Biparatopic FR-alpha antibodies and immunoconjugates
Biparatopic antibodies targeting multiple FRα epitopes enhance ADC delivery and efficacy, improving progression-free and overall survival in FRα-expressing cancers by using dual-binding domains and immunoconjugate formats, addressing the limitations of existing FRα-targeting ADCs.
Patent Information
- Authority / Receiving Office
- AU · AU
- Patent Type
- Applications
- Current Assignee / Owner
- Filing Date
- 2026-07-01
- Publication Date
- 2026-07-16
AI Technical Summary
Existing folate receptor-alpha (FRα) targeting antibody-drug conjugates (ADCs) like Mirvetuximab soravtansine (IMGN853) show limited efficacy in improving progression-free survival across a broad patient population, highlighting the need for more efficacious ADCs that can enhance ADC delivery to FRα-expressing tumors.
Development of biparatopic antibodies that bind to two distinct epitopes of FRα, utilizing a first and second FRα-binding domain, which can be murine, humanized, or human, and are configured in formats such as scFv, diabody, triabody, or tetravalent structures, linked with cytotoxic agents via cleavable or non-cleavable linkers to form immunoconjugates.
The biparatopic antibodies demonstrate enhanced tumor targeting and cytotoxic activity, showing improved progression-free survival and overall survival in pre-specified high FRα subpopulations, particularly in platinum-resistant ovarian cancer, with reduced off-target effects.
Smart Images

Figure 00000176_0000 
Figure 00000178_0000 
Figure 00000179_0000
Abstract
Description
[0001] This application is a divisional application of Australian Patent Application No. 2020265568, filed on 7 October 2021, and is related to International Patent Application No. PCT / US2020 / 030245, filed on 28 April 2020, and claims priority to Provisional Patent Application No. 62,840,297, filed on 29 April 2019, and Provisional Patent Application No. 62 / 879,864, the disclosure of each of which is incorporated herein by reference in their entirety. [0001a] Preceding applications contained a Sequence Listing which was originally submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on 07 October 2021, is named "P0038045AU Gene Sequence (07 Oct 2021)" and is 102806 bytes in size. The present application contains a sequence listing which has been submitted electronically as an XML document in the ST.26 format and is hereby incorporated by reference in its entirety. Said XML copy, created on 16 June 2026, is named "P0038045AUD1 ST.26 Sequence Listing (16Jun2026)" and is 90364 bytes in size. FIELD OF THE DISCLOSURE [0001b] The field of this disclosure generally relates to biparatopic antibodies and immunoconjugates that bind to human folate receptor 1 (FRa). BACKGROUND OF THE DISCLOSURE
[0002] Cancer is one of the leading causes of death in the developed world, with over one million people diagnosed with cancer and 500,000 deaths per year in the United States alone. Overall it is estimated that more than 1 in 3 people will develop some form of cancer during their lifetime.
[0003] Antibody-drug conjugates (ADC) composed of highly cytotoxic agents conjugated to antibodies that bind to tumor-associated antigens represent a promising therapeutic strategy to enhance the potency of tumor-targeting antibodies. ADCs offer the potential to combine the favorable pharmacokinetics, biodistribution, and tumor-targeting properties of antibodies with the potent cell killing mechanism provided by the attached small molecule, or payload.
[0004] The folate receptor-a (FRa or FOLR1) is a glycosylphosphatidylinositol-linked cell-surface glycoprotein that has high affinity for folates. Its physiologic role in normal and 2026205205 01 Jul 2026 cancerous tissues has not yet been fully elucidated. Most normal tissues do not express FRa, and transport of physiologic folates into most cells is thought to be mediated by several other proteins, most notably, reduced folate carrier. High levels of FRa have been found in serous and endometrioid epithelial ovarian cancer, endometrial adenocarcinoma, and non-small cell lung cancer of the adenocarcinoma subtype. Importantly, FRa expression is maintained in metastatic foci and recurrent carcinomas in ovarian cancer patients, and after chemotherapy in epithelial ovarian and endometrial cancers. These properties, together with the highly restricted expression of FRa on normal tissues, make FRa a highly promising target for targeted therapies such as ADCs.
[0005] Mirvetuximab soravtansine (IMGN853), a folate targeting ADC that comprises a FRa targeting antibody conjugated to a potent tubulin-acting maytansinoid, DM4, was recently evaluated in the clinic in platinum-resistant ovarian cancer patients exhibiting medium and high FRa levels. The FORWARD I Phase 3 trial randomized 366 patients 2:1 to receive either mirvetuximab soravtansine or the physician's choice of single-agent chemotherapy (pegylated liposomal doxorubicin, topotecan, or weekly paclitaxel). While the 2026205205 01 Jul 2026 trial did not meet its primary endpoint of improvement in progression-free survival (PFS) (in the overall population hazard ratio (HR)= 0.98, p=0.897), the pre-specified high FRa subpopulation (218 / 366) showed an overall response rate of 24% with IMGN853 treatment versus 10% for standard of care chemotherapy. In addition, in the pre-specified high FRa sub-population, the PFS was longer in patients who received IMGN853 compared with chemotherapy (HR=0.69, p-value=0.049), and overall survival was longer in patients who received IMGN853 compared with chemotherapy (HR=0.62, p-value=O.O33). While, these results are encouraging for patients expressing high levels of FRa, the results also demonstrated the limitations of IMGN853 in improving progression-free survival across a broader patient population. |0006| Thus, there remains a need to identify additional folate targeting ADCs that can lead to even more efficacious treatment and higher ADC delivery. SUMMARY OF THE DISCLOSURE 100071 Provided herein is a biparatopic antibody or antigen binding fragment thereof that specifically binds a human folate receptor 1 (FRa), wherein the antibody or antigen-binding fragment thereof comprises (a) a first FRa-binding domain that comprises a first variable heavy chain (VH) and a first variable light chain (VL) and that bind to a first epitope of FRa; and (b) a second FRa-binding domain that comprises a second VH and a second VL and that binds to a second epitope of FRa. 10008] In some embodiments, the first FRa-binding domain specifically binds to the same FRa epitope as an antibody comprising a VH amino acid sequence selected from the group consisting of SEQ ID NOs:24, 25, and 26, and a VL amino acid sequence selected from the group consisting of SEQ ID NOs:19, 20, and 21. In some embodiments, the first FRa-binding domain specifically binds to the same FRa epitope as an antibody comprising a VH amino acid sequence selected from the group consisting of SEQ ID NOs:24, 57, and 26, and a VL amino acid sequence selected from the group consisting of SEQ ID NOs:19, 20, and 21. In some embodiments, the first FRa-binding domain competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence selected from the group consisting of SEQ ID NOs:24, 25, and 26, and a VL amino acid sequence selected from the group consisting of SEQ ID NOs:19, 20, and 21. In some embodiments, the first FRa-binding domain competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence selected from the group consisting of SEQ ID NOs:24, 57, and 26, and a VL amino acid sequence selected from the group consisting of 2026205205 01 Jul 2026 SEQ ID NOs: 19, 20, and 21. In some embodiments, the second FRa-binding domain specifically binds to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:22 or 23 and a VL amino acid sequence of SEQ ID NO: 17 or 18. In some embodiments, the second FRa-binding domain competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:22 or 23 and a VL amino acid sequence of SEQ ID NO :17 or 18. |0009| In some embodiments, the first VH comprises VH CDR1-3 comprising the amino acid sequences of (a) SEQ ID NOs: 10-12 or (b) SEQ ID NOs: 15, 16, and 12, respectively and the first VL comprises VL CDR1-3 comprising the amino acid sequences of SEQ ID NOs: 4-6, respectively. In some embodiments, the first VH comprises the amino acid sequence selected from the group consisting of SEQ ID NOs:24, 25, and 26, and / or the first VL comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 20, and 21. In some embodiments, the first FRa-binding domain competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence selected from the group consisting of SEQ ID NOs:24, 57, and 26, and a VL amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 20, and 21. In some embodiments, the second VH comprises VH CDR1-3 comprising the amino acid sequences of (a) SEQ ID NOs: 7-9 or (b) SEQ ID NOs: 13, 14, and 9, respectively and the second VL comprises VL CDR1-3 comprising the amino acid sequences of SEQ ID NOs: 1-3, respectively. In some embodiments, the second VH comprises the amino acid sequence of SEQ ID NO:22 or 23 and / or the second VL comprises the amino acid sequence of SEQ ID NO:17orl8. |0010] In some embodiments, the first VH and VL pair and / or the second VH and VL pair is murine, non-human, humanized, chimeric, resurfaced, or human. In some embodiments, the antibody or antigen-binding fragment thereof binds to human FRa but not FOLR2 or FOLR3. In some embodiments, the first FRa-binding domain is an single-chain variable fragment (scFv). In some embodiments, the scFv of the first FRa binding domain has a peptide orientation of VH-linker-VL. In some embodiments, the scFv of the first FRa binding domain has a peptide orientation of VL-linker-VH. In some embodiments, the second FRa-binding domain is an single-chain variable fragment (scFv). In some embodiments, the scFv of the second FRa binding domain has a peptide orientation of VH-linker-VL. In some embodiments, the scFv of the second FRa binding domain has a peptide orientation of VL-linker-VH. In some embodiments, the linker is a glycine-serine linker 2026205205 01 Jul 2026
[0011] In some embodiments, the second FRa-binding domain comprises an amino acid sequence selected from SEQ ID NOs: 27-29. In some embodiments, the first FRa-binding domain comprises an amino acid sequence selected from SEQ ID NOs: 30-32. In some embodiments, the biparatopic antibody or antigen binding fragment thereof disclosed herein comprises the amino acid sequence of (i) SEQ ID NOs:33 and 34, (ii) SEQ ID NOs: 35 and 36, (iii) SEQ ID NOs: 37 and 38, or (iv) SEQ ED NOs: 39 and 40.
[0012] In some embodiments, the biparatopic antibody or antigen binding fragment thereof comprises the amino acid sequences of SEQ ID NOs: 41-43. |0013| In some embodiments, the biparatopic antibody or antigen binding fragment thereof comprises the amino acid sequences of SEQ ID NOs: 44-46. |0014] In some embodiments, the biparatopic antibody or antigen binding fragment thereof is a tetravalent biparatopic antibody or antigen binding fragment thereof. In some embodiments, the biparatopic antibody or antigen binding fragment thereof is a bivalent btparatopic antibody or antigen binding fragment thereof. In some embodiments, the biparatopic antibody or antigen-binding fragment thereof comprises FRa-binding domains selected from the group consisting of tandem scFvs, a diabody, a triabody, a tetrabody, and a knob-in-hole structure. In some embodiments, the biparatopic antibody or antigen binding fragment thereof has a knob-in-hole (Kil l) structure 10015] In some embodiments, the biparatopic antibody or antigen binding fragment thereof comprises a FRa binding domain, wherein the FRa binding domain comprises SEQ ID NOs: 1-3 and 7-9 is on the knob side of the KIH structure. In some embodiments, the FRa binding domain comprises SEQ ID NOs: 1-3 and 7-9 is on the hole side of the KIH structure. In some embodiments, the FRa binding domain comprises SEQ ID NOs. 4-6 and 10-12 is on the knob side of the KIH structure. In some embodiments, the FRa binding domain comprises SEQ ID NOs. 4-6 and 10-12 is on the hole side of the KIH structure.
[0016] In some embodiments, the biparatopic antibody or antigen-binding fragment thereof comprises a full length antibody. In some embodiments, the biparatopic antibody or antigen-binding fragment thereof comprises a first FRa-binding domain, wherein the first FRa-binding domain is a full length antibody. In some embodiments, the biparatopic antibody or antigen-binding fragment thereof comprises a second FRa-binding domain, wherein the second FRa-binding domain is a full length antibody. In some embodiments, the biparatopic antibody or antigen-binding fragment thereof comprises an antigen-binding fragment. In some embodiments, the biparatopic antibody or antigen-binding fragment thereof comprises a first FRa-binding domain, wherein the first FRa-binding domain is an 2026205205 01 Jul 2026 antigen-binding fragment. In some embodiments, the biparatopic antibody or antigen-binding fragment thereof comprises a second FRa-binding domain, wherein the second FRa-binding domain is an antigen-binding fragment. In some embodiments, the biparatopic antibody or antigen binding fragment thereof comprises the amino acid sequences of SEQ ID NOs: 4143. |0017] In some embodiments, provided herein is a combination of isolated nucleic acid molecules encoding the biparatopic antibody or antigen binding fragment thereof disclosed herein.
[0018] In some embodiments, provided herein is an isolated vector comprising one of the nucleic acid molecules disclosed herein. |0019| In some embodiments, provided herein is a host cell comprising the combination of isolated nucleic acid molecules as disclosed herein, or the isolated vector as disclosed herein. In some embodiments, the host cell is selected from the group consisting of E. coli, Pseudomonas, Bacillus, Streptomyces, yeast, CHO, YB / 20, NS0, PER-C6, HEK-293T, NIH-3T3, HeLa, BHK, Hep G2, SP2 / 0, Rl.l, B-W, L-M, COS 1, COS 7, BSC1, BSC40, BMT10 cell, plant cell, insect cell, and human cell in tissue culture. |0020] In some embodiments, provided herein is a pharmaceutical composition comprising the biparatopic antibody or antigen as disclosed herein, the combination of nucleic acid molecule(s) as disclosed herein, a vector as disclosed herein, or a host cell as disclosed herein, and a pharmaceutically acceptable carrier or excipient. In some embodiments, the pharmaceutical composition as provided herein comprises a biparatopic antibody as disclosed herein, and a pharmaceutically carrier or excipient. In some embodiments, a pharmaceutical composition comprises an average of 1 to 10 drugs per antibody or antigen-binding fragment thereof. In some embodiments, a pharmaceutical composition comprises an average of 2 to 5 drugs per antibody or antigen-binding fragment thereof. In some embodiments, a pharmaceutical composition comprises an average of 3 to 4 drugs per antibody or antigen-binding fragment thereof. |0021 ] In some embodiments, provided herein is a method of making the biparatopic antibody as disclosed herein comprising (a) culturing a cell expressing the antibody; and (b) isolating the antibody from the cultured cell. In some embodiments, the cultured cell is a eukaryotic cell. 10022] In some embodiments, provided herein is an immunoconjugate represented by the following formula: 2026205205 01 Jul 2026 CB—:-L2—a—NH—CR1R2-S-L—D ■ q (I) or a pharmaceutically acceptable salt thereof, wherein: CB is any biparatopic antibody or an antigen-binding fragment thereof provided herein; L2 is represented by one of the following formula: wherein: Rx, Ry, Rx and R?, for each occurrence, are independently H, -OH, halogen, -O-fCi-i alkyl), -SO3H, -NR4oR4iR42+, or a C1-4 alkyl optionally substituted with -OH, halogen, SOiH or NR40R41R42* wherein R40, R41 and R42 are each independently H or aCi-4 alkyl; 1 and k are each independently an integer from 1 to 10; 11 is an integer from 2 to 5; 2026205205 01 Jul 2026 kl is an integer from 1 to 5; and si indicates the site connected to the cell-binding agent CB and s3 indicates the site connected to the A group; A is an amino acid residue or a peptide comprising 2 to 20 amino acid residues; R1 and R2 are each independently H or a Cioalkyl; Li is represented by the following formula; -CR3R4-(CH2)i-s-C(=O)- wherein R3 and R4 are each independently H or Me, and the -C(=O)- moiety in Li is connected to D, D is represented by the following formula; q is an integer from 1 to 20. In some embodiments q is an integer from 1 to 10. In some embodiments q is an integer from 2 to 5. In some embodiments, q is an integer from 3 to 4. 10023| In some embodiments, the R\ R\ Rx and Ry of the immunoconjugate are all H; and 1 and k are each independently an integer an integer from 2 to 6. In some embodiments, the A of the immunoconjugate is a peptide containing 2 to 5 amino acid residues.
[0024] In some embodiments, the A of the immunoconjugate is selected from the group consisting of Gly-Gly-Gly, Ala-Vai, Vai-Ala, D-Val-Ala, Val-Cit, D-Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Phe-Ala, Phe-N9-tosyl-Arg, Phe-N9-nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val-Ala-Val, Ala-Ala-Ala, D-Ala-Ala-Ala, Ala-D-Ala-Ala, Ala-Ala-D-Ala, Ala-Leu-Ala-Leu (SEQ ID NO;54), p-Ala-Leu-Ala-Leu (SEQ ID NO:55), Gly-Phe-Leu-Gly (SEQ ID NO56), Val-Arg, Arg-Arg, Val-D-Cit, Val-D-Lys, Val-D-Arg, D-Val-Cit, D-Val-Lys, D-Val-Arg, D-Val-D-Cit, D-Val-D-Lys, D-Val-D-Arg, D-Arg-D-Arg, Ala-Ala, Ala-D-Ala, D-Ala-Ala, D-Ala-D- 2026205205 01 Jul 2026 Ala, Ala-Met, Gln-Val, Asn-Ala, Gln-Phe, Gin-Ala, D-Ala-Pro, and D-Ala-tBu-Gly, wherein the first amino acid in each peptide is connected to L2 group and the last amino acid in each peptide is connected to NH-CR1R2-S-Li-D In some embodiments, the R1 and R2 of the immunoconjugate are both H. In some embodiments, the Li of the immunoconjugate is -(CH2)4-6-C(=O)-. |0025] In some embodiments, the D of the immunoconjugate is represented by the following formula:
[0026] In some embodiments, the immunoconjugate is represented by the following formula: 2026205205 01 Jul 2026 or a pharmaceutically acceptable salt thereof, wherein: CBA^N— H is any biparatopic antibody or an antigen-binding fragment thereof provided herein connected to the L? group through a Lys amine group; CBA^s js any biparatopic antibody or an antigen-binding fragment thereof provided herein connected to the L? group through a Cys thiol group; R’ and R4 are each independently H or Me; ml, m3, nl, rl,sl andtl are each independently an integer from 1 to 6; m2, n2, r2, s2 and t2 are each independently an integer from 1 to 7; t3 is an integer from 1 to 12; Di is represented by the following formula:
[0027] In some embodiments, the immunoconjugate is represented by the following formula: 2026205205 01 Jul 2026 wherein: m 1 and m3 are each independently an integer from 2 to 4; m2 is an integer from 2 to 5; rl is an integer from 2 to 6; and r2 is an integer from 2 to 5. |0028| In some embodiments, A of the immunoconjugate is Ala-Ala-Ala, Ala-D-Ala-Ala, Ala-Ala, D-Ala-Ala, Vai-Ala, D-Val-Ala, D-Ala-Pro, or D-Ala-tBu-Gly |0029| In some embodiments, the immunoconjugate is represented by the following formula: o no -ID o o n _q vgo _Q SI 2026205205 01 Jul 2026 -vao 2026205205 01 Jul 2026 2026205205 01 Jul 2026
[0030] In some embodiments, the immunoconjugate is represented by the following formula: q. or 2026205205 01 Jul 2026 wherein Di is represented by the following formula: 10031] In some embodiments, the immunoconjugate is represented by the following CBA is any biparatopic antibody or an antigen-binding fragment thereof provided herein; q is an integer from 1 to 10, e.g., 1 or 10, Di is represented by the following formula; 2026205205 01 Jul 2026 |0032] In some embodiments q is an integer from 2 to 5. In some embodiments, q is an integer from 3 to 4. |0033] In some embodiments, the immunoconjugate is represented by the following formula: or a pharmaceutically acceptable salt thereof, wherein: CBA is the biparatopic antibody or an antigen-binding fragment comprising the amino acid sequences of SEQ ID NOs: 41-43; Di is represented by the following formula: q is an integer from 1 to 10. In some embodiments q is an integer from 2 to 5 In some embodiments, q is an integer from 3 to 4. 2026205205 01 Jul 2026
[0034] In some embodiments, disclosed herein is an immunoconjugate having the formula (A) - (L) - (C), wherein: (A) is any biparatopic antibody or antigen binding fragment provided herein; (L) is a linker; and (C) is a cytotoxic agent, wherein the linker (L) links (A) to (C)
[0035] In some embodiments, the linker of an immunoconjugate disclosed herein is selected from the group consisting of a cleavable linker, a non-cleavable linker, a hydrophilic linker, and a dicarboxylic acid based linker. In some embodiments, the linker is selected from the group consisting of N-(y maleimidobutryloxyjsulfosuccinimide ester (sulfo-GMBS or sGMBS), y maleimidobutyric acid N-succinimidyl ester (GMBS), N-succinimidyl 4-(2-pyridyldithio)-2-sulfobutanoate (sulfo-SPDB), N-succinimidyl 4-(2-pyridyldithio)pentanoate (SPP) or N-succinimidyl 4-(2- pyridyldithio)-2-sulfopentanoate (sulfo-SPP); N-succinimidyl 4-(2-pyridyldithio)butanoate (SPDB), N-succinimidyl 4- (maleimidomethyl) cyclohexanecarboxylate (SMCC); N-sulfosuccinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (sulfoSMCC); N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB); and N-succinimidyl-[(N-maleimidopropionamido)-tetraethyleneglycol] ester (NHS-PEG4-mal eimide). |0036] In some embodiments, the linker is sulfo-GMBS. 10037] In some embodiments, the linker is GMBS. 10038| In some embodiments, the linker is sulfo-SPDB.
[0039] In some embodiments, the cytotoxic agent of an immunoconjugate disclosed herein is selected from the group consisting of a maytansinoid, maytansinoid analog, benzodiazepine, taxoid, CC-1065, CC-1065 analog, duocarmycin, duocarmycin analog, calicheamicin, dolastatin, dolastatin analog, auristatin, tomaymycin derivative, and leptomycin derivative or a prodrug of the agent. In some embodiments, the cytotoxic agent is a maytansinoid. 10040| In some embodiments, the immunoconjugate further comprises a second (C). In some embodiments, the immunoconjugate further comprises a third (C). In some embodiments, the immunoconjugate further comprises a fourth (C). |0041| In some embodiments, provided herein is a composition comprising at least one immunoconjugate as disclosed herein, wherein the immunoconjugate comprises an average of 3-4 C per A. 2026205205 01 Jul 2026
[0042] In some embodiments, provided herein is a pharmaceutical composition comprising the immunoconjugate ad disclosed herein and a pharmaceutically acceptable carrier. In some embodiments, a pharmaceutical composition comprises an average of 1 to 10 drugs per antibody or antigen-binding fragment thereof. In some embodiments, a pharmaceutical composition comprises an average of 2 to 5 drugs per antibody or antigenbinding fragment thereof. In some embodiments, a pharmaceutical composition comprises an average of 3 to 4 drugs per antibody or antigen-binding fragment thereof. |0043] In some embodiments, provided herein is a method of treating a cancer in a subject, comprising administering to the subject a therapeutically effective amount of the antibody or antigen binding fragment thereof as disclosed herein, an immunoconjugate as disclosed herein, or the pharmaceutical compositions as disclosed herein. 10044] In some embodiments, provided herein is a method of treating a cancer. In some embodiments, the cancer is ovarian cancer, uterine cancer, peritoneal cancer, fallopian tube cancer, endometrial cancer, lung cancer, or brain cancer. In some embodiments, the cancer is ovarian cancer. In some embodiments, the ovarian cancer is platinum-resistant epithelial ovarian cancer. In some embodiments, the ovarian cancer is relapsed epithelial ovarian cancer. In some embodiments, the ovarian cancer is platinum-refractory epithelial ovarian cancer. In some embodiments, the cancer is uterine cancer. In some embodiments, the cancer is peritoneal cancer. In some embodiments, the cancer is fallopian tube cancer. In some embodiments, the cancer is endometrial cancer. In some embodiments, the cancer is lung cancer. In some embodiments, the cancer is brain cancer. In some embodiments, the cancer is IMGN853-resistant. 10045] In some embodiments, the method further comprises administration of a steroid. BRIEF DESCRIPTIONS OF THE DRA WINGS
[0046] FIG. 1 shows binding competition of huMovl9-biotin with folate receptor antibodies FR57; FRa Antibody A ("FRa-A"); FRa Antibody B ("FRa-B"); FRa Antibody C ("FRa-C"); and non-biotinylated huMov!9 ("huMovl9") by FACS. (See Example 1.)
[0047] FIG. 2 shows exemplary molecules, characteristics, and schematics for conventional monospecific antibodies (such as huMovl9 and FR57), bivalent biparatopic knob-in-hole (KIH) antibodies, and tetravalent biparatopic (Morrison) antibodies. (See Example 1.) |0048| FIG. 3 shows a gel of several heavy chain and light chain plasmid transfection ratios that were used for producing asymmetric-Fc based molecules. LI: transfection with 2026205205 01 Jul 2026 FR57scFv-knob only; L2: transfection of Movl9LC: Movl9HC-Hole: FR57scFv-knob at 4:4:1; L3: transfection of Movl9LC: Movl9HC-Hole: FR57scFv-knob at 6:2:1; L4: transfection of Movl9LC: Movl9HC-Hole: FR57scFv-knob at 6:6:1; L5: transfection of Movl9LC: Movl9HC-Hole: FR57scFv-knob at 9:3:1, L6: transfection of Movl9LC: Movl9HC-Hole: FR57scFv-knob at 2:3:1; L7 transfection of Movl9LC: Movl9HC-Hole: FR57scFv-knob at 1:1:1; L8: transfection of Movl9 LC: Movl9-hole at 3:1; L9: Isotype human IgGl transfection. (See Example 1.) |0049| FIGs. 4A-4H show binding activity of Morrison’s antibodies or fragments thereof by competition FACS. (See Example 2.). In particular, FIG. 4A shows the binding activity of Movl9-Gl-FR57scFvl (M9346A-FR57scFv); FIG. 4B shows the binding activity of FR57-Gl-Movl9scFvl (FR57-M9346AscFv), FIG. 4C shows the binding activity of Movl9-Gl-FRa-Antibody-A-scFvl (M9346A-FR-a-A:scFv); FIG. 4D shows the binding activity of FRa-Antibody-A-Gl-Movl9scFvl (FR-a-A: M9346AscFv); FIG. 4E shows the binding activity of FRa-Antibody-A-scFv2-Gl-Movl9 (FR-a-A:scFv-M9346A); FIG. 4F shows the binding activity of FRa-Antibody-B-scFv2-Gl-Mov 19 (FR-a-B:scFV-M9346A); FIG. 4G shows the binding activity of FRa-Antibody-C-scFv2-GI-Movl9 (FR-a-C:scFv-M9346A); and FIG. 4H shows the binding activity of FR57scFv2-Gl-Movl9 (FR57scFv-M9346A). |0050| FIG. 5 shows an SDS PAGE gel of three purified preparations (Pl, P2, and P3) of the FR57scFv2-knob-Movl9-hole antibody under non-reducing and reducing conditions. The FR57scFv2-knob-Movl9-hole antibody is a biparatopic antibody in the knob-in-hole (KIH) format with an FR57 scFv on the knob side of the antibody and huMovl9 antibody sequences on the hole side of the antibody. (See Example 2.)
[0051] FIG. 6 shows an overlay of size exclusion chromatography results obtained from Day 0 and Day 14 samples of the FR57scFv2-knob-Movl9-hole antibody. mAU: milliAbsorbance Units. (See Example 2.)
[0052] FIGs. 7A-7F show the binding (FIGs. 7A and 7B), internalization and processing (FIGs. 7C and 7D), and degradation (FIGs. 7E and 7F) of a Knob-in-hole (KIH) biparatopic antibody (FIGs. 7A, 7C, and 7E) or a tetravalent biparatopic antibody (FIGs. 7B, 7D. and 7F) compared to the huMovl9 (“parent”) antibody. (See Example 2.) 10053| FIG. 8 shows the median tumor volume in an OV-90 xenograft model after administration of vehicle, an immunoconjugate containing a tetravalent biparatopic antibody (“Tetravalent-s-SPDB-DM4”), or an immunoconjugate containing the huMov!9 antibody (“M-S-SPDB-DM4”) (See Example 4.) 2026205205 01 Jul 2026
[0054] FIG* 9 shows the median tumor volume in an Igrov-1 xenograft model after administration of vehicle, Tetravalent-s-SPDB-DM4, or M-S-SPDB-DM4. (See Example 4.)
[0055] FIG. 10 shows the median tumor volume in an OV-90 xenograft model after administration of vehicle, an immunoconjugate containing a knob-in-hole biparatopic antibody (“KIH-S-SPDB-DM4”), or M-S-SPDB-DM4. (See Example 4.) 10056] FIG. 11 shows the cytotoxic activity of immunoconjugates containing the FR.57 antibody (FR57-L-DM21) or the huMovl9 antibody (M-L-DM21) against KB cells. (See Example 5 )
[0057] FIGs. 12A-12E show the cytotoxic activity of the biparatopic KIH-DM21 immunoconjugate, the huMovl9 immunoconjugate M-DM21, and huMovl9 immunoconjugate M-S-SPDB-DM4 against a panel of FRa-positive cell lines including KB cells (FIG. 12A), Igrov-1 cells (FIG. 12B), JEG-3 cells (FIG. 12C), T47D cells (FIG. 12D), and JHOS-4 cells (FIG. 12E). (See Example 5.)
[0058] FIGs. 13A-13D show the in vitro bystander killing activity of the biparatopic KIH-L-DM21 immunoconjugate, the huMovl9 immunoconjugate M-L-DM21, and huMovl9 immunoconjugate M-S-SPDB-DM4 in target-negative cells Namalwa / / / / c mixed with KB cells (FIG. 13A), Igrov-1 cells (FIG. 13B), JEG-3 cells (FIG. 13C), and T47D cells (FIG. 13D). (See Example 5.)
[0059] FIGs. 14A and 14B show the median tumor volumes after administration of the biparatopic immunoconjugate KIH-L-DM21 and the huMov!9 immunoconjugate M-L-DM21 (FIG. 14A) or the biparatopic immunoconjugate KIH-S-SPDB-DM4 and the huMovl9 immunoconjugate M-S-SPDB-DM4 (FIG. 14B) to an OV-90 xenograft model. (See Example 6.)
[0060] FIG. 15 shows the median tumor volume after administration of the biparatopic immunoconjugate KIH-L-DM21, immunoconjugate to an Ishikawa xenograft model compared to vehicle, the huMovl9 immunoconjugate M-L-DM21, or the huMovl9 immunoconjugate M-S-SPDB-DM4 (“IMGN853”,). (See Example 6.) 100611 FIG. 16 shows the median tumor volume after administration of the biparatopic KIH-L-DM21 immunoconjugate to an Igrov-1 xenograft model compared to vehicle, the huMovl9 immunoconjugate M-L-DM21, or the huMovl9 immunoconjugate IMGN853. (See Example 6.) |0062| FIG. 17 shows the median tumor volume after administration of the biparatopic K1H-L-DM21 immunoconjugate to a KB xenograft model compared to vehicle, the huMov!9 2026205205 01 Jul 2026 immunoconjugate M-L-DM21, or the huMovl9 immunoconjugate M-S-SPDB-DM4. (See Example 7.) |0063| FIGs. 18A and 18B show the toxicity of the biparatopic KIH-sSPDB-DM21 immunoconjugate (FIG. 18A) and the huMov!9 immunoconjugate M-S-SPDB-DM4 ("IMGN853") (FIG. 1 SB) compared to total antibody (TAb: total antibody; conjugated and unconjugated). (See Example 7.) |0064| FIG. 19 shows the median tumor volume after administration of the biparatopic KIH-L-DM21 immunoconjugate to a IMGN853-resistant KB human cervical carcinoma xenograft model compared to vehicle, the huMovl9 immunoconjugate M9346A-DM21-L, or the huMovl9 immunoconjugate IMGN853. (See Example 6.) DETAILED DESCRIPTION OF THE DISCLOSURE LDefiiiitions |0065| To facilitate an understanding of the present disclosure, a number of terms and phrases are defined below. |0066| The terms “human folate receptor 1,” “FRa,” “folate receptor alpha (FR-a),” or “FOLRI” as used herein, refers to any native human FRa polypeptide, unless otherwise indicated. The term “FRa” encompasses “full-length,” unprocessed FRa polypeptide as well as any form of FRa polypeptide that results from processing within the cell. The term also encompasses naturally occurring variants of FRa, e.g., those encoded by splice variants and allelic variants. The FRa polypeptides described herein can be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods. Where specifically indicated, “FRa” can be used to refer to a nucleic acid that encodes a FRa polypeptide. Human FRa sequences are known and include, for example, the sequences publicly available at UniProtKB Accession No. P15328 (including isoforms). As used herein, the term "human FRa" refers to FRa comprising the sequence of SEQ ID NO 53 MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLH EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYEC SPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWT SGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQG NPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS (SEQ ID NO 53). 2026205205 01 Jul 2026
[0067] The term “anti-FRa antibody” or “an antibody that binds to FRa” refers to an antibody that is capable of binding FRa with sufficient affinity such that the antibody is useful as a diagnostic and / or therapeutic agent in targeting FRa. As used herein, such antibodies include, for example, bispecific (eg., biparatopic) antibodies. Unless otherwise specified, the extent of binding of an anti-FRa antibody to an unrelated, non-FRa protein is less than about 10% of the binding of the antibody to FRa as measured, e.g., by a radioimmunoassay (RIA). Examples of FRa antibodies are known in the art and are disclosed in U.S. Published Application Nos. 2012 / 0009181 and 2012 / 0282175 and U.S. Patent No. 9,200,073 B2, and PCT publication WO 2011 / 106528 Al, each of which is herein incorporated by reference in its entirety. The sequences of exemplary anti-FRa antibodies and antigen-binding fragments thereof are provided in Tables 1-8. 10068] The term “1MGN853” (also known as “mirvetuximab soravtansine”) refers to the immunoconjugate described herein containing the huMovl9 (or M9346A) antibody, the sulfoSPDB linker, and the DM4 maytansinoid. The “huMovl9” (or “M9346A”) antibody is an anti-FRa antibody comprising the full length heavy chain of SEQ ID NO:47 (comprising the variable heavy chain sequence SEQ ID NO 24, which is underlined in the context of SEQ ID NO:47 below) and the full length light chain of SEQ ID NO:48 (comprising the variable light chain sequence SEQ ID NO: 19, which is underlined in the context of SEQ ID NO:48 below). O VOL VO SGAE V VKPGAS VKISCK ASGYTFTGYFMNW VKQSPGOSLE WIGRIHPYDG DTF YNOKFOGK ATLT VDK S SNTAHMELL SLTSEDF A VYYCTRYDGSRAMD YWGQG TTV1VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO:47) DIVLTQSPLSLAVSLGOPAIISCKASQSVSFAGTSLMHWYHOKPGQQPRLLIYRASNL EAGVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKRTVAA PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:48) 2026205205 01 Jul 2026 |0069| The huMovl9 (M9346A) antibody is encoded by the plasmids deposited with the American Type Culture Collection (ATCC), located at 10801 University Boulevard, Manassas, VA 20110 on April 7, 2010 under the terms of the Budapest Treaty and having ATCC deposit nos. PTA-10772 and PTA-10773 or 10774. DM4 refers to N2’-deacetyl-N2’-(4-mercapto-4-methyl-l-oxopentyl) maytansinoid. “SulfoSPDB” refers to the N-succinimidyl 4-(2-pyridyldithio)-2-sulfobutanoate) linker. 10070| The terms “elevated” FRa, “increased expression” of FRa, or “overexpression” of FRa in a particular tumor, tissue, or cell sample refers to FRa (a FRa polypeptide or a nucleic acid encoding such a polypeptide) that is present at a level higher than that which is present in a healthy or non-diseased (native, wild type) tissue or cells of the same type or origin. Such increased expression or overexpression can be caused, for example, by mutation, gene amplification, increased transcription, increased translation, or increased protein stability. 100711 FRa expression can be measured by immunohistochemistry and given a “staining intensity score” or a “staining uniformity score” by comparison to calibrated controls exhibiting defined scores (e.g., an intensity score of 3 is given to the test sample if the intensity is comparable to the level 3 calibrated control or an intensity of 2 is given to the test sample if the intensity is comparable to the level 2 calibrated control). For example, a score of 1, 2, or 3, preferably a score of 2, or 3, by immunohistochemistry indicates an increased expression of FRa. A staining uniformity that is heterogeneous or homogeneous is also indicative of FRa expression. The staining intensity and staining uniformity scores can be used alone or in combination (e.g., 2 homo, 2 hetero, 3 homo, 3 hetero, etc.). Staining uniformity can also be expressed as percentage (%) of cells staining at a certain intensity (e.g., 25% of cells staining at intensity of 1, 2, or 3; 50% of cells staining at intensity of 1, 2, or 3; 70% of cells staining at intensity of 1, 2, or 3. In another example, an increase in FRa expression can be determined by detection of an increase of at least 2-fold, at least 3-fold, or at least 5-fold relative to control values (eg., expression level in a tissue or cell from a subject without cancer or with a cancer that does not have elevated FRa values). FRa expression can be measured by immunohistochemistry and given a visual score where FRa positive may refer to greater than or equal to 50% of tumor cells with FRa membrane staining visible at less than or equal to 10X microscope objective.
[0072] The term “antibody” means an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, 2026205205 01 Jul 2026 polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule. As used herein, the term “antibody” encompasses intact polyclonal antibodies, intact monoclonal antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antibody, and any other modified immunoglobulin molecule so long as the antibodies exhibit the desired biological activity. As used herein, such antibodies include, for example, bispecific (e,g., biparatopic) antibodies. An antibody can be of any the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g. IgGl, IgG2, IgG3, IgG4, IgAl and lgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively. The different classes of immunoglobulins have different and well known subunit structures and threedimensional configurations. Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc.
[0073] The term “antibody fragment” or “antibody fragment thereof’ refers to a portion of an intact antibody. An “antigen-binding fragment” refers to a portion of an intact antibody that binds to an antigen. An antigen-binding fragment can contain the antigenic determining variable regions of an intact antibody. Examples of antibody fragments include, but are not limited to Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, and single chain antibodies. Antibody fragments can be naked or conjugated to other molecules such as toxins, radioisotopes, etc. |0074| A “monoclonal” antibody or antigen-binding fragment thereof refers to a homogeneous antibody or antigen-binding fragment population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants. The term “monoclonal” antibody or antigen-binding fragment thereof encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site. Furthermore, “monoclonal” antibody or antigenbinding fragment thereof refers to such antibodies and antigen-binding fragments thereof made in any number of manners including but not limited to by hybridoma, phage selection, recombinant expression, and transgenic animals. |0075| The term “humanized” antibody or antigen-binding fragment thereof refers to forms of non-human (e.g. murine) antibodies or antigen-binding fragments that are specific 2026205205 01 Jul 2026 immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g., murine) sequences. Typically, humanized antibodies or antigenbinding fragments thereof are human immunoglobulins in which residues from the complementarity determining region (CDR) are replaced by residues from the CDR of a nonhuman species (e.g. mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and capability (“CDR grafted”) (Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al, Science 239:1534-1536 (1988)). In some instances, the Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody or fragment from a non-human species that has the desired specificity, affinity, and capability. The humanized antibody or antigenbinding fragment thereof can be further modified by the substitution of additional residues either in the Fv framework region and / or within the replaced non-human residues to refine and optimize antibody or antigen-binding fragment thereof specificity, affinity, and / or capability. In general, the humanized antibody or antigen-binding fragment thereof will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody or antigen-binding fragment thereof can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are described in U.S. Pat. 5,225,539; Roguska et al, Proc. Natl. Acad. Sci, USA, 91(3):969-973 (1994), and Roguska et al, Protein Eng. 9(10):895-904 (1996). In some embodiments, a “humanized antibody” is a resurfaced antibody.
[0076] A “variable region” of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination. The variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions. The CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigenbinding site of antibodies. There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability (i.e., Kabat et al., Sequences of Proteins of Immunological Interest, (5th ed., 1991, National Institutes of Health, Bethesda Md.), “Rabat”); and (2) an approach based on crystallographic studies of antigen-antibody 2026205205 01 Jul 2026 complexes (Al-lazikani et al, J. Molec. Biol. 273:927-948 (1997)). In addition, combinations of these two approaches are sometimes used in the art to determine CDRs 10077| A ‘‘constant” region of an antibody is not involved directly in binding an antibody to an antigen, but exhibits various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity |0078| The Rabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al., Sequences of Immunological Interest. 5th Ed., 1991, National Institutes of Health, Bethesda, Md.) (“Kabat”). 10079] The amino acid position numbering as in Kabat, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al. (Sequences of Immunological Interest. 5th Ed., 1991, National Institutes of Health, Bethesda, Md.), (“Kabat”). Using this numbering system, the actual linear amino acid sequence can contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain. For example, a heavy chain variable domain can include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82. The Kabat numbering of residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence. Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol Biol 196:901-917 (1987)). The end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34). The AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software. Loop Kabat AbM Chothia LI L24-L34 L24-L34 L24-L34 L2 L50-L56 L50-L56 L50-L56 L3 L89-L97 L89-L97 L89-L97 Hl H31-H35B H26-H35B H26-H32..34 2026205205 01 Jul 2026 Hl H31-H35 (Kabat Numbering) H26-H35 H26-H32 (Chothia Numbering) H2 H50-H65 H50-H58 H52-H56 H3 H95-H1O2 H95-H102 H95-H102 |0080| The term “human” antibody or antigen-binding fragment thereof means an antibody or antigen-binding fragment thereof produced by a human or an antibody or antigen-binding fragment thereof having an amino acid sequence corresponding to an antibody or antigen-binding fragment thereof produced by a human made using any technique known in the art. This definition of a human antibody or antigen-binding fragment thereof includes intact or full-length antibodies and fragments thereof. 100811 The term “chimeric” antibodies or antigen-binding fragments thereof refers to antibodies or antigen-binding fragments thereof wherein the amino acid sequence is derived from two or more species. Typically, the variable region of both light and heavy chains corresponds to the variable region of antibodies or antigen-binding fragments thereof derived from one species of mammals (e.g. mouse, rat, rabbit, etc.) with the desired specificity, affinity, and capability while the constant regions are homologous to the sequences in antibodies or antigen-binding fragments thereof derived from another (usually human) to avoid eliciting an immune response in that species. |0082| The term “epitope” or “antigenic determinant” are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody. When the antigen is a polypeptide, epitopes can be formed both from contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding are typically lost upon protein denaturing. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation. 10083| “Binding affinity” generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein. Low-affinity antibodies generally 2026205205 01 Jul 2026 bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer. A variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present di sclosure. 100841 “Or better” when used herein to refer to binding affinity refers to a stronger binding between a molecule and its binding partner. “Or better” when used herein refers to a stronger binding, represented by a smaller numerical Kd value. For example, an antibody which has an affinity for an antigen of “0.6 nM or better,” the antibody's affinity for the antigen is <0.6 nM, i.e. 0.59 nM, 0.58 nM, 0.57 nM etc. or any value less than 0.6 nM 100851 By “specifically binds,” it is generally meant that an antibody binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. According to this definition, an antibody is said to “specifically bind” to an epitope when it binds to that epitope, via its antigen binding domain more readily than it would bind to a random, unrelated epitope. The term “specificity” is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope. For example, antibody “A” may be deemed to have a higher specificity for a given epitope than antibody “B,” or antibody “A” may be said to bind to epitope “C” with a higher specificity than it has for related epitope “D.” 10086| By “preferentially binds,” it is meant that the antibody specifically binds to an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope. Thus, an antibody which “preferentially binds” to a given epitope would more likely bind to that epitope than to a related epitope, even though such an antibody may cross-react with the related epitope. |0087| An antibody is said to “competitively inhibit” binding of a reference antibody to a given epitope if it preferentially binds to that epitope or an overlapping epitope to the extent that it blocks, to some degree, binding of the reference antibody to the epitope. Competitive inhibition may be determined by any method known in the art, for example, competition ELISA assays. An antibody may be said to competitively inhibit binding of the reference antibody to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%. 10088| The phrase “substantially similar,” or “substantially the same,” as used herein, denotes a sufficiently high degree of similarity between two numeric values (generally one associated with an antibody of the disclosure and the other associated with a reference / comparator antibody) such that one of skill in the art would consider the difference 2026205205 01 Jul 2026 between the two values to be of little or no biological and / or statistical significance within the context of the biological characteristic measured by said values (e.g., Kd values). The difference between said two values can be less than about 50%, less than about 40%, less than about 30%, less than about 20%, or less than about 10% as a function of the value for the reference / comparator antibody.
[0089] The terms “polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length. The polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art. It is understood that, because the polypeptides of this disclosure are based upon antibodies, in certain embodiments, the polypeptides can occur as single chains or associated chains. 100901 The terms “polynucleotide” or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA. The nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and / or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase. A polynucleotide can comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure can be imparted before or after assembly of the polymer. The sequence of nucleotides can be interrupted by non-nucleotide components. A polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component. Other types of modifications include, for example, “caps,” substitution of one or more of the naturally occurring nucleotides with an analog, intemucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotri esters, phosphoamidates, cabamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, ply-L-lysine, etc.), those with intercalators (e.g., acridine, psoralen, etc.), those containing chelators (e.g., metals, radioactive metals, boron, oxidative metals, etc ), those containing alkylators, those with modified linkages (e.g., alpha anomeric nucleic acids, etc ), as well as unmodified forms of 2026205205 01 Jul 2026 the polynucleotide(s). Further, any of the hydroxyl groups ordinarily present in the sugars can be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or can be conjugated to solid supports. The 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms. Other hydroxyls can also be derivatized to standard protecting groups. Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-O-methyl-, 2'-O-allyl, 2'-fluoro- or 2’-azido-ribose, carbocyclic sugar analogs, alpha-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and abasic nucleoside analogs such as methyl riboside. One or more phosphodiester linkages can be replaced by alternative linking groups. These alternative linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(O)S (“thioate”), P(S)S (“dithioate”), “(O)NR2 (“amidate”), P(O)R, P(O)OR', CO or CH2 (“formacetal”), in which each R or R1 is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-0--) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA. 100911 The term “vector” means a construct, which is capable of delivering, and optionally expressing, one or more gene(s) or sequence(s) of interest in a host cell. Examples of vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells. 100921 A polypeptide, antibody, polynucleotide, vector, cell, or composition which is “isolated” is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature. Isolated polypeptides, antibodies, polynucleotides, vectors, cell or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature. In some embodiments, an antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
[0093] As used herein, “substantially pure” refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure. 2026205205 01 Jul 2026
[0094] The terms “identical” or “percent identity” in the context of two or more nucleic acids or polypeptides, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity. The percent identity can be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software are known in the art that can be used to obtain alignments of amino acid or nucleotide sequences. One such non-limiting example of a sequence alignment algorithm is the algorithm described in Karlin et al, Proc. Natl. Acad. Sci., 87:2264-2268 (1990), as modified in Karlin et al., Proc. Natl. Acad. Sci., 90:5873-5877 (1993), and incorporated into the NBLAST and XBLAST programs (Altschul et al., Nucleic Acids Res., 25:3389-3402 (1991)). In certain embodiments, Gapped BLAST can be used as described in Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997). BLAST-2, WU-BLAST-2 (Altschul et al., Methods in Enzymology, 266:460-480 (1996)), ALIGN, ALIGN-2 (Genentech, South San Francisco, California) or Megalign (DNASTAR) are additional publicly available software programs that can be used to align sequences. In certain embodiments, the percent identity between two nucleotide sequences is determined using the GAP program in GCG software (e.g., using a NWSgapdna CMP matrix and a gap weight of 40, 50, 60, 70, or 90 and a length weight of 1, 2, 3, 4, 5, or 6). In certain alternative embodiments, the GAP program in the GCG software package, which incorporates the algorithm of Needleman and Wunsch (J. Mol. Biol. (48):444-453 (1970)) can be used to determine the percent identity between two amino acid sequences (e.g., using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5). Alternatively, in certain embodiments, the percent identity between nucleotide or amino acid sequences is determined using the algorithm of Myers and Miller (CABIOS, 4:11-17 (1989)). For example, the percent identity can be determined using the ALIGN program (version 2.0) and using a PAM 120 with residue table, a gap length penalty of 12 and a gap penalty of 4. Appropriate parameters for maximal alignment by particular alignment software can be determined by one skilled in the art. In certain embodiments, the default parameters of the alignment software are used. In certain embodiments, the percentage identity “X” of a first amino acid sequence to a second sequence amino acid is calculated as 100 x (Y / Z), where Y is the number of amino acid residues scored as identical matches in the alignment of the first and second sequences (as aligned by visual inspection or a particular sequence alignment program) and Z is the total 2026205205 01 Jul 2026 number of residues in the second sequence. If the length of a first sequence is longer than the second sequence, the percent identity of the first sequence to the second sequence will be longer than the percent identity of the second sequence to the first sequence.
[0095] As a non-limiting example, whether any particular polynucleotide has a certain percentage “sequence identity’’ (e.g., is at least 80% identical, at least 85% identical, at least 90% identical, and in some embodiments, at least 95%, 96%, 97%, 98%, or 99% identical) to a reference sequence can, in certain embodiments, be determined using the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 53711). Bestfit uses the local homology algorithm of Smith and Waterman (Advances in Applied Mathematics 2: 482 489 (1981)) to find the best segment of homology between two sequences. When using Bestfit or any other sequence alignment program to determine whether a particular sequence is, for instance, 95% identical to a reference sequence according to the present disclosure, the parameters are set such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed. 100961 A “conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (eg., lysine, arginine, histidine), acidic side chains (eg., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). For example, substitution of a phenylalanine for a tyrosine is a conservative substitution. In some embodiments, conservative substitutions in the sequences of the polypeptides and antibodies of the disclosure do not abrogate the binding of the polypeptide or antibody containing the amino acid sequence, to the antigen(s), i e., the FRa to which the polypeptide or antibody binds. Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well- known in the art (see, e.g., Brummell et al., Biochem. 32: 1180-1 187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:.412-417 (1997)).
[0097] “Bispecific antibodies' refer to antibodies that bind to two different epitopes. The epitopes can be on the same target antigen or can be on different target antigens. 2026205205 01 Jul 2026
[0098] “Biparatopic antibodies” are bispecific antibodies that bind to two different non-overlapping epitopes on the same target antigen (e g., FRa). 100991 In some embodiments, the FRa antibodies or antigen binding fragments thereof disclosed herein are multivalent molecules. The term “valent” as used within the current application denotes the presence of a specified number of binding sites in an antibody molecule. A natural antibody for example or a full length antibody according to the invention has two binding sites and is “bivalent.” The term “tetravalent,” denotes the presence of four binding sites in an antigen binding protein. The term “trivalenf ’ denotes the presence of three binding sites in an antibody molecule. The term “bispecific, tetravalent,” as used herein denotes an antigen binding protein according to the invention that has four antigen-binding sites of which at least one binds to a first antigen and at least one binds to a second antigen or another epitope of the antigen.
[00100] The term “immunoconjugate” or “conjugate” as used herein refers to a compound or a derivative thereof that is linked to a cell binding agent and is defined by a generic formula: C-L-A, wherein C = cytotoxin, L = linker, and A = antibody or antigenbinding fragment there of (eg., an anti-FRa antibody or antibody fragment). Immunoconjugates can also be defined by the generic formula in reverse order: A-L-C. 100101] A “linker” is any chemical moiety that is capable of linking a compound, usually a drug, such as maytansinoid, to a cell-binding agent such as an anti-FRa antibody or antigenbinding fragment thereof in a stable, covalent manner. Linkers can be susceptible to or be substantially resistant to cleavage (e g., acid-induced cleavage, light-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, or disulfide bond cleavage) at conditions under which the compound or the antibody remains active. Suitable linkers are well known in the art and include, for example, disulfide groups and thioether groups. 100102] As used herein, the term “cytotoxic agent” refers to a substance that inhibits or prevents one or more cellular functions and / or causes cell death. In some embodiments, the cytotoxic agent is a maytansinoid, e.g., DM21. Immunoconjugates comprising DM21 are disclosed in WO 2018 / 160539 Al, which is herein incorporated by reference in its entirety. 100103| An immunoconjugate can comprise the site-specific DM21 linkage of "DM21C" represented by the following structural formula: wherein Di is: 2026205205 01 Jul 2026 |00104| An immunoconjugate can also comprise the lysine-linked DM21 "L-DM21," "DM21-L" or "DM21L," which are represented by the following structural formula: coupled to an antibody by a linker, e.g., a y-maleimidobutyric acid N-succinimidyl ester (GMBS) or a N-(y-maleimidobutryloxy)sulfosuccinimide ester (sulfo-GMBS or sGMBS) linker The GMBS and sulfo-GMBS (or sGMBS) linkers are known in the art and can be presented by the following structural formula: O GMBS 100105] “Optional” or “optionally” means that the subsequently described circumstance may or may not occur, so that the application includes instances where the circumstance occurs and instances where it does not. For example, the phrase “optionally substituted” means that a nonhydrogen substituent may or may not be present on a given atom, and, thus, the application includes structures wherein a non-hydrogen substituent is present and structures wherein a nonhydrogen substituent is not present. 2026205205 01 Jul 2026
[00106] The terms “cancer” and “cancerous” refer to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include fallopian tube cancer, squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancers. The cancer can be a cancer that expresses FRa (“FRa-expressing cancer”). |00107] The terms “cancer cell,” “tumor cell,” and grammatical equivalents refer to the total population of cells derived from a tumor or a pre-cancerous lesion, including both non-tumorigenic cells, which comprise the bulk of the tumor cell population, and tumorigenic stem cells (cancer stem cells). As used herein, the term “tumor cell” will be modified by the term “non-tumorigenic” when referring solely to those tumor cells lacking the capacity to renew and differentiate to distinguish those tumor cells from cancer stem cells. 100108] An “advanced” cancer is one which has spread outside the site or organ of origin, either by local invasion or metastasis. The term “advanced” cancer includes both locally advanced and metastatic disease 1001091 “Metastatic” cancer refers to cancer that has spread from one part of the body ) to another part of the body. 100110] A “refractory” cancer is one that progresses even though an anti-tumor treatment, such as a chemotherapy, is administered to the cancer patient. 100111] A “recurrent” cancer is one that has regrown, either at the initial site or at a distant site, after a response to initial therapy. 100112] A “relapsed” patient is one who has signs or symptoms of cancer after remission. Optionally, the patient has relapsed after adjuvant or neoadjuvant therapy. 100113] The term “maintenance therapy” refers to therapy that is given to help keep cancer from coming back after it has disappeared following the initial therapy. 100114] The term “subject” refers to any animal (e.g., a mammal), including, but not limited to humans, non-human primates, rodents, and the like, which is to be the recipient of 2026205205 01 Jul 2026 a particular treatment. Typically, the terms “subject” and “patient” are used interchangeably herein in reference to a human subject. 100115| The term “pharmaceutical formulation” refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. The formulation can be sterile.
[00116] An “effective amount” of an antibody, immunoconjugate, or other drug as disclosed herein is an amount sufficient to carry out a specifically stated purpose.
[00117] The term “therapeutically effective amount” refers to an amount of an antibody, immunoconjugate, or other drug effective to “treat” a disease or disorder in a subject or mammal. In the case of cancer, the therapeutically effective amount of the drug can reduce the number of cancer cells; reduce the tumor size or burden; inhibit (i.e., slow to some extent and in a certain embodiment, stop) cancer cell infiltration into peripheral organs, inhibit (i.e., slow to some extent and in a certain embodiment, stop) tumor metastasis; inhibit, to some extent, tumor growth; relieve to some extent one or more of the symptoms associated with the cancer; and / or result in a favorable response such as increased progression-free survival (PFS), disease-free survival (DFS), or overall survival (OS), complete response (CR), partial response (PR), or, in some cases, stable disease (SD), a decrease in progressive disease (PD), a reduced time to progression (TTP), or any combination thereof. See the definition herein of “treating”. To the extent the drug can prevent growth and / or kill existing cancer cells, it can be cytostatic and / or cytotoxic. 100118] Terms such as “treating” or “treatment” or “to treat” or “alleviating” or “to alleviate” refer to therapeutic measures that cure, slow down, lessen symptoms of, and / or halt progression of a diagnosed pathologic condition or disorder. Thus, those in need of treatment include those already diagnosed with or suspected of having the disorder. In certain embodiments, a subject is successfully “treated” for cancer according to the methods of the present disclosure if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in the tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibition of or an absence of tumor metastasis; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality, improvement in quality of life; reduction in tumorigenicity, tumorigenic frequency, or tumorigenic capacity, of a tumor; reduction in the number or frequency of cancer stem cells in a tumor; differentiation of tumorigenic cells to a 2026205205 01 Jul 2026 non-turnorigenic state, increased progression-free survival (PFS), disease-free survival (DFS), or overall survival (OS), complete response (CR), partial response (PR), stable disease (SD), a decrease in progressive disease (PD), a reduced time to progression (TTP), or any combination thereof. 100119| The terms “administer“■administering,” “administration,” and the like, as used herein, refer to methods that may be used to enable delivery of the immunoconjugate to the desired site of biological action. Administration techniques that can be employed with the agents and methods described herein are found in e.g., Goodman and Gilman, The Pharmacological Basis of Therapeutics, current ed ; Pergamon; and Remington’s, Pharmaceutical Sciences (current edition), Mack Publishing Co., Easton, Pa. In one aspect, immunoconjugate is administered intravenously. 1001201 The term “instructing” means providing directions for applicable therapy, medication, treatment, treatment regimens, and the like, by any means, for example, in writing, such as in the form of package inserts or other written promotional material. 1001211 The terms “pre-treat” and “pre-treatment” refer to therapeutic measures that occur prior to the administration of a therapeutic antibody, antigen-binding fragment thereof, or immunoconjugate. For example, as described in more detail herein, a steroid (e.g., corticosteroid) can be administered as a prophylactic within about a week, about five days, about three days, about two days, or about one day or 24 hours prior to the administration of an immunoconjugate. The steroid can also be administered prior to the immunoconjugate on the same day as the immunoconjugate. 100122] Unless specifically stated or obvious from context, as used herein, the term “about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about. 100123| The recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups The recitation of an embodiment for a variable or aspect herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
[00124] As used in the present disclosure and claims, the singular forms “a,” “an,” and “the” include plural forms unless the context clearly dictates otherwise. 100125] It is understood that wherever embodiments are described herein with the language “comprising,” otherwise analogous embodiments described in terms of “consisting 2026205205 01 Jul 2026 of’ and / or “consisting essentially of’ are also provided. In this disclosure, “comprises,” “comprising,” “containing” and “having” and the like can have the meaning ascribed to them in U.S. Patent law and can mean “ includes,” “including,” and the like; “consisting essentially of’ or “consists essentially” likewise has the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments 100126] Unless specifically stated or obvious from context, as used herein, the term “or” is understood to be inclusive. The term “and / or” as used in a phrase such as “A and / or B” herein is intended to include both “A and B,” “A or B,” “A,” and “B.” Likewise, the term “and / or” as used in a phrase such as “A, B, and / or C” is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone), and C (alone) 100127] Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein. TLBiparatopic Antibodies |00128| Provided herein are biparatopic anti-FRa antibodies and antigen-binding fragments thereof. These biparatopic antibodies and antigen-binding fragments thereof can comprise a first FRa-binding domain that binds to a first epitope of FRa and a second FRa-binding domain that binds to a second epitope of FRa. The first and the second epitopes of -FRa are non-overlapping epitopes. These biparatopic antibodies and antigen-binding fragments can contain additional FRa-binding domains. For example, a tetravalent biparatopic antibody or antigen-binding fragment can have two FRa-binding domains that bind to the first epitope and two FRa-binding domains that bind to the second epitope. Exemplary' biparatopic antibodies and antigen-binding fragments thereof are shown in FIG. 1. A. FRa-Binding Domains
[00129] Disclosed herein are FRa-binding domains that can be used to assemble biparatopic antibodies or antigen binding fragments thereof. A FRa-binding domain can comprise six complementarity determining regions (CDRs), i.e., a variable heavy chain (VH) CDR1, a VH CDR2, a VH CDR3, a variable light chain (VL) CDR1, a VL CDR2, and a VL CDR3. A FRa-binding domain can comprise a variable heavy chain (VH) and a variable light chain (VL). The VH and the VL can be separate polypeptides or can parts of the same polypeptide (e.g., in an scFv). 2026205205 01 Jul 2026
[00130] FRa antibodies and antigen binding fragments thereof are known in the art and have been disclosed, for example, in PCT Application Publication Nos. WO 2011 / 106528 Al; WO 2012 / 135675 A3; WO 2012 / 138749 Al; WO 2014 / 036495 A3; and WO 2015 / 031815 A2; each of which is herein incorporated by reference in its entirety. Additional FRa antibodies have been disclosed in US Patent Nos. 8,557,966 B2; 8,709,432 B2; 9,702,881 B2; and 9,637,547 B2; and U.S. Patent Application Publication No. US-20120282282 Al, each of which is herein incorporated by reference in its entirety. In addition, the FRa antibody huMovl9 (M9346A) is encoded by the plasmids deposited with the American Type Culture Collection (ATCC), located at 10801 University Boulevard, Manassas, VA 20110 on April 7, 2010 under the terms of the Budapest Treaty and having ATCC deposit nos. PTA-10772 and PTA-10774. As provided herein, an FRa-binding domain can be the FRa-binding domain (e g., the six CDRs or the VH and VL) of any of these antibodies or antigen-binding fragments thereof. [00131 ] By way of example, an FRa-binding domain can comprise the CDR sequences, the VH sequence, and / or the VL sequence of the huMovl9 antibody and / or the FR57 antibody. The CDR sequences of the huMovl9 and FR57 antibodies are provided in Tables 1 and 2 below. 100132] In some embodiments, an FRa-binding domain disclosed herein comprises one or more polypeptides comprising one or more of the CDR sequences described herein. For example, an FRa-binding domain can comprise one or more of the light chain CDR sequences (i e., LC CDR1, LC CDR2, and LC CDR3) and / or one or more of the heavy chain CDR sequences (i.e., HC CDR1, HC CDR2, and HC CDR3) shown below in Tables 1 and 2. Table 1: Light chain CDR sequences (by Rabat Definition) Antibody VL-CDR1 \L(DR2 VL-CDR3 FR57 RASQNINNNLH (SEQ ID NO;1) YVSQSVS (SEQ ID NO:2) QQSNSWPHYT (SEQ ID NO 3) huMov!9 KASQSVSFAGTSLMH (SEQ ID NO:4) RASNLEA (SEQ IDNO 5) QQSREYPYT (SEQ ID NO 6) Table 2: Heavy chain CDR sequences Antibody VH-CDR1 VH-CDR2 VH-CDR3 FR57 SFGMH (SEQ ID NO: 7) AbM Defined: GFTFSSFGMH Kabat Defined: YISSGSSTISYADSVKG (SEQ ID NO:8) AbM Defined: Kabat or AbM Defined: EAYGSSMEY (SEQ ID NO :9) 2026205205 01 Jul 2026 (SEQ ID NO: 13) YISSGSSTIS (SEQ ID NO: 14) huMovl9 Kabat Defined: GYFMN (SEQ ID NOTO) AbM Defined: GYTFTGYFMN (SEQ ID NO: 15) Kabat Defined: RIHPYDGDTFYNQKFQG (SEQ ID NO: 11) AbM Defined: RIHPYDGDTF (SEQ ID NO: 16) Kabat or AbM Defined: YDGSRAMDY (SEQ ID NO: 12) |00133| In some embodiments, an FRa-binding domain comprises (a) VL CDR1, VL CDR2, and VL CDR3 comprising the amino acid sequences of SEQ ID NOs: 1-3, respectively; and (b) VH CDR1, VH CDR2, and VH CDR3 comprising the amino acid sequences of SEQ ID NOs: 7-9, respectively. In some embodiments, an FRa-binding domain comprises (a) VL CDR1, VL CDR2, and VL CDR3 comprising the amino acid sequences of SEQ ID NOs: 1-3, respectively; and (b) VH CDR1, VH CDR2, and VH CDR3 comprising the amino acid sequences of SEQ ID NOs: 13, 14, and 9, respectively. In some embodiments, an FRa-binding domain comprises (a) VL CDR1, VL CDR2, and VL CDR3 comprising the amino acid sequences of SEQ ID NOs: 4-6, respectively and (b) VH CDR1, VH CDR2, and VH CDR3 comprising the amino acid sequences of SEQ ID NOs: 10-12, respectively. In some embodiments, an FRa-binding domain comprises (a) VL CDRI, VL CDR2, and VL CDR3 comprising the amino acid sequences of SEQ ID NOs: 4-6, respectively and (b) VH CDRI, VH CDR2, and VH CDR3 comprising the amino acid sequences of SEQ ID NOs: 15, 16, and 12, respectively. 100134] By way of example, an FRa-binding domain can comprise the CDR sequences, the VH sequence, and / or the VL sequence of the huMov!9 antibody and / or the FR57 antibody. The CDR sequences of huMovl9 and FR57 are provided in Tables 1 and 2 below. |00135] In some embodiments, an FRa-binding domain disclosed herein comprises one or more polypeptides comprising one or more of the CDR sequences described herein. For example, an FRa-binding domain can comprise one or more of the light chain CDR sequences (i e., LC CDRI, LC CDR2, and LC CDR3) and / or one or more of the heavy chain CDR sequences (i.e., HC CDRI, HC CDR2, and HC CDR3) shown below in Tables 1 and 2. |00136| In some embodiments, an FRa-binding domain comprises the light and / or heavy chain variable sequences of the huMovlQ antibody and / or the FR57 antibody. The light chain variable sequences and heavy chain variable sequences of huMovl9 and FR57 are provided in Tables 3 and 4 below. 2026205205 01 Jul 2026 Table 3* Light Chain Variable Sequence Antibody Sequence FR57 EIVLTQSPATLSVTPGDRVSLSCRASQNINNNLHWYQQKPGQSPRLLIKYV SQSVSGIPDRFSGSGSGTDFTLSISSVEPEDFGMYFCQQSNSWPHYTFGQG TKLEIK (SEQ ID NO: 17) FR57 F83E; Q101C EIVLTQSPATLSVTPGDRVSLSCRASQNINNNLHWYQQKPGQSPRLLIKYV SQSVSGIPDRFSGSGSGTDFTLSISSVEPEDEGMYFCQQSNSWPHYTFGCG TKLEIK (SEQ ID NO: 18) huMovl9 DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLL IYRASNLEAGVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTF GGGTKLEIK (SEQ ID NO :19) huMovl9 G104C DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLL IYRASNLEAGVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTF GCGTKLEIK (SEQ ID NO :20) huMovl9 A87E; G104C DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLL IYRASNLEAGVPDRFSGSGSKTDFTLTISPVEAEDEATYYCQQSREYPYTF GCGTKLEIK (SEQ ID NO 21) Table 4. Heavy Chain Variable Sequence Antibody Sequence FR57 EVQLVESGGGLVQPGGSRRLSCAASGFTFSSFGMHWVRQAPGKGLEWVA YIS SGSSTISY ADS VKGRFTISRDNSKKTLLLQMTSLRAEDT AMY YC AREA YGSSMEYWGQGTLVTVSS (SEQ ID NO:22) FR57 E6Q; G44C EVQLVQSGGGLVQPGGSRRLSCAASGFTFSSFGMHWVRQAPGKCLEWV AYISSGSSTISYADSVKGRFTISRDNSKKTLLLQMTSLRAEDTAMYYCARE AYGSSMEYWGQGTLVTVSS (SEQ ID NO 23) huMovl9 QVQLVQSGAEWKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEWIG RIHPYDGDTFYNQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRY DGSRAMDYWGQGTTVTVSS (SEQ IDNO:24) huMovl9 S44C QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQCLEWIG RIHPYDGDTFYNQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRY DGSRAMDY (SEQ ID NO:25) huMovl9 S44C QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQCLEWIG RIHPYDGDTFYNQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRY DGSRAMDYWGQGTTVTVSS (SEQ ID NO: 57) huMov!9 A16E; S44C QVQLVQSGAEVVKPGESVKISCKASGYTFTGYFMNWVKQSPGQCLEWIG RIHPYDGDTFYNQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRY DGSRAMDYWGQGTTVTVSS (SEQ IDNO:26) 100137| In some embodiments, an FRa-binding domain comprises a VL having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO: 17, optionally wherein the VL comprises VL CDR1, VL CDR2, and VL CDR3 sequences of SEQ ID NOs: 1-3, respectively In some embodiments, an FRa-binding domain comprises a VL having at least about 70%, at least 2026205205 01 Jul 2026 about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO: 19, optionally wherein the VL comprises VL CDR1, VL CDR2, and VL CDR3 sequences of SEQ ID NOs: 4-6, respectively. 100138| In some embodiments, an FRa-binding domain comprises a VH having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:22, optionally wherein the VH comprises VH CDR1, VH CDR2, and VH CDR3 sequences of SEQ ID NOs: 7-9, respectively or SEQ ID NOs: 13, 14, and 9, respectively. In some embodiments, an FRa-binding domain comprises a VH having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:24, optionally wherein the VH comprises VH CDR1, VH CDR2, and VH CDR3 sequences of SEQ ID NOs: 10-12, respectively or SEQ ID NOs: 15, 16, and 12, respectively.
[00139] In some embodiments, an FRa-binding domain comprises a VL and a VH, wherein (i) the VL has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO: 17, optionally wherein the VL comprises VL CDR1, VL CDR2, and VL CDR3 sequences of SEQ ID NOs: 1-3, respectively and (ii) the VH has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:22, optionally wherein the VH comprises VH CDR1, VH CDR2, and VH CDR3 sequences of SEQ ID NOs: 7-9, respectively or SEQ ID NOs: 13, 14, and 9, respectively. |00140| In some embodiments, an FRa-binding domain comprises a VL and a VH, wherein (i) the VL has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO: 19, optionally wherein the VL comprises VL CDR1, VL CDR2, and VL CDR3 sequences of SEQ ID NOs: 4-6, respectively and (ii) the VH has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID 2026205205 01 Jul 2026 NO:24, optionally wherein the VH comprises VH CDR1, VH CDR2, and VH CDR3 sequences of SEQ ID NOs: 10-12, respectively or SEQ ID NOs: 15, 16, and 12, respectively. |00141J In some embodiments, an FRa-binding domain comprises a VL and a VH. The VL and the VH can be separate polypeptides. The VL and the VH can also be parts of the same polypeptide, e.g., a polypeptide comprising a VL, a linker, and a VH. A polypeptide comprising a VL, a linker, and a VH can be in the orientation VL-linker-VH or the orientation VH-linker-VL. |00142] Accordingly, in some embodiments, an FRa-binding domain (e.g., scFv) comprises, from N- to C-terminus: a VL comprising the amino acid sequence of SEQ ID NO: 17, a linker (e.g., a glycine-serine linker), and a VH comprising the amino acid sequence of SEQ ID NO:22. In some embodiments, an FRa-binding domain comprises, from N to C terminus: a VH comprising the amino acid sequence of SEQ ID NO:22, a linker (e.g., a glycine-serine linker), and a VL comprising the amino acid sequence of SEQ ID NO: 17. |00143] In some embodiments, an FRa-binding domain (e.g., scFv) comprises, from N- to C-terminus: a VL comprising the amino acid sequence of SEQ ID NO: 19, a linker (e.g., a glycine-serine linker), and a VH comprising the amino acid sequence of SEQ ID NO:24. In some embodiments, an FRa-binding domain comprises, from N to C terminus: a VH comprising the amino acid sequence of SEQ ID NO:24, a linker (eg., a glycine-serine linker), and a VL comprising the amino acid sequence of SEQ ID NO: 19. 100144] Linkers that can be used to connect a VH and a VL are known in the art. For example, a linker can be a glycine-serine linker. In some embodiments, the linker can be of any length and can comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, I I, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 50, or 60 or more amino acids. In other embodiments, a linker useful for the present disclosure has at least one amino acid and less than 100 amino acids, less than 90 amino acids, less than 80 amino acids, less than 70 amino acids, less than 60 amino acids, less than 50 amino acids, less than 40 amino acids, less than 30 amino acids, less than 20 amino acids, less than 19 amino acids, less than 18 amino acids, less than 17 amino acids, less than 16 amino acids, less than 15 amino acids, less than 14 amino acids, less than 13 amino acids, or less than 12 amino acids. In one embodiment, the linker sequence comprises glycine amino acid residues. In other instances, the linker sequence comprises a combination of glycine and serine amino acid residues. |00145] In some embodiments, a FRa-binding domain comprises a linker fused in frame between the VH and the VL. In some embodiments, such glycine / serine linkers comprises any combination of the amino acid residues, including, but not limited to, the peptide GGGS 2026205205 01 Jul 2026 (SEQ ID NO:49) or GGGGS (SEQ ID NO:50) or repeats of the same, including 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more repeats of these given peptides. The glycine / serine linkers disclosed herein comprises an amino acid sequence of (GS)n, (GGS)n, (GGGS)n, (GGGGS)n, or (GGGGS)n, wherein n is an integer of 1,2, 3, 4, 5, 6, 7, 8, 9, or 10. In one embodiment, the linker sequence is GGGGSGGGGSGGGGS (SEQ IDN0:51) (also noted as (Gly4Ser)3). In another embodiment, the linker sequence is GGGGSGGGGSGGGGSGGGGS (SEQ ID NO:52) (also noted as (Gly4Ser)4).
[00146] In some embodiments, an FRa-binding domain is an scFv. Exemplary scFv FRa-binding domains are provided in Table 5 below. Table 5. scFv Fusion Proteins Name scFv Sequences FR57scFvl scFv in VH-(G4S)4-VL orientation EVQLVESGGGLVQPGGSRRLSCAASGFTFSSFGMHWVRQAPGKGLEW VAYISSGSSTISYADSVKGRFTISRDNSKKTLLLQMTSLRAEDTAMYYC AREAYGSSMEYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSEIVLT QSPATLSVTPGDRVSLSCRASQNINNNLHWYQQKPGQSPRLLIKYVSQ SVSGIPDRFSGSGSGTDFTLSISSVEPEDFGMYFCQQSNSWPHYTFGQG TKLEIK (SEQ IDNO 27) FR57scFv2 scFv in VL (F83E; Q101C)-(G4S)4- VH (E6Q; G44C) orientation EIVLTQSPATLSVTPGDRVSLSCRASQNINNNLHWYQQKPGQSPRLLIK YVSQSVSGIPDRFSGSGSGTDFTLSISSVEPEDEGMYFCQQSNSWPHYT FGCGTKLEIKGGGGSGGGGSGGGGSGGGGSEVQLVQSGGGLVQPGGS RRLSCAASGFTFSSFGMHWVRQAPGKCLEWVAYISSGSSTISYADSVK GRFTISRDNSKKTLLLQMTSLRAEDTAMYYCAREAYGSSMEYWGQGT LVTVSS (SEQ ID NO:28) FR57scFv3wt scFv in VL-(G4S)4-VH orientation EIVLTQSPATLSVTPGDRVSLSCRASQNINNNLHWYQQKPGQSPRLLIK YVSQSVSGIPDRFSGSGSGTDFTLSISSVEPEDFGMYFCQQSNSWPHYTF GQGTKLEIKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSR RLSCAASGFTFSSFGMHWVRQAPGKGLEWVAYISSGSSTISYADSVKG RFTISRDNSKKTLLLQMTSLRAEDTAMYYCAREAYGSSMEYWGQGTL VTVSS (SEQ ID NO:29) Movl9scFvl scFv in VH-(G4S)4-VL orientation QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEW IGRIHPYDGDTFYNQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYY CTRYDGSRAMDYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDIV LTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLI YRASNLEAGVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYT FGGGTKLEIK (SEQ ID NO:30) Movl9scFv2 scFv in VL (G104C)-(G4S)4-VH (S44C) orientation DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPR LLIYRASNLEAGVPDRF SGSGSKTDFTLTISPVEAEDAAT YYCQQ SREY PYTFGCGTKLEIKGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVVKP GASVKISCKASGYTFTGYFMNWVKQSPGQCLEWIGRIHPYDGDTFYN QKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDY WGQGTTVTVSS (SEQ ID NO31) 2026205205 01 Jul 2026 Movl9scFv3 scFv in VL (A87E; G104C)-(G4S)4- VH(A16E; S44C) orientation DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPR LLIYRASNLEAGVPDRFSGSGSKTDFTLTISPVEAEDEATYYCQQSREY PYTFGCGTKLEIKGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVVKP GESVKISCKASGYTFTGYFMNWVKQSPGQCLEWIGRIHPYDGDTFYN QKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDY WGQGTTVTVSS (SEQ ID NO 32)
[00147] In some embodiments, an FRa-binding domain comprises a scFv comprising an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90? / o, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:27, 28, or 29, optionally wherein the scFv comprises VL CDR1, VL CDR2, and VL CDR3 sequences of SEQ ID NOs: 1-3, respectively and VH CDR1, VH CDR2, and VH CDR3 sequences of SEQ ID NOs: 7-9, respectively or SEQ ID NOs: 13, 14, and 9, respectively.
[00148] In some embodiments, an FRa-binding domain comprises a scFv comprising an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to SEQ ID NO:30, 31, or 32, optionally wherein the scFv comprises VL CDR1, VL CDR2, and VL CDR3 sequences of SEQ ID NOs: 4-6, respectively and VH CDR1, VH CDR2, and VH CDR3 sequences of SEQ ID NOs: 10-12, respectively or SEQ ID NOs: 15, 16, and 12, respectively. |00149| In certain embodiments, a FRa-binding domain binds to the same epitope of FRa as an antibody comprising the amino acid sequences of SEQ ID NO: 17 and SEQ ID NO:22. |00150| In certain embodiments, a FRa-binding domain binds to the same epitope of FRa as an antibody comprising the amino acid sequences of SEQ ID NO:19 and SEQ ID NO:24.
[00151] In certain embodiments, a FRa-binding domain is a murine, chimeric, or humanized FRa-binding domain. As used herein, a humanized FRa-binding domain can be a resurfaced FRa-binding domain. 100152] In certain embodiments, a FRa-binding domain binds to human FRa but not FOLR2 or FOLR3. B. Biparatopic Antibody Formats 2026205205 01 Jul 2026
[00153] The biparatopic anti-FRa antibodies or antigen binding fragments thereof can comprise a combination of the FRa-binding domains discussed above, wherein the FRa-binding domains bind to non-overlapping epitopes of FRa.
[00154] Many different types of bispecific constructs are known in the art and can be used in the biaparatopic anti-FRa antibodies or antigen binding fragments thereof provided herein. |00155] Early attempts at bispecific antibody construction either utilized chemical crosslinking or hybrid hybridomas or quadromas to join the two halves of two different antibodies together. Although these techniques work to make bispecific antibodies, they are associated with production problems, such as the production of mixed populations containing different combinations of antigen-binding sites, difficulty in protein expression, the need to purify the bispecific antibody of interest, low yields, expense of production, etc. |00156| More recent approaches have utilized genetically engineered constructs that are capable of producing homogeneous products of single bispecific antibodies, without the need for extensive purification to remove unwanted byproducts. Such constructs have included tandem scFv, diabodies, tandem diabodies, dual variable domain antibodies and heterodimerization using a motif such as Chl / Ck domain or DNL- (Chames & Baty, 2009, Curr Opin Drug Discov Devel 12:276-83; Chames & Baty, mAbs 1:539-47). BITE8 refers to tandem scFvs that are joined by a short peptide linker (Chames & Baty, mAbs 1:539-47). Other approaches to bispecific antibody production have included tetravalent IgG-scFv fusions (Dong et al., 2011, MAbs 3:273-88); dual-acting Fab (DAF) antibodies (Bostrom et al., 2009, Science 323:1610-14); Igg-like dual-variable domain antibodies (DVD-Ig) (Wu et al., 2007, Nat Biotechnol 25:1290-97); and use of dynamic exchange between IgG4 molecules (van derNeut Kolfschoten et al., 2007, Science 317:1554-57). |00157] DOCK-AND-LOCK® (DNL®) complex (see, e.g„ U.S. Pat. Nos. 7,521,056; 7,527,787, 7,534,866; 7,550,143; 7,666,400; 7,901,680; 7,906,118, 7,981,398, 8,003,111) represent another bi specific antibody format. Although the standard DNL"’ complex comprises a trimer with two DDD-linked molecules attached to one AD-linked molecule, variations in complex structure allow the formation of dimers, trimers, tetramers, pentamers, hexamers and other multimers. |00158| In some embodiments, disclosed herein are biparatopic constructs with asymmetric-Fc molecules, including in “knob-in-hole” structures. See Kontermann, MAbs., 4(2):182-97 (2012). Knobs-into-holes (KIHs) technology involves engineering Ch3 domains to create either a “knob” or a “hole” in each heavy chain to promote heterodimerization. KIH technology is described, for instance, in Ridgway et al., Protein Engineering 9(7):617-721 2026205205 01 Jul 2026 (1996); US 5,731,168; US 5,807,706; US 5,821,333, each of which is herein incorporated by reference in its entirety. The "CrossMab" technique further involves the exchange of heavy and light chain domains within the Fab of one half of the bispecific antibody, making the two arms so different that light-heavy chain mispairing cannot occur (Schaefer et al., 2011, Proc Natl. Acad Sci USA 108:11187-92). The knobs-into-holes approach introduces amino acids with bulky side chains into the CH3 domain of one heavy chain that fit into appropriately designed cavities in the CH3 domain of the other heavy chain. The combination of approaches prevents mismatch of both heavy chain to heavy chain and heavy chain to light chain interactions, resulting in primarily a single product. |00159| In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof is bivalent (see e.g., the “knob in hole” example shown in FIG. 1). A bivalent biparatopic anti-FRa antibody or antigen binding fragment thereof can comprise, for example, two FRa-binding domains comprising scFvs, two FRa-binding domains comprising VHs and VLs on separate polypeptide chains, or one FRa-binding domain comprising an scFv and one FRa-binding domain that comprises a VH and a VL on separate polypeptide chains. |00160| In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof is trivalent. |00161] In some embodiments, a biparatopic anti-FRa antibody or antigen-binding fragment thereof is tetravalent (see e.g., the “Morrison” example shown in FIG. 1). Tetravalent antibodies and are described, for instance, in M.J Coloma, S L Morrison, Nat. Biotechnol., 15(2):159-63 (1997), which is herein incorporated by reference in its entirety. |00162] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises an FRa-binding domain that is an scFv. In some embodiments, a biparatopic anti-FRa antibody or antigen-binding fragment thereof comprises