS KLDSGVPDRFTGSGSGTDFTLKISRVEAE DLGVYYCWQGTHFPQTFGGGTKLEIK (SEQ ID NO: 317) 110 48 BC 106 8 365 QIQLVQSGPELKKPGETVKISCKASGYTFTN YGMNWVKQAPGKGLKWMGWINTNTGEPT YSEEFKGRFAFSLETSASTAYLQINNLKNEDT ATYFCGRSSYYAMDYWGQGTSVTVSS (SEQ ID NO: 150) DVVMTQTPLTLSVTIGQPASISCKSSQSL LDSDGKTYLNWLLQRPGQSPKRLIYLVS KLDSGVPDRFTGSGSGTDFTLKISRVEAE DLGVYYCWQATI1FPQ TFGGGTKLEIK (SEQ ID NO: 318) 110 48 BC 106 8374 QIQLVQSGPELKKPGETVKISCKASGYTFTN YGMNWVKQAPGKGLKWMGWINTYTGEPT YADDFKGRFAFSLETSASTAYLQINNLKNED MATYFCARYAMDYWGQGTSVTVSS (SEQ ID NO: 151) QAVVTQESALTTSPGGTVILTCRSSTGA V'ITSNYANWVQEKPDIILFTGLIGGTSNR APGVPVRFSGSLIGDKAALTITGAQTED DAMYFCALWYSTHYVFGGGTKVTVL (SEQ ID NO: 319) no 4S BC 106 8 378 QIQLVQSGPELKKPGETVKISCKASGYTFTN YGMNWVKQAPGKGLKWMGWINTYTGEPT YADDFKGRFAFSLETSASTAYLQINNLKNED TATYFCARWDDYDGFAYWGQGTLVTVSA (SEQ ID NO: 152) DIVLTQSPATLSVTPGDSVSLSCRASQSIS NNLHWYQQKSHESPRLLIKYASQSISGIP SRFSGSGSGTDFTLSINSVETEDFGMYFC QQSNSWPLTFGAGTKLELK (SEQ ID NO: 320) 122 OS BC 106 EVKLVESGGGLVQPGGSRKLSCAASGFTFSD YGMAWFRQAPGKGPEWVAFISNLAYSVYY ADTVTGRFTISRENAKNTLFLEMSSLRSEDT ATYYCTRDRGLRESMDYWGQGTSVTVSS DIVMTQAAPSVPVTPGESVSISCRSSKSL LHNNGNTYLCWFLQRPGQSPQLLIYRMS DLASGVPDRFSGSGSGTAFTLRISRVEAE D VGV Y YCMQITLEYP YTFGGGTKLETK 8 022 (SEQ ID NO: 153) (SEQ ID NO: 321) 122 OS BC 106 8035 EVQLQQSGPELVKPGASMKISCKASGYAFTG YTMN W VKQSHGKNLE W1GL1SPY SGGTN YN QRFKGKATFTVDKSSSTAYMELLSLTSEDSG VYYCARSGFITTGVPTNFDVWGAGTTVTVSS (SEQ ID NO : 154) DIVMTQSHKFMSTSVGDGVNITCKASQD VSTAVAWYQQKPGQSPRLL1YSASYRYT GVPDRFTGSGSGTDFTFTISSMQAEDLA VYYCQQHYTTPRTFGGGTKLEIK (SEQ ID NO: 322) 122 OS BC 106 8041 EVKLLESGGGLVQPGGSLKLSCAASGFDFSR FWMSWVRQAPGKGLEWIGEISPDSNTIDLTP SLKDNFIISRDNAKNALFLQMSKVRSEDTAL YYCTRPYYGYYWGQGTLVTVSA (SEQ ID NO: 155) DIVMTQSPSSLTVTAGEKVTMNCRSSQS LFNSTNQKNYLTWYQQKPGQPPKLLIY WASSRESGVPDRFTGSGSGTDFTLTISTV QTEDLAVYYCQNDYTSPFTFGSGTRLEI K (SEQ ID NO: 323) 122 OS BC 106 8056 EVKLVESGGGLVQPGGSRKLSCAASGFTFSD YGMAWFRQAPGKGPEWVAFISNLAYSVYY ADT VTGRFTISRENAKNTL YLEMS SLRSED T AIYYCTRDRGLRESMDYWGQGTSVTVSS (SEQ ID NO: 156) DIVMTQAAPSVPVTPGESVSISCGSSKSL LHKNGNTYLCWFLQRPGQSPQLLIYRMS NLASGVPDRFSGSGSGTAFTLRISSVEAE DVG1YYCMQI1LEYPYTFGGGTKLEIK (SEQ ID NO: 324) 122 OS BC 106 8058 EVKLVESGGGLVQPGGSRKLSCAASGFTFSD YGMAWFRQAPGKGPEWVAFISNLAYSVYY ADTVTGRFTISRENAKNTLYLEMNSLRSEDT AIYYCTRDRGLRETMDYW'GQGTS VTVSS (SEQ ID NO: 157) DIVMTQAAPSVPVTPGESVSlSCRSSKSL LHNNGNTYLCWFLQRPGQSPQLLIYRMS NLASGVPDRFSGSGSGTAFTLRISRVEAE D VGV YYCMQHLE YP YTFGGGTKLEIK (SEQ ID NO: 325) 122 OS BC 106 8063 EVNLLESGGGLVQPGGSLKLSCEASGFDFSR FWMSWVRQTPGEGLEWIGEISPNSSTIHQTPS LKDRFIISRDNAKNTLFLQMTKVTSDDSALY YCARPYYGYYWGHGTLVTVSA (SEQ ID NO: 158) DIVMTQSPSSLTVTAGEKVTMSCKSSQS LLSSINQKNYLTWYQQKPGQPPKLLIYW ATSRESGVPDRFTGSGSGTDFTLTISSLQ AEDLAVYYCHNDYSYPFTFGSGTRLEIK (SEQ ID NO: 326) 122 OS BC 106 8097 EVKLLESGGGLVQPGGSLKLSCAASGFDFSR YWMSWVRQAPGKGLEWIGEINPDSSTIDLTP SLKDNFIISRDNAKNALYLQMSKVKSEDTAL YYCTRPYHGYYWGQGTLVTVSA (SEQ ID NO: 159) DIVMTQSPSSLTVTAGEKVTMNCRSSQS LLNSTNQKNYLTWYQQKPGQPPKLLIY WASTRESGVPDRFTGSGSGTDFTLTINT VQAEDLAIYYCQNDY TSPFTFGSGTKLEI K (SEQ ID NO: 327) 122 OS BC 106 8098 EVKLLESGGGLVQPGGSLKLSCAASGFDFSR YWMSWVRQAPGKGLEWIGEISPDSSTIDLTP SLKDNFIISRDNAKNALYLQMSKVKSEDTAL YYCTRPYHGYYWGQGTLVTVSA (SEQ ID NO: 160) DIVMTQSPSSLTVTAGEKVTMNCRSSQS LLNSTNQK.NYLTWYQQK.PGQPPK.LLIY WASTKESG VPDRFTG SGSGTDFTLTINT VQAEDLAVYYCQNDYTSPFTFGSGTKLE IK (SEQ ID NO: 328) 122 OS BC 106 8- EVKLLESGGGLVQPGGSLKLSCAASGFDFSR YWMTWVRQAPGKGLEWIGEINPHSSTITYTP SLKDKFIISRDNAKNTLYLQMSKVSSEDTAL YYCARPYYGYYWGQGTLVTVSA (SEQ ID NO: 161) DIVMTQSPSSLTVTAGEKVTMSCKSSQS LLNSGNQKIYLTWYQQKPGQPPKLLIYW ASIRESGVPDRFTGSGSGTDFTLTISSVQ AEDLAVYYCQNDYSSPFTFGSGTKLEIK (SEQ ID NO: 329) 099 122 OS BC 106 8129 EVKLLESGGDLVQPGGSLKLSCAASGFDFSR FWMSWVRQAPGKGLEWIGEINPDSSTITYTP SLKDKFIISRDNAKS SL YLQMSKVTSEDTAL YYCARPYYGYYWGQGTLVTVSA (SEQ ID NO: 162) DIVMTQSPSSLTVTAGKEVTMSCKSSQS LLNSTNQKNYLTWYQQKPGQSPKLLIY WASTRDSGVPDRFTGSGSGTDFTLTISSV QAEDLAIYYCHNDYISPFTFGSGTKLEIK (SEQ ID NO: 330) 122 OS BC 106 8 164 evkllesggglvqpggslklscaasgfdfsr YWMSWVRQAPGKGLEWIGEISPDSSTINYTA SLKDKF’NlSRDNAKNTLYLQMSKVRSEDTAL YYCARPYYGYYWGQGTLVTVSE (SEQ ID NO: 163) divmtqspssltvtagekvtmsckssqs LFNSGNQKNYLTWYQQKPGQPPKLLIY WAYTRESGVPDRFTGSGSGTDFTLTIHG vqaedlavyyciindytspftfgsgtkle MK (SEQ ID NO: 331) 122 OS BC 106 8186 EVQLQQSGPELVKPGASMKMSCKASGYSFT GYTMNWVKQSHGKNLEWIGLlSPYSGGTNY NQKFKGKATLTVDKSSSTAYMEVFSLTSEDS GVYYCARSGFITTGVATNFDVWGAGTTVTV SS (SEQ ID NO: 164) D1VMTQSHKFMSTSVGDR VSITCKASQD VSTAVAWYQQRPGQSPKLLIYSASNRYT GVPDRFTGSGSGTDFTFTISSMQAEDLAI YYCQQHYSTPRTFGGGTKLEIK (SEQ ID NO: 332) 122 OS BC 106 8197 EVNLLESGGGLVQPGGSLKLSCEASGFDFSR FWMSWVRQTPGEGLEWTGEISPNSSTTIIQTPS LKDKFFISRDNAKSTLFLQMTNVTSEDSALY YCARPYYGYYWGHGTLVTVSA (SEQ ID NO: 165) DIVMTQSPSSLTVTAGEKVTMSCKSSQS LLNSTNQKNYLTWYQQKPGQPPKLLTYW ATFRESGVPDRFTGSGSGTDFTLTISGLQ AEDLAVYYCHNDYSYPFTFGSGTRLEIK (SEQ ID NO: 333) 122 OS BC 106 8210 EVKLLESGGGLVQPGGSLKLSCAASGFDFSR YWMSWVRQAPGKGLEWIGEINPDSSTIDLTP SLKDNFIISRDNAKNALYLQMSKVRSEDTAL YYCTRPYYGYYWGQGTLVTVSA (SEQ ID NO: 166) DIVM TQSPSSLTV TAGEKVTMNCRSSQS LLNSTNQKNYLTWYQQRPGQPPKLLIY WASTRESGVPDRFTGSGSGTDFTLTISTV QAEDLAVYYCQNDYTSPFTFGSGTKLEI K(SEQ ID NO: 334) 122 OS BC 106 8274 evkllesggglvqpggslklscaasgfdfsr YWMSWVRQAPGKGLEWIGEISPDSNTIDLTP SLKDNFIISRDNAKNALYLQMSKLRSEDTAL YYCTRPYYGYYWGQGTLVTVSA (SEQ ID NO: 167) DIVMTQSPSSLTVTAGEKVTMNCRSSQS LLNSTNQKNYLTWYQQKPGQPPKLLIY WASTRESGVPDRFTGSGSGSDFTLTISTV QAEDLAVYYCQNDYTSPFTFGSGTKLEI K (SEQ ID NO: 335) 122 OS BC 106 8281 EVKLVESGGGLVQSGGSRKLSCAASGFTFSD FGMAWVRQAPGKGPEWVAFISNLAYNIYYS DTVTGRFTISRENAKNTLYLEMSSLRSEDTA VYYCTRDRGLRETMDYWGQGTSVTVSS (SEQ ID NO: 168) DIVMTQAAPSVPVTPGESVSISCRSNKSL LHSNGNAYLSWFLQRPGQSPQLLIYRVS DLASGVPDRFSGSGSGTAFTLRISRVEAE DVGIYYCMQHLEFPYTFGGGTKLEIK (SEQ ID NO: 336) SIF 001 QVQLVQSGSELKKPGASVKVSCKASGYTFT NYGMN WVRQAPGQGLEWMGWINTYTGEP TYADDFKGRFVFSLDTSVSTAYLQISSLKNE DMAVYFCARYAMDYWGQGTLVTVS S (SEQ ID NO: 353) EAWTQEPSLTVSPGGTVTLTCRSSTGA VTTSNYANWVQQKPGQAFTGLIGGTSN RAPGTPARFSGSLLGDKAALTLLGAQPE DEAEYFCALWYSTHYVFGGGTKLTVL (SEQ ID NO: 354) SIF 002 EVQLLESGGGLVQPGGSLRLSCAASGFTFSR FWMSWVRQAPGKGLEWVSEISPDSNTIDLTP SLKDRFT1SRDN SKNTLYLQMN SLRAEDTA V YYCAKPYYGYYWGQGTLVTVSS (SEQ ID NO: 355) DIVMTQSPDSLAVSLGERATMNCRSSQS LFS STNQKNYLTWYQQKPGQPPKLLIY WASSRESGVPDRFSGSGSGTDFTLT1SSL QAEDVAVYYCQNDYTSPFTFGQGTRLEI K (SEQ ID NO: 356)

[0226] In some embodiments, the anti-GAL-3 antibody comprises a heavy chain variable region comprising a HCDR1 comprising a sequence NYGMN (SEQ ID NO: 4), or a variant HCDR1 in which 1, 2, or 3 amino acids are substituted relative to the sequence; a HCDR2 comprising a sequence WINTYTGEPTYADDFKG (SEQ ID NO: 25) , or a variant HCDR2 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a HCDR3 comprising a sequence YAMDY (SEQ ID NO: 46), or a variant HCDR3 in which 1, 2, or 3 amino acids are substituted relative to the sequence. In some embodiments, the anti-GAL-3 antibody further comprises a light chain variable region comprising a LCDR1 comprising a sequence RSSTGAVTTSNYAN (SEQ ID NO: 172), or a variant LCDR1 in which 1 amino acid is substituted relative to the sequence; a LCDR2 comprising a sequence GTSNRAP (SEQ ID NO: 193), or variant LCDR2 in which 1 amino acid is substituted relative to the sequence; and a LCDR3 comprising a sequence ALWYSTHYV (SEQ ID NO: 214), or a variant LCDR3 in which 1 amino acid is substituted relative to the sequence.

[0227] In some embodiments, the antibody or the binding fragment thereof that binds to Galectin-3 comprises a heavy chain variable region comprising a HCDR1 comprising a sequence RFWMS (SEQ ID NO: 8), or a variant HCDR1 in which 1, 2, or 3 amino acids are substituted relative to the sequence; a HCDR2 comprising a sequence EISPDSNTIDLTPSLKD (SEQ ID NO: 29) , or a variant HCDR2 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a HCDR3 comprising a sequence PYYGYY (SEQ ID NO: 50), or a variant HCDR3 in which 1, 2, or 3 amino acids are substituted relative to the sequence. In some embodiments, the anti-GAL-3 antibody further comprises a light chain variable region comprising a LCDR1 comprising a sequence RSSQSLFNSTNQKNYLT (SEQ ID NO: 176) or RSSQSLFSSTNQKNYLT (SEQ ID NO: 369), or a variant LCDR1 in which 1 amino acid is substituted relative to the sequence; a LCDR2 comprising a sequence WASSRES (SEQ ID NO: 197), or variant LCDR2 in which 1 amino acid is substituted relative to the sequence; and a LCDR3 comprising a sequence QNDYTSPFT (SEQ ID NO: 218), or a variant LCDR3 in which 1 amino acid is substituted relative to the sequence.

[0228] In some embodiments, the antibody or the binding fragment thereof that binds to Galectin-3 comprises a HCDR1 comprising a sequence of NX2GMN (SEQ ID NO: 357), wherein X2 is Y, W, or F, wherein the HCDR1 has zero or one aa substitution in rest of the residues relative to the HCDR1 sequence, a HCDR2 comprising a sequence of XJXsTYTGEPTYADDFKG (SEQ ID NO: 358), Where X! is W, Y, or F, and wherein X3 is N or Q, wherein the HCDR2 has zero, one, two, three, or four aa substitutions in rest of the residues relative to the HCDR2 sequence, a HCDR3 comprising a sequence of YAMDY (SEQ ID NO: 359), wherein the HCDR3 has zero, one, or two aa substitutions relative to the HCDR3 sequence, a LCDR1 comprising a sequence of RSSTGAVTTSNX12AN (SEQ ID NO: 360), wherein X12 is Y, W, or F, wherein the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, a LCDR2 comprising a sequence of GTSNRAP (SEQ ID NO: 361), wherein the LCDR2 has zero, one, two, or three aa substitutions in the rest of the residues relative to the LCDR2 sequence, and a LCDR3 comprising a sequence of ALX3YSTHX8V (SEQ ID NO: 362), wherein X3 is Y, W, or F, wherein X8 is Y, W, or F, wherein the LCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the LCDR3 sequence.

[0229] In some embodiments, the antibody or the binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of NX2GMN (SEQ ID NO: 357), wherein X2 is Y, W, or F, a HCDR2 comprising a sequence of X1IX3TYTGEPTYADDFKG (SEQ ID NO: 358), Where X! is W, Y, or F, and wherein X3 is N or Q, a HCDR3 comprising a sequence of YAMDY (SEQ ID NO: 359), a LCDR1 comprising a sequence of RSSTGAVTTSNX12AN (SEQ ID NO: 360), wherein Xi2 is Y, W, or F, a LCDR2 comprising a sequence of GTSNRAP (SEQ ID NO: 361), and a LCDR3 comprising a sequence of ALX3YSTHX8V (SEQ ID NO: 362), wherein X3 is Y, W, or F, wherein X8 is Y, W, or F; wherein the HCDR1 has zero or one aa substitution in rest of the residues relative to the HCDR1 sequence, the HCDR2 has zero, one, two, three, or four aa substitutions in rest of the residues relative to the HCDR2 sequence, the HCDR3 has zero, one, or two aa substitutions relative to the HCDR3 sequence, the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, the LCDR2 has zero, one, two, or three aa substitutions in the rest of the residues relative to the LCDR2 sequence, or the LCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the LCDR3 sequence.

[0230] In some embodiments, the antibody or the binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of RFX3MS (SEQ ID NO: 363), wherein X3 is Y, W, or F, and wherein the HCDR1 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR1 sequence, a HCDR2 comprising XJSPDSNTIDLTPSLKD (SEQ ID NO: 364), wherein Xi is E or D, and wherein the HCDR2 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the HCDR2 sequence, a HCDR3 comprising PYYGX5Y (SEQ ID NO: 365), wherein X5 is Y, W, or F, wherein the HCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR3 sequence, a LCDR1 comprising RSSQSLFSSTNQKNX15LT (SEQ ID NO: 366), wherein Xi5 is Y, W, or F, wherein the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, a LCDR2 comprising WASSRES (SEQ ID NO: 367), wherein the LCDR2 has zero, one, two, or three aa substitutions relative to the LCDR2 sequence, and a LCDR3 comprising QNDYTSPFT (SEQ ID NO: 368), wherein the LCDR3 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR3 sequence.

[0231] In some embodiments, the antibody or the binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of RFX3MS (SEQ ID NO: 363), wherein X3 is Y, W, or F, a HCDR2 comprising XJSPDSNTIDLTPSLKD (SEQ ID NO: 364), wherein X! is E or D, a HCDR3 comprising PYYGX5Y (SEQ ID NO: 365), wherein X5 is Y, W, or F, a LCDR1 comprising RSSQSLFSSTNQKNX15LT (SEQ ID NO: 366), wherein X15 is Y, W, or F, a LCDR2 comprising WASSRES (SEQ ID NO: 367), and a LCDR3 comprising QNDYTSPFT (SEQ ID NO: 368) ; and wherein the HCDR1 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR1 sequence, the HCDR2 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the HCDR2 sequence, the HCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR3 sequence, the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, the LCDR2 has zero, one, two, or three aa substitutions relative to the LCDR2 sequence, or the LCDR3 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR3 sequence.

[0232] In some embodiments, the antibody or the binding fragment thereof that binds to Galectin-3, wherein the antibody comprises a HCDR1 comprising a sequence of NYGMN (SEQ ID NO: 4) , a HCDR2 comprising a sequence of WINTYT-GEPTYADDFKG (SEQ ID NO: 25), a HCDR3 comprising a sequence of YAMDY (SEQ ID NO: 46), a LCDR1 comprising a sequence of RSSTGAVTTSNYAN (SEQ ID NO: 172), a LCDR2 comprising a sequence of GTSNRAP (SEQ ID NO: 193) , and a LCDR3 comprising a sequence of ALWYSTHYV (SEQ ID NO: 214). In some embodiments, the antibody comprises a VH region comprising a sequence of SEQ ID NO: 353, and a VL region comprising a sequence of SEQ ID NO: 354.

[0233] In some embodiments, the antibody or the binding fragment thereof that binds to Galectin-3, wherein the antibody comprises a HCDR1 comprising a sequence of RFWMS (SEQ ID NO: 8), a HCDR2 comprising a sequence of EISPDSN-TIDLTPSLKD (SEQ ID NO: 29), a HCDR3 comprising a sequence of PYYGYY (SEQ ID NO: 50), a LCDR1 comprising a sequence of RSSQSLFNSTNQKNYLT (SEQ ID NO: 176) or RSSQSLFSSTNQKNYLT (SEQ ID NO: 369) , a LCDR2 comprising a sequence of WASSRES (SEQ ID NO: 197), and a LCDR3 comprising a sequence of QNDYTSPFT (SEQ ID NO: 218). In some embodiments, the antibody comprises a VH region comprising a sequence of SEQ ID NO: 355, and a VL region comprising a sequence of SEQ ID NO: 356.

[0234] In some embodiments, an anti-GAL-3 antibody disclosed herein comprises i) a VH amino acid sequence and a VL amino acid sequence listed in Table 7, or ii) a VH amino acid sequence with at least 70%, at least 80%, at least 85%, at least 90%, at least 95% identity to the VH amino acid sequence in Table 7 and a VL amino acid sequence with at least 70% identity to the VL amino acid sequence in Table 7, wherein variations as compared to the VH amino acid sequence or the VL amino acid sequence in Table 7 are in the framework regions only.

[0235] In some embodiments, an anti-GAL-3 antibody disclosed herein comprises all three heavy chain CDRs of an antibody in Table 3, and the antibody comprises heavy chain framework regions having at least 70%, at least 80%, at least 85%, at least 90%, at least 95% sequence identity to the combined heavy chain framework regions in the same antibody in Table 3. In some embodiments, at least one of the antibodies comprises all three light chain CDRs of an antibody in Table 4, and the antibody comprises light chain framework regions having at least 70%, at least 80%, at least 85%, at least 90%, at least 95% sequence identity to the combined light chain framework regions of the same antibody in Table 4.

[0236] The present disclosure also provides an antibody competes for binding to GAL-3 with any one of the antibodies described herein. In some embodiments, the antibody is capable of competing for binding to GAL-3 with an antibody from a community cluster listed in Table 10. In some embodiments, the antibody competes for binding to GAL-3 with antibody 1104SBC1068-033. In some embodiments, the antibody competes for binding to GAL-3 with any one of the antibodies in community cluster 2, including 1220SBC1068-186, 1220SBC1068-205, 1220SBC1068-022, 1220SBC1068-058, 1220SBC1068-056, 20241223SBC1205-119, and 1104SBC1068-160. In some embodiments, the antibody competes for binding to GAL-3 with any one of the antibodies in community cluster 3, including 20240628SBC1080-009, 20240628SBC1080-002, 1104SBC1068-374, 20240929SBC1205-022, 1104SBC1068-335, 20040628SBC1080-006, 20240628SBC1080-008, 1104SBC1068-378, 1104SBC1068-365, ANbl361-G119-5M-LP2R2-58-higg4P, and 20240628SBC1080-007. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 4, including the antibody 1220SBC1068-035. In some embodiments, the antibody competes for binding to GAL-3 with any one of the antibodies in community cluster 5, including 1220SBC1068-098, 1220SBC1068-210, 1220SBC1068-041, 1220SBC1068-063, 1220SBC1068-274, 1220SBC1068-129, 1220SBC1068-099, 1220SBC1068-164, and 1220SBC1068-197. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 6, including the antibody 1220SBC1068-097. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 7, including the antibody 20240628SBC1080-003. In some embodiments, the antibody competes for binding to GAL-3 with the antibody 20240628SBC1080-004. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 8, including the antibody 1104SBC1068-033. In some embodiments, the antibody competes for binding to GAL-3 with any one of the antibodies, in community cluster 9, including 20240903SBC1093-015, 20240903SBC1093-020, 20240903SBC1093-023, 20240903SBC1093-030, 20240628SBC1080-005, 20240903SBC1093-183, 20240903SBC1093-220, 20240903SBC1093-230, 20240903SBC1093-185, 20240903SBC1093-021, 20240903SBC1093-037, 20240903SBC1093-036, 20240903SBC1093-099, 20240903SBC1093-025, 20240903SBC1093-182, and 20240903SBC1093-184. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 10, including the antibody 20240903SBC1093-033. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 11, including the antibody 20240903SBC1093-034. In some embodiments, the antibody competes for binding to GAL-3 with any one of the antibodies, in community cluster 12, including 20240903SBC1093-228, 20240903SBC1093-074, 20240903SBC1093-193, 20240903SBC1093-044, 20240903SBC1093-059, 20240903SBC1093-056, 20240903SBC1093-057, 20240903SBC1093-219, 20240903SBC1093-194, and 20240903SBC1093-035. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 13, including antibody 20240903SBC1093-055. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 14, including the antibody 20240903SBC1093-075. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 15, including the antibody 20241223SBC1205-061. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 16, including the antibody 20241223SBC1205-063. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 17, including the antibody 20241223SBC1205-130. In some embodiments, the antibody competes for binding to GAL-3 with an antibody in community cluster 18, including the antibody 20241223SBC1205-131.

[0237] Based on the differential binding profiles, it is predicted that combinations of the antibodies from the different community clusters described above (for example, any combination of 2 antibodies between Community cluster 1 & Bin 2 would have an improved beneficial therapeutic profile as compared to the therapeutic profile of the individual antibodies. Thus, in some embodiments, the method provides a combination of two or more antibodies from two or more different community clusters for use to treat patients in need. The two or more antibodies may be administered sequentially or simultaneously, for example, as an antibody cocktail. Generation of antibodies

[0238] The anti-GAL-3 antibodies can be produced using vectors and recombinant methodology well known in the art (see, e.g., Sambrook & Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; Ausubel, Current Protocols in Molecular Biology). Reagents, cloning vectors, and kits for genetic manipulation are available from commercial vendors.

[0239] Accordingly, in a further aspect of the disclosure, provided herein are isolated nucleic acids encoding a VH and / or VL region, or fragment thereof, of any of the GAL-3 antibodies as described herein; vectors comprising such nucleic acids and host cells into which the nucleic acids are introduced that are used to replicate the antibody-encoding nucleic acids and / or to express the antibodies. Such nucleic acids may encode an amino acid sequence containing the VL and / or an amino acid sequence containing the VH of the GAL-3 antibody (e.g., the light and / or heavy chains of the antibody).

[0240] The present disclosure further provides a polypeptide comprising a VH sequence and / or a VL amino acid sequence of the anti-GAL-3 antibody described herein. In some embodiments, the polypeptide comprises a heavy chain variable (VH) region comprising a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to any one of SEQ ID NOS: 148-168, 353, and 355. In some embodiments, the polypeptide comprises a VL region comprising a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 316-336, 354, and 356. In some embodiments, the polypeptide comprises a VH amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%identical to any one of SEQ ID NOS: 148-168, 353, and 355, and a VL amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identical to any one of SEQ ID NOS: 316-336, 354, and 356.

[0241] In some embodiments, the polypeptide comprising a VH sequence selected from the group consisting of SEQ ID NOS: 148-168, 353, and 355. In some embodiments, the polypeptide comprising a VL sequence selected from the group consisting of SEQ ID NOS: 316-336, 354, and 356. In some embodiments, the polypeptide comprising a VH sequence selected from the group consisting of SEQ ID NOS: 148-168, 353, and 355, and a VL sequence selected from the group consisting of SEQ ID NOS: 316-336, 354, and 356.

[0242] In some embodiments, the polypeptide comprising the VH sequence and / or the VL amino acid sequence of the anti-GAL-3 antibody selected from the group consisting of 1104SBC1068-033, 1104SBC1068-335, 1104SBC1068-365, 1104SBC1068-374, 1104SBC1068-378, 1220SBC1068-022, 1220SBC1068-035, 1220SBC1068-041, 1220SBC1068-056, 1220SBC1068-058, 1220SBC1068-063, 1220SBC1068-097, 1220SBC1068-098, 1220SBC1068-099, 1220SBC1068-129, 1220SBC1068-164, 1220SBC1068-186, 1220SBC1068-197, 1220SBC1068-210, 1220SBC1068-274, 1220SBC1068-281, SIF-001, and SIF-002.

[0243] The present disclosure further provides a polynucleotide encoding the polypeptide described herein. In some embodiments, the polynucleotide comprising one or more expression cassettes encoding the polypeptide. In some embodiments, the polynucleotide comprising one expression cassettes encoding both VH and VL amino acid sequences of the antibody. Optionally the VH and VL amino acid sequences are linked through a linker. In some embodiments, the polynucleotide comprising one expression cassettes encoding a VH amino acid sequence of the antibody and the other expression cassettes encoding a VL amino acid sequence of the antibody. In some embodiments, the expression cassette comprising a promoter operably linked to a nucleic acid encoding the VH and / or VL amino acid sequences of the antibody.

[0244] The present disclosure further provides an expression vector comprising the polynucleotide (s) described herein and a host cell which the polynucleotide (s) are introduced into for antibody expression. In some embodiments, the host cell contains (1) a vector containing a polynucleotide that encodes the VL amino acid sequence and a polynucleotide that encodes the VH amino acid sequence, or (2) a first vector containing a polynucleotide that encodes the VL amino acid sequence and a second vector containing a polynucleotide that encodes the VH amino acid sequence.

[0245] The present disclosure further provides a method of making an anti-GAL-3 antibody as described herein. In some embodiments, the method includes culturing a host cell as described in the preceding paragraph under conditions suitable for expression of the antibody. In some embodiments, the antibody is subsequently recovered from the host cell (or host cell culture medium).

[0246] Suitable vectors containing polynucleotides encoding antibodies of the present disclosure, or fragments thereof, include cloning vectors and expression vectors. While the cloning vector selected may vary according to the host cell intended to be used, useful cloning vectors generally can self-replicate, may possess a single target for a particular restriction endonuclease, and / or may carry genes for a marker that can be used in selecting clones containing the vector. Examples include plasmids and bacterial viruses, e.g., pUC18, pUC19, Bluescript (e.g., pBS SK+) and its derivatives, mpl8, mpl9, pBR322, pMB9, ColEl plasmids, pCRl, RP4, phage DNAs, and shuttle vectors. These and many other cloning vectors are available from commercial vendors.

[0247] Expression vectors generally are replicable polynucleotide constructs that contain a nucleic acid of the present disclosure. The expression vector can be replicable in the host cells either as episomes or as an integral part of the chromosomal DNA. Suitable expression vectors include but are not limited to plasmids and viral vectors, including adenoviruses, adeno-associated viruses, retroviruses, and any other vector.

[0248] Suitable host cells for expressing an anti-GAL-3 antibody as described herein include both prokaryotic and eukaryotic cells. For example, an anti-GAL-3 antibody may be produced in bacteria when glycosylation and Fc effector function are not needed. After expression, the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified. Alternatively, the host cell may be a eukaryotic host cell, including eukaryotic microorganisms, such as filamentous fungi or yeast, including fungi and yeast strains whose glycosylation pathways have been “humanized, ” resulting in the production of an antibody with a partially or fully human glycosylation pattern, vertebrate, invertebrate, and plant cells. Examples of invertebrate cells include insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells. Plant cell cultures can also be utilized as host cells.

[0249] In some embodiments, vertebrate host cells are used for producing an anti-GAL-3 antibody of the present disclosure. For example, mammalian cell lines such as a monkey kidney CV1 line transformed by SV40 (COS-7) ; human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36: 59, 1977; baby hamster kidney cells (BHK) ; mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod. 23: 243-251, 1980 monkey kidney cells (CV1) ; African green monkey kidney cells (VERO-76) ; human cervical carcinoma cells (HELA) ; canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A) ; human lung cells (W138) ; human liver cells (Hep G2) ; mouse mammary tumor (MMT 060562) ; TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383: 44-68, 1982; MRC 5 cells; and FS4 cells may be used to express an anti-GAL-3 antibody antibodies. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216, 1980) ; and myeloma cell lines such as Y0, NS0 and Sp2 / 0. Host cells of the present disclosure also include, without limitation, isolated cells, in vitro cultured cells, and ex vivo cultured cells. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ), pp. 255-268, 2003.

[0250] In some embodiments, an anti-GAL-3 antibody of the present invention is produced by a CHO cell line, e.g., the CHO-K1 cell line. One or more expression plasmids can be introduced that encode heavy and light chain sequences. For example, in one embodiment, an expression plasmid encoding a heavy chain disclosed herein, and an expression plasmid encoding a light chain disclosed herein are transfected into host cells. The expression plasmids can be introduced as linearized plasmids at a ratio of 1: 1 in the CHO-K1 host cell line using reagents such as Freestyle Max reagent. Fluorescence-activated cell sorting (FACS) coupled with single cell imaging can be used as a cloning method to obtain a production cell line.

[0251] A host cell transfected with an expression vector encoding an anti-GAL-3 antibody of the present disclosure, or fragment thereof, can be cultured under appropriate conditions to allow expression of the polypeptide to occur. The polypeptides may be secreted and isolated from a mixture of cells and medium containing the polypeptides. Alternatively, the polypeptide may be retained in the cytoplasm or in a membrane fraction and the cells harvested, lysed, and the polypeptide isolated using a desired method.

[0252] In some embodiments, an anti-GAL-3 antibody of the present disclosure can be produced by in vitro synthesis (see, e.g., Sutro Biopharma biochemical protein synthesis platform).

[0253] The present disclosure further provides a kit that comprises the antibody, the polypeptide, the polynucleotide, the expression vector, and / or the cell described herein. Compositions

[0254] In one aspect, the present disclosure provides a composition comprising the antibody described herein. For examples, the composition comprises an anti-GAL-3 antibody comprising a heavy chain variable (VH) region comprising a HCDR1 amino acid sequence at least 70%identical to any one of SEQ ID NOS: 1-21 and 481-507, a HCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 22-42 and 390-417, and / or a HCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 43-63 and 418-439, and / or a light chain variable (VL) region comprising: a LCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 169-189 and 440-462, a LCDR2 amino acid sequence at least 70%identical to any one of SEQ ID NOS: 190-210 and 463-480, and / or a LCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 211-231 and 481-507. The compositions can additionally contain other therapeutic agents that are suitable for treating or preventing a given disorder.

[0255] In another aspect, the present disclosure provides a composition comprising the immunoconjugate described herein, wherein the immunoconjugate comprises an anti-anti-GAL-3 antibody conjugated or linked to therapeutic, imaging / detectable moieties, or enzymes.

[0256] In another aspect, the present disclosure provides a pharmaceutical composition. In some embodiments, the pharmaceutical composition comprises any of the compositions described herein and a pharmaceutically acceptable carrier. For example, the pharmaceutical composition may comprise an anti-GAL-3 antibody comprising a heavy chain variable (VH) region comprising a HCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 1-21 and 481-507, a HCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 22-42 and 390-417, and / or a HCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 43-63 and 418-439, and / or a light chain variable (VL) region comprising: a LCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 169-189 and 440-462, a LCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 190-210 and 463-480, and / or a LCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 211-231 and 481-507. The pharmaceutically acceptable carrier can enhance or stabilize the composition, or to facilitate preparation of the composition. Pharmaceutically acceptable carriers include solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.

[0257] A pharmaceutical composition as described herein can be administered by a variety of methods known in the art. The route and / or mode of administration vary depending upon the desired results. In some embodiments, the composition is sterile and fluid. Proper fluidity can be maintained, for example, by use of coating such as lecithin, by maintenance of required particle size in the case of dispersion and by use of surfactants. In many cases, it is preferable to include isotonic agents, for example, sugars, polyalcohol such as mannitol or sorbitol, and sodium chloride in the composition. Long-term absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate or gelatin.

[0258] Pharmaceutical compositions described herein can be prepared in accordance with methods well known and routinely practiced in the art. Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions. Applicable methods for formulating the compositions and determining appropriate dosing and scheduling can be found, for example, in Remington: The Science and Practice of Pharmacy, 21st Ed., University of the Sciences in Philadelphia, Eds., Lippincott Williams & Wilkins (2005) ; and in Martindale: The Complete Drug Reference, Sweetman, 2005, London: Pharmaceutical Press., and in Martindale, Martindale: The Extra Pharmacopoeia, 31st Edition., 1996, Amer Pharmaceutical Assn, and Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York, 1978, each of which are hereby incorporated herein by reference. Pharmaceutical compositions are preferably manufactured under GMP conditions. Typically, a therapeutically effective dose or efficacious dose is employed in the pharmaceutical compositions described herein. The compositions can be formulated into pharmaceutically acceptable dosage forms. Dosage regimens are adjusted to provide the desired response (e.g., a therapeutic response). In determining a therapeutically or prophylactically effective dose, a low dose can be administered and then incrementally increased until a desired response is achieved with minimal or no undesired side effects. For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.

[0259] Actual dosage levels of the active ingredients in the pharmaceutical compositions can be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level depends upon a variety of pharmacokinetic factors including the activity of the particular compositions employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and / or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors. Method of Treatment

[0260] In one aspect, the present disclosure provides a method for preventing or treating epilepsy and / or a neurological disorder in a subject in need thereof, the method comprising administering to the subject an antibody comprising a means for binding to Galectin-3. In some embodiments, the Galectin-3 is human Galectin-3. In some embodiments, the method comprising administering to the subject an anti-GAL-3 antibody, wherein the antibody binds to GAL-3 in the subject thereby preventing or treating epilepsy and / or a neurological disorder. In some embodiments, the neurological disorder is Alzheimer’s disease (AD) or Parkinson’s disease (PD). In some embodiments, the antibody is administered in combination with an additional therapeutic agent.

[0261] In certain embodiments, an antibody described herein is administered to the subject in combination with one or more additional therapeutic agents used to treat epilepsy and / or a neurological disorder, or the side effects or associated symptoms thereof. In certain embodiments, the method comprises administering to a subject a therapeutically effective amount of an antibody as disclosed herein, or a pharmaceutical composition comprising the antibody, in combination with a therapeutically effective amount of one or more additional therapeutic agents. In one embodiment, a method for treating epilepsy and / or a neurological disorder in a subject, the method comprising administering to the subject a therapeutically effective amount of an antibody as disclosed herein, or a pharmaceutical composition comprising the antibody, in combination with a therapeutically effective amount of one or more additional therapeutic agents.

[0262] In some embodiments, the antibody or pharmaceutical composition is administered to the subject in combination with one or more additional therapeutic agents that are effective at preventing or treating epilepsy and / or a neurological disorder. In some embodiments, the one or more additional therapeutic agents comprise another anti-Gal-3 antibody that does not compete with the antibody or pharmaceutical composition for binding to Gal-3. In some embodiments, the co-administration includes two or more anti-Gal-3 antibodies disclosed herein, with each antibody selected from a different community cluster listed in Table 10. For example, the antibodies may be selected from any two or more community clusters, including community 1 (Com 1), Com 2, Com 3, Com 4, Com 5, Com 6, Com 7, Com 8, Com 9, Com 10, Com 11, Com 12, Com 13, Com 14, Com 15, Com 16, Com 17, and Com 18 in Table 10. Since each antibody is selected from a different community cluster and binds to a distinct Gal-3 epitope, they do not compete with one another. Diseases

[0263] The anti- GAL-3 antibodies disclosed herein can be used to prevent or treat epilepsy or neurological disorders. In some embodiments, the neurological disorder is Alzheimer’s disease (AD) or Parkinson’s disease (PD). Epilepsy and Drug-Resistant Epilepsy

[0264] In some embodiments, the anti-GAL-3 antibodies disclosed herein can be used to prevent or treat Epilepsy. Epilepsy is a neurological disorder characterized by recurrent unprovoked seizures. It affects approximately 1% of the global population and presents a significant burden of disease worldwide. For about 30-40% of patients, seizures cannot be effectively managed with current drug therapies, leading to a condition known as drug-resistant epilepsy (DRE). Surgical interventions offer relief to some patients, but a substantial number continue to experience seizures even after surgery.

[0265] Epileptogenesis is associated with an increased and persistent inflammatory state in the microenvironment of neural tissues, which can lead to the production of cytokines by glial cells and neurons. The anti-Gal-3 antibodies disclosed herein, by inhibiting Gal-3 activity or expression, can mitigate neuroinflammatory responses, potentially alleviating the pathological processes that contribute to epilepsy development and drug resistance. In some embodiments, the anti-Gal-3 antibodies can be used to treat drugresistant epilepsy. Parkinson’s disease

[0266] In some embodiments, the anti-GAL-3 antibodies disclosed herein can be used to prevent or treat Parkinson’s disease (PD). Parkinson’s disease (PD) is the second most prevalent neurodegenerative disease in the world. It is characterized by intense neurodegeneration in the basal ganglia area leading to severe and progressive motor impairment. The presence of Lewy bodies (LBs), described as neuronal intracy-toplasmic deposits of a-synuclein (aSYN), is the second hallmark of the disease. While dopaminergic neurons from the substantia nigra (SN) are frequently the most affected cells, neurodegeneration and LB formation commonly appear in other central and enteric nervous system locations even years before than in the SN.

[0267] Disease modifying therapies are being developed that work either through targeting aSYN, inflammation, metabolism, vasculature and / or neuroplasticity. Galectin-3 (GAL3) is associated with LB formation and toxicity. As such, an anti-GAL-3 antibody disclosed herein can be used for therapeutical treatment to prevent or slow down PD progression. Alzheimer’s disease

[0268] In some embodiments, the anti-GAL-3 antibodies disclosed herein can be used to prevent or treat Alzheimer’s disease (AD). Alzheimer’s disease (AD) is a chronic progressive neurodegenerative disorder that is the leading cause of dementia among older adults. There are two major pathological hallmark proteins associated with toxic changes in the brain that may lead to AD: A[3 and tau. The disease is characterized by accumulation of extracellular amyloid plaques, intracellular neurofibrillary tangles, and extensive synaptic loss leading to progressive cognitive impairment and eventually dementia. Abnormal tau (hyperphosphorylated tau) accumulates to form neurofibrillary tangles, while A[3 plaques accumulate both extracellular and intracellular. Amyloid plaques and hyperphosphorylated tau in the brain are therefore the major hallmarks of AD.

[0269] Gal-3 is highly upregulated in the brains of AD patients. As such, an anti-GAL-3 antibody disclosed herein can be used for therapeutical treatment to prevent or slow down AD progression. In some embodiments, the anti-GAL-3 antibody disclosed herein enhances A[3oligomerization. In some embodiments, the anti-GAL-3 antibody disclosed herein reduces and / or degrades the formation of neurotoxic conformational oligomers, such as A[342 oligomers. In some embodiments, the anti-GAL-3 antibody disclosed herein reduces neuroinflammation and / or AD-related pathology in a subject. In some embodiments, the anti-GAL-3 antibody disclosed herein enhances cognitive memory function in a subject.

[0270] In particular embodiments, the method for preventing or treating epilepsy and / or a neurological disorder in a subject, comprises administering to the subject an effective amount of the pharmaceutical composition comprising an antibody which comprises a heavy chain variable (VH) region comprising a HCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 1-21 and 481-507, a HCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 22-42 and 390-417, and / or a HCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 43-63 and 418-439, and / or a light chain variable (VL) region comprising: a LCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 169-189 and 440-462, a LCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 190-210 and 463-480, and / or a LCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 211-231 and 481-507. In some embodiments, the pharmaceutical composition further comprises one or more therapeutic agent (s), wherein the therapeutic agent (s) can be either conjugated to the antibody or in a separate form apart from the antibody.

[0271] In another aspect, the disclosure additionally provides methods of identifying subjects who are candidates for treatment with an anti-GAL-3 antibody. Thus, in one embodiment, the disclosure provides a method of identifying a subject who can benefit from treatment with the anti-GAL-3 antibody disclosed herein. In one embodiment, the subject has epilepsy and / or a neurological disorder that overexpresses Galectin-3. Binding of the antibody to Galectin-3 can be measured using any assay, such as immunohistochemistry or flow cytometry. In some embodiments, binding of the antibody to at least 0.2%, 0.5%, or 1%, or at least 5% or 10%, or at least 20%, 30%, or 50%, of Galectin-3 in a sample may be used as a selection criterion for determining a patient to be treated with the anti-GAL-3 antibody as described herein.

[0272] In one aspect, methods of the disclosure comprise administering an anti-GAL-3 antibody disclosed herein, or a variant thereof, as a pharmaceutical composition to a patient in a therapeutically effective amount using a dosing regimen suitable for treatment of the epilepsy, the neurological disorder or the cancer. The composition can be formulated for use in a variety of drug delivery systems. One or more physiologically acceptable excipients or carriers can also be included in the compositions for proper formulation. Suitable formulations for use in the present invention are found, e.g., in Remington: The Science and Practice of Pharmacy, 21st Edition, Philadelphia, PA. Lippincott Williams & Wilkins, 2005.

[0273] The anti-GAL-3 antibody is provided in a solution suitable for administration to the patient, such as a sterile isotonic aqueous solution for injection. The antibody is dissolved or suspended at a suitable concentration in an acceptable carrier. In some embodiments the carrier is aqueous, e.g., water, saline, phosphate buffered saline, and the like. The compositions may contain auxiliary pharmaceutical substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, and the like. Administration

[0274] The pharmaceutical compositions are administered to a patient in an amount sufficient to cure or at least partially arrest the disease or symptoms of the disease and its complications. An amount adequate to accomplish this is defined as a “therapeutically effective dose. ” A therapeutically effective dose is determined by monitoring a patient’s response to therapy. Typical benchmarks indicative of a therapeutically effective dose includes the amelioration of symptoms of the disease in the patient. Amounts effective for this use will depend upon the severity of the disease and the general state of the patient’s health, including other factors such as age, weight, gender, administration route, and the like Single or multiple administrations of the antibody may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the methods provide a sufficient quantity of anti-GAL-3 antibody to effectively treat the patient.

[0275] An anti-GAL-3 antibody or the antibody immunoconjugate (e.g., an anti-GAL-3 antibody- drug conjugate) can be administered by any suitable means, including, for example, parenteral, intrapulmonary, and intranasal, administration, as well as local administration, such as intratumor administration. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. In some embodiments, the antibody may be administered by insufflation. In an illustrative embodiment, the antibody or the antibody immunoconjugate (e.g., an anti-GAL-3 antibody- drug conjugate) may be stored at 10 mg / ml in sterile isotonic aqueous saline solution for injection at 4°C and is diluted in either 100 ml or 200 ml 0.9% sodium chloride for injection prior to administration to the patient. In some embodiments, the antibody or the antibody immunoconjugate (e.g., an anti-GAL-3 antibody-drug conjugate) is administered by intravenous infusion over the course of 1 or 2 hours at a dose of between 0.01 and 100 mg / kg per the subject’s body weight. In some embodiments, the antibody or the antibody immunoconjugate (e.g., an anti-GAL-3 antibody- drug conjugate) is administered at a dose range between 0.01-1 mg / kg, between 1-10 mg / kg, between 10-50 mg / kg, or between 50-100 mg / kg per the subject’s body weight. In some embodiments, the antibody or the antibody immunoconjugate (e.g., an anti-GAL-3 antibody- drug conjugate) is administered at a dose of about 10, 20, 30, 40, 50, 60, 70 mg / kg or a dose in a range defined by any two of the aforementioned values per the subject’s body weight. In some embodiments, the antibody or the antibody immunoconjugate (e.g., an anti-GAL-3 antibody- drug conjugate) is administered at a dose of about 10, 20, 40, and 70 mg / kg or a dose in a range defined by any two of the aforementioned valuesper the subject’s body weight. In other embodiments, the antibody or the antibody immunoconjugate (e.g., an anti-GAL-3 antibody- drug conjugate) is administered by intravenous infusion over a period of between 15 minutes and 2 hours. In still other embodiments, the administration procedure is via sub-cutaneous bolus injection.

[0276] The dose of antibody is chosen to provide effective therapy for the patient and is in the range of less than 0.01 mg / kg body weight to about 100 mg / kg body weight or in the range 1 mg —8g per patient. Preferably the dose is in the range 0.1 — 50 mg / kg or approximately 50 mg —5000 mg / patient. The dose may be repeated at an appropriate frequency which may be in the range once per day to once every three months, or every six months, depending on the pharmacokinetics of the antibody (e.g., half-life of the antibody in the circulation) and the pharmacodynamic response (e.g., the duration of the therapeutic effect of the antibody). In some embodiments, the in vivo half-life of between about 7 and about 25 days and antibody dosing is repeated between once per week and once every 3 months or once every 6 months. In other embodiments, the antibody is administered approximately once per month.

[0277] In some embodiments, the antibody is administered more than once, such as two, three, four, or more times. In some embodiments, each administration is at least 7 days apart. In some embodiments, each administration is at least 14 days apart. In some embodiments, each administration is at least four weeks apart.

[0278] In an illustrative embodiment, the antibody may be stored at 10 mg / ml or 20 mg / ml in a sterile isotonic aqueous solution. The solution can comprise agents such as buffering agents and stabilizing agents. For example, in some embodiments, a buffering agent such as histidine is included to maintain a formulation pH of about 5.5. Additional reagents such as sucrose or alternatives can be added to prevent aggregation and fragmentation in solution and during freezing and thawing. Agents such as polysorbate 80 or an alternative can be included to lower surface tension and stabilizes the antibody against agitation-induced denaturation and air-liquid and ice-liquid surface denaturation. In some embodiments, the solution for injection is stored at 2-8°C and is diluted in either 100 ml or 200 ml 0.9% sodium chloride for injection prior to administration to the patient. In some embodiments, the antibody is administered as a one to two-hour IV infusion from a diluted saline bag with a total volume of 100, 250, or 500 mL, depending on dose level. IV. Examples

[0279] The present disclosure will be described in greater detail by way of specific examples. The following examples are offered for illustrative purposes only and are not intended to limit the invention in any manner. Those of skill in the art will readily recognize a variety of noncritical parameters which can be changed or modified to yield essentially the same results. Example 1. Cross Species Reactivity of SIF001 Binding with Galectin-3 (GAL-3)

[0280] This example illustrates that the in vitro cross-species reactivity of SIF001 against GAL-3 from different species.

[0281] SIF001 is a humanized monoclonal antibody raised against the human GAL-3 protein. It has the HCDR sequences of SEQ ID Nos: 4, 25, and 46, and the LCDR sequences of SEQ ID Nos: 172, 193, and 214. The cross-species reactivity of SIF001 against GAL-3 from different species: human, mouse, rat, and cynomolgus monkey (cyno) samples was evaluated in vitro, and the affinity of GAL-3 binding to SIF001 was measured by Surface Plasmon Resonance (SPR). The binding affinity of SIF001 to human, mouse, and rat GAL-3, measured by dissociation constant (KD), is presented in Table 8 below. Table 8. Binding Affinity of SIF001 to GAL-3 Human GAL-3 Mouse GAL-3 Rat GAL-3 BCD 7.15 x 1O'S M 1.09 x 10'8M 1.17 x HP’ M

[0282] The curve fitting analysis demonstrated strong binding affinity in human, mouse, and rat samples, as evidenced by well-fitted curves (FIGS. 1A-1C). However, the curve fitting did not perform as well in monkey samples (FIG. ID), suggesting a lack of binding affinity or potential species-specific differences in GAL-3 recognition by SIF001. These results indicate that while the SIF001 effectively binds to GAL-3 in human, mouse, and rat samples, its binding affinity may not extend to monkey GAL-3 or may be reduced in monkeys compared to other species. Example 2. SIF001 Reduced Inflammatory Cytokine TNFa Release in LPS-Stimulated microglia BV2 Cells

[0283] This example illustrates the in vitro effect of SIF001 on inflammatory cytokine TN-Farelease in microglia BV2 cells when stimulated by lipopolysaccharide (LPS).

[0284] The inhibitory effects of SIF001 on the release of the inflammatory cytokine TNFawere evaluated in vitro in microglia BV2 cells stimulated by lipopolysaccharide (LPS) to mimic neuroinflammatory processes that are implicated in epileptogenesis and seizure activity. An ELISA assay was performed with the protocol shown below. 1. On the first day, seed BV2 cells into a 96-well plate, with 5,000 cells per well. Incubate at 37°C with 5% CO2 overnight to allow the cells to adhere to the well. 2. On the second day, use a new 96-well plate with LPS concentration at 30 ug / ml. The 8th row of the 96-well plate serves as the control and contains only complete culture medium without LPS. All other wells contain 30 ug / ml LPS with a volume of 200 ul each. 3. Take two antibodies labeled as Isotype control, mSIFOOl. Set up 3 replicates for each antibody. The concentration for the first row of antibodies is 100 nM with a volume of 300 ul. Thoroughly mix the replicates containing the antibody, take 100 ul from it and add to the second row, mix well, and then take 100 ul from the second row to the third, continuing this process down to the seventh row, thus performing a 3-fold dilution. 4. After mixing, remove the complete culture medium from the original 96-well plate containing BV2 cells, wash 2-3 times with complete culture medium, 100 ul each time, and transfer all the liquid from step “3” into the BV2 cell plate. Incubate for 14-15 hours in the incubator. 5. After incubation, take 20 ul of culture medium from each well and dilute it 5 times with the sample diluent from a mouse TNF-a ELISA Kit (High-sensitive) ( Beyotime, China) . Store the remainder at 4°C. 6. Bring the reagents from the kit to room temperature to equilibrate for 20-30 minutes before use. Prepare the wash buffer by diluting the 20X wash buffer with sterile water to IX. 7. Add 100 pl of the sample to the respective wells, seal the reaction wells with sealing film, and incubate at room temperature for 120 minutes. After incubation, manually wash the plate, adding 200 ul of wash buffer to each well, for a total of 5 washes. Tap dry on thick absorbent paper after the last wash. 8. Add 100 ul of biotinylated antibody to each well, seal the reaction...

Claims

Claims

1. An antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a heavy chain variable (VH) region comprising: a HCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 1-21 and 370-389, a HCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 22-42 and 390-417, and / or a HCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 43-63 and 418-439, and / or a light chain variable (VL) region comprising: a LCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 169-189 and 440-462, a LCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 190-210 and 463-480, and / or a LCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 211-231 and 481-507.

2. The antibody or a binding fragment thereof of claim 1, wherein the Galectin-3 is human Galectin-3.

3. The antibody or the binding fragment thereof of claim 1, wherein the antibody comprises: a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 1, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 22, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 43; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 169, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 190, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 211, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 2, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 23, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 44; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 170, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 191, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 212, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 3, a HCDR2 aminoacid sequence at least 70% identical to SEQ ID NO: 24, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 45; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 171, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 192, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 213, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 25, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 46; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 172, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 193, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 214, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 5, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 26, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 47; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 173, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 194, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 215, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 6, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 27, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 48; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 174, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 195, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 216, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 7, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 28, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 49; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 175, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 196, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 217, ora heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 8, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 29, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 50; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 176, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 197, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 218, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 9, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 30, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 51; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 177, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 198, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 219, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 10, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 31, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 52; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 178, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 199, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 220, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 11, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 32, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 53; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 179, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 200, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 221, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 12, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 33, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 54; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 180, a LCDR2 amino acidsequence at least 70% identical to SEQ ID NO: 201, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 222, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 13, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 34, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 55; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 181, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 202, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 223, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 14, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 35, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 56; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 182, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 203, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 224, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 15, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 36, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 57; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 183, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 204, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 225, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 16, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 37, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 58; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 184, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 205, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 226, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 17, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 38, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 59; and alight chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 185, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 206, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 227, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 18, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 39, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 60; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 186, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 207, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 228, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 19, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 40, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 61; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 187, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 208, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 229, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 20, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 41, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 62; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 188, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 209, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 230, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 21, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 42, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 63; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 189, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 210, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 231.

4. The antibody or the binding fragment thereof of claim 1, wherein theantibody comprises:a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 370, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 390, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 418; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 440, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 463, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 481, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 371, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 391, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 418; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 441, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 464, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 482, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 372, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 392, and a HCDR3 amino acid sequence at least 70% identical to DNL; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 442, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 465, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 483, ora heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 373, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 393, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 419; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 443, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 466, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 484, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 374, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 394, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 420; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 444, a LCDR2 amino acidsequence at least 70% identical to SEQ ID NO: 467, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 485, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 375, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 395, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 421; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 445, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 468, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 486, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 376, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 396, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 422; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 446, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 469, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 487, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 373, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 393, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 419; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 447, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 484, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and alight chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 449, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 450, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 398, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 424; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 489, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 aminoacid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 490, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 398, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 423; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 491, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 399, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 424; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 472, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 489, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 377, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 397, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 424; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 448, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 488, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 400, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 451, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 473, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 492, ora heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 401, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 473, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 493, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 402, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 425; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 473, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 493, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 379, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 403, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 380, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 403, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 380, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 403, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acidsequence at least 70% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 381, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 404, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 381, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 404, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 495, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 381, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 405, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 426; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 453, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 494, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 406, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 427; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 496, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 378, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 407, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 425; and alight chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 452, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 475, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 496, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 428; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 454, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 471, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 497, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 429; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 455, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 476, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 498, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 429; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 454, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 468, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 497, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 382, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 408, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 430; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 454, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 477, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 497, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 383, a HCDR2 aminoacid sequence at least 70% identical to SEQ ID NO: 409, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 431; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 456, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 499, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 383, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 409, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 431; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 456, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 478, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 499, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 384, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 410, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 431; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 457, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 500, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 384, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 410, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 432; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 458, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 474, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 500, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 385, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 411, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 433; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 459, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 470, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 501.

5. The antibody or the binding fragment thereof of claim 1, wherein theantibody comprises:a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 386, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 412, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 434; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 460, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 479, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 502, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 387, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 413, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 435; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 461, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 201, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 503, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 414, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 436; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 462, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 480, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 504, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 388, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 415, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 437; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 461, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 201, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 505, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 416, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 438; and alight chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 462, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 480, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 506, or a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 4, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 414, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 436; and a light chain variable region comprising a LCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 462, a LCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 480, and a LCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 507.

6. The antibody or the binding fragment thereof of claim 1, wherein theantibody comprises:a heavy chain variable region comprising a HCDR1 amino acid sequence at least 70% identical to SEQ ID NO: 389, a HCDR2 amino acid sequence at least 70% identical to SEQ ID NO: 417, and a HCDR3 amino acid sequence at least 70% identical to SEQ ID NO: 439.

7. The antibody or the binding fragment thereof of claim 1, whereinthe antibody comprises all six CDRs of an antibody selected from the group consisting of 1104SBC1068-033, 1104SBC1068-335, 1104SBC1068-365, 1104SBC1068-374, 1104SBC1068-378, 1220SBC1068-022, 1220SBC1068-035, 1220SBC1068-041, 1220SBC1068-056, 1220SBC1068-058, 1220SBC1068-063, 1220SBC1068-097, 1220SBC1068-098, 1220SBC1068-099, 1220SBC1068-129, 1220SBC1068-164, 1220SBC1068-186, 1220SBC1068-197, 1220SBC1068-210, 1220SBC1068-274, 1220SBC1068-281, 20240628SBC1080-002, 20240628SBC1080-003, 20240628SBC1080-004, 20240628SBC1080-005, 20240628SBC1080-006, 20240628SBC1080-007, 20240628SBC1080-008, 20240628SBC1080-009, 20240903SBC1093-015, 20240903SBC1093-020, 20240903SBC1093-021,20240903SBC1093-025, 20240903SBC1093-030, 20240903SBC1093-182, 20240903SBC1093-183, 20240903SBC1093-184, 20240903SBC1093-185, 20240903SBC1093-230, 20240903SBC1093-033, 20240903SBC1093-034, 20240903SBC1093-035, 20240903SBC1093-044,20240903SBC1093-054, 20240903SBC1093-055, 20240903SBC1093-056, 20240903SBC1093-057, 20240903SBC1093-059, 20240903SBC1093-219, 20240903SBC1093-228, 20240903SBC1093-023, 20240903SBC1093-036, 20240903SBC1093-037, 20240903SBC1093-220, 20240903SBC1093-074, 20240903SBC1093-075, 20240903SBC1093-193, 20240903SBC1093-194, 20240903SBC1093-099, 20240929SBC1205-022, 20241223SBC1205-061, 20241223SBC1205-063, 20241223SBC1205-119, 20241223SBC1205-130, 20241223SBC1205-131, and ANbl361-hGal-3-LP3R3 P2-69.

8. The antibody or the binding fragment thereof of any one of claims 1-7,wherein the antibody comprises:a VH region comprising a VH amino acid sequence at least 70% identity to any one of SEQ ID NOS: 148-168, 353, and 355; and / ora VL region comprising a VL amino acid sequence at least 70% identity to any one of SEQ ID NOS: 316-336, 354, and 356.

9. The antibody or the binding fragment thereof of any one of claims 1-7,wherein the antibody comprises:a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 148, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 316; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 149, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 317; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 150, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 318; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 151, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 319; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 152, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 320; ora VH region comprising a VH amino acid sequence at least 70% identityto SEQ ID NO: 153, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 321; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 154, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 322; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 155, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 323; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 156, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 324; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 157, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 325; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 158, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 326; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 159, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 327; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 160, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 328; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 161, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 329; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 162, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 330; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 163, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 331; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 164, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 332; or

10.

11.

12.

13.

14.

15. a VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 165, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 333; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 166, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 334; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 167, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 335; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 168, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 336; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 353, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 354; ora VH region comprising a VH amino acid sequence at least 70% identity to SEQ ID NO: 355, and a VL region comprising a VL amino acid sequence at least 70% identity to SEQ ID NO: 356.The antibody or the binding fragment thereof of any one of claims 1-7, wherein the antibody comprises both the VH and VL of an antibody selected from the group consisting of 1104SBC1068-033, 1104SBC1068-335, 1104SBC1068-365, 1104SBC1068-374, 1104SBC1068-378, 1220SBC1068-022, 1220SBC1068-035, 1220SBC1068-041, 1220SBC1068-056, 1220SBC1068-058, 1220SBC1068-063, 1220SBC1068-097, 1220SBC1068-098, 1220SBC1068-099, 1220SBC1068-129, 1220SBC1068-164, 1220SBC1068-186, 1220SBC1068-197, 1220SBC1068-210, 1220SBC1068-274, 1220SBC1068-281, SIF-001, SIF-002, and a variant thereof.The antibody of any one of claims 1-7, wherein the antibody is a humanized, chimeric, or human antibody.A polypeptide comprising a VH sequence and / or a VL sequence of the antibody of claim 1.A polynucleotide encoding the polypeptide of claim 12.An expression vector comprising the polynucleotide of claim 13.A cell that comprises the expression vector of claim 14.

16. A kit that comprises the antibody of claim 1, the polypeptide of claim 12, the polynucleotide of claim 13, the expression vector of claim 14, and / or the cell of claim 15.

17. An immunoconjugate comprising the antibody of claim 1-7 and a cytotoxic agent.

18. A composition comprising the antibody of any one of claims l-7or the Rule91, 21.03.2025 immunoconjugate of claim 17.

19. A pharmaceutical composition comprising the composition of claim 18 and a pharmaceutically acceptable carrier.

20. A method of treating epilepsy or a related neurological disorder in a subject in need thereof, comprising administering the subject an effective amount of the pharmaceutical composition of claim 19.

21. The method of claim 20, wherein the effective amount is about 5-100 mg / kg of the antibody or the immunoconjugate per the subject’s body weight, optionally wherein the effective amount is about 10, 20, 40, and 70 mg / kg of the antibody or the immunoconjugate per the subject’s body weight.

22. The method of claim 20, wherein the pharmaceutical composition is administered intravenously into the subject.

23. The method of any one of claims 20-22, wherein the pharmaceutical composition is administered more than once, optionally wherein each administration is at least 14 days apart.

24. A method for treating epilepsy or a neurological disorder in a subject in need thereof, comprising administering to the subject an antibody comprising a means for binding to Galectin-3.

25. The method of claim 24, wherein the neurological disorder is Alzheimer’s disease (AD) or Parkinson’s disease (PD).

26.

27. The method of claim 24, wherein the Galectin-3 is human Galectin-3. The method of any one of claims 24 to 26, wherein the antibody is administered in combination with an additional therapeutic agent.

28. The method of any one of claims 20 to 22, wherein the antibody is administered intravenously into the subject.

29. The method of any one of claims 20 to 22, wherein the administration dosage of the antibody is between about 5-100 mg / kg per the subject’s body weight.

30. The method of any one of claims 20 to 22, wherein the administration dosage of the antibody is about 10, 20, 40, and 70 mg / kg per the subject’s body weight.

31. An antibody or a binding fragment thereof for use in the treatment of epilepsy or a related neurological disorder in a subject, wherein the antibody comprises: a heavy chain variable (VH) region comprising: a HCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 1-21 and 370-389, a HCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 22-42 and 390-417, and / or a HCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 43-63 and 418-439, and / or a light chain variable (VL) region comprising: a LCDR1 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 169-189 and 440-462, a LCDR2 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 190-210 and 463-480, and / or a LCDR3 amino acid sequence at least 70% identical to any one of SEQ ID NOS: 211-231 and 481-507.

32. An antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a heavy chain variable region comprising: a HCDR1 comprising a sequence NYGMN (SEQ ID NO: 4) , or a variant HCDR1 in which 1, 2, or 3 amino acids are substituted relative to the sequence; a HCDR2 comprising a sequence WINTYTGEPTYADDFKG (SEQ ID NO: 25), or a variant HCDR2 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a HCDR3 comprising a sequence YAMDY (SEQ ID NO: 46) , or a variant HCDR3 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a light chain variable region comprising: a LCDR1 comprising a sequence RSSTGAVTTSNYAN (SEQ ID NO: 172) , or a variant LCDR1 in which 1 amino acid is substituted relative to the sequence; a LCDR2 comprising a sequence GTSNRAP (SEQ ID NO: 193), or variant LCDR2 in which 1 amino acid is substituted relative to the sequence; anda LCDR3 comprising a sequence ALWYSTHYV (SEQ ID NO: 214) , or a variant LCDR3 in which 1 amino acid is substituted relative to the sequence.

33. The antibody of claim 32, wherein the substitution in HCDR1 is in any of the residue #1, and #3- #5, wherein the substitution in HCDR2 is in any of the residue #2, #4-#17, wherein the substitution in HCDR3 is in any of the residues #2-#4, wherein the substitution in LCDR1 is in any of the residues #1-#11 and #13-#14, wherein the substitution in LCDR3 is in any of the residues #l-#2, #4-#7, and #9.

34. The antibody of claim 32 or 33, wherein the aa at position #2 in HCDR1 is Y, W, or F, wherein the aa at position #1 in HCDR2 is W, Y, or F, and aa at position #3 residue in HCDR1 is N or Q, wherein the aa at position #1 in HCDR3 is Y, wherein the aa at position #12 in LCDR1 is Y, W, or F, wherein the aa at position #3 in LCDR3 is Y, W, or F, and aa at position #8 in LCDR3 is Y, W, or F.

35. An antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a heavy chain variable region comprising: a HCDR1 comprising a sequence RFWMS (SEQ ID NO: 8), or a variant HCDR1 in which 1, 2, or 3 amino acids are substituted relative to the sequence; a HCDR2 comprising a sequence EISPDSNTIDLTPSLKD (SEQ ID NO: 29), or a variant HCDR2 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a HCDR3 comprising a sequence PYYGYY (SEQ ID NO: 50), or a variant HCDR3 in which 1, 2, or 3 amino acids are substituted relative to the sequence; and a light chain variable region comprising: a LCDR1 comprising a sequence RSSQSLFNSTNQKNYLT (SEQ ID NO: 176) or RSSQSLFSSTNQKNYLT (SEQ ID NO: 369), or a variant LCDR1 in which 1 amino acid is substituted relative to the sequence;a LCDR2 comprising a sequence WASSRES (SEQ ID NO: 197), or variant LCDR2 in which 1 amino acid is substituted relative to the sequence; and a LCDR3 comprising a sequence QNDYTSPFT (SEQ ID NO: 218), or a variant LCDR3 in which 1 amino acid is substituted relative to the sequence.

36. The antibody of claim 35, wherein the substitution in HCDR1 is in any of the positions #l-#2, and #4-#5 in HCDR1, wherein the substitution in HCDR2 is in any of the positions #2-#17 in HCDR2, wherein the substitution in HCDR3 is in any of the residues #l-#4 and #6 in HCDR3, wherein the substitution in LCDR1 is in any of the residues #1-#14 and #16-#17 in LCDR1, wherein the substitution in LCDR3 is in any of the residues #l-#2, #4-#9 in LCDR3.

37. The antibody of claim 35 or 36, wherein the aa at position #3 in HCDR1 is Y, W, or F, wherein the aa at position #1 in HCDR2 is E or D, wherein the aa at position #5 in HCDR3 is Y, W, or F wherein the aa at position #15 in LCDR1 is Y, W, or F, wherein the aa at position #3 in LCDR3 is Y.

38. An antibody competes for binding to GAL-3 with any one of the antibody of claims 1-7.

39. An antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of NX2GMN (SEQ ID NO: 357), wherein X2 is Y, W, or F, wherein the HCDR1 has zero or one aa substitution in rest of the residues relative to the HCDR1 sequence, a HCDR2 comprising a sequence of XJXsTYTGEPTYADDFKG (SEQ ID NO: 358), Where Xi is W, Y, or F, and wherein X3 is N or Q, wherein the HCDR2 has zero, one, two, three, or four aa substitutions in rest of the residues relative to the HCDR2 sequence, a HCDR3 comprising a sequence of YAMDY (SEQ ID NO: 359), wherein the HCDR3 has zero, one, or two aa substitutions relative to the HCDR3 sequence,a LCDR1 comprising a sequence of RSSTGAVTTSNXi2AN (SEQ ID NO: 360), wherein Xn is Y, W, or F, wherein the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence,a LCDR2 comprising a sequence of GTSNRAP (SEQ ID NO: 361), wherein the LCDR2 has zero, one, two, or three aa substitutions in the rest of the residues relative to the LCDR2 sequence, anda LCDR3 comprising a sequence of ALX3YSTHX8V (SEQ ID NO: 362) , wherein X3 is Y, W, or F, wherein X8 is Y, W, or F, wherein the LCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the LCDR3 sequence.

40. An antibody or a binding fragment thereof that binds to Galectin-3,wherein the antibody comprises:a HCDR1 comprising a sequence of NX2GMN (SEQ ID NO: 357), wherein X2 is Y, W, or F,a HCDR2 comprising a sequence of XJX^YTGEPTYADDFKG (SEQ ID NO: 358), Where Xi is W, Y, or F, and wherein X3 is N or Q, a HCDR3 comprising a sequence of YAMDY (SEQ ID NO: 359), a LCDR1 comprising a sequence of RSSTGAVTTSNXi2AN (SEQ ID NO: 360), wherein Xn is Y, W, or F,a LCDR2 comprising a sequence of GTSNRAP (SEQ ID NO: 361), anda LCDR3 comprising a sequence of ALX3YSTHX8V (SEQ ID NO: 362) , wherein X3 is Y, W, or F, wherein X8 is Y, W, or F;whereinthe HCDR1 has zero or one aa substitution in rest of the residues relative to the HCDR1 sequence,the HCDR2 has zero, one, two, three, or four aa substitutions in rest of the residues relative to the HCDR2 sequence,the HCDR3 has zero, one, or two aa substitutions relative to theHCDR3 sequence,the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence,the LCDR2 has zero, one, two, or three aa substitutions in the rest ofthe residues relative to the LCDR2 sequence, and / orthe LCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the LCDR3 sequence.

41. An antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of RFX3MS (SEQ ID NO: 363), wherein X3 is Y, W, or F, and wherein the HCDR1 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR1 sequence, a HCDR2 comprising XJSPDSNTIDLTPSLKD (SEQ ID NO: 364), wherein Xi is E or D, and wherein the HCDR2 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the HCDR2 sequence, a HCDR3 comprising PYYGX5Y (SEQ ID NO: 365), wherein X5 is Y, W, or F, wherein the HCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR3 sequence, a LCDR1 comprising RSSQSLFSSTNQKNX15LT (SEQ ID NO: 366) , wherein Xi5 is Y, W, or F, wherein the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, a LCDR2 comprising WASSRES (SEQ ID NO: 367) , wherein the LCDR2 has zero, one, two, or three aa substitutions relative to the LCDR2 sequence, and / or a LCDR3 comprising QNDYTSPFT (SEQ ID NO: 368), wherein the LCDR3 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR3 sequence.

42. An antibody or a binding fragment thereof that binds to Galectin-3, wherein the antibody comprises: a HCDR1 comprising a sequence of RFX3MS (SEQ ID NO: 363), wherein X3 is Y, W, or F, a HCDR2 comprising XJSPDSNTIDLTPSLKD (SEQ ID NO: 364), wherein Xi is E or D, a HCDR3 comprising PYYGX5Y (SEQ ID NO: 365), wherein X5 is Y, W, or F, a LCDR1 comprising RSSQSLFSSTNQKNX15LT (SEQ ID NO: 366) , wherein Xi5 is Y, W, or F, a LCDR2 comprising WASSRES (SEQ ID NO: 367) , and a LCDR3 comprising QNDYTSPFT (SEQ ID NO: 368) ; and whereinthe HCDR1 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR1 sequence, the HCDR2 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the HCDR2 sequence, the HCDR3 has zero, one, two aa substitutions in the rest of the residues relative to the HCDR3 sequence, the LCDR1 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR1 sequence, the LCDR2 has zero, one, two, or three aa substitutions relative to the LCDR2 sequence, and / or the LCDR3 has zero, one, two, three, or four aa substitutions in the rest of the residues relative to the LCDR3 sequence.

43. An antibody or a binding fragment thereof that binds to Galectin-3,wherein the antibody comprises a HCDR1 comprising a sequence of NYGMN (SEQ ID NO: 4), a HCDR2 comprising a sequence of WINTYTGEPTYADDFKG (SEQ ID NO: 25) , a HCDR3 comprising a sequence of YAMDY (SEQ ID NO: 46), a LCDR1 comprising a sequence of RSSTGAVTTSNYAN (SEQ ID NO: 172), a LCDR2 comprising a sequence of GTSNRAP (SEQ ID NO: 193), and a LCDR3 comprising a sequence of ALWYSTHYV (SEQ ID NO: 214).

44. The antibody of claim 43, wherein the antibody comprises a VHregion comprising a sequence of SEQ ID NO: 353, and a VL region comprising a sequence of SEQ ID NO: 354.

45. An antibody or a binding fragment thereof that binds to Galectin-3,wherein the antibody comprises a HCDR1 comprising a sequence of RFWMS (SEQ ID NO: 8), a HCDR2 comprising a sequence of EISPDSNTIDLTPSLKD (SEQ ID NO: 29) , a HCDR3 comprising a sequence of PYYGYY (SEQ ID NO: 50), a LCDR1 comprising a sequence of RSSQSLFNSTNQKNYLT (SEQ ID NO: 176) or RSSQSLFSSTNQKNYLT (SEQ ID NO: 369), a LCDR2 comprising a sequence of WASSRES (SEQ ID NO: 197), and a LCDR3 comprising a sequence of QNDYTSPFT (SEQ ID NO: 218) .

46. The antibody of claim 45, wherein the antibody comprises a VHregion comprising a sequence of SEQ ID NO: 355, and a VL region comprising a sequence of SEQ ID NO: 356.

Images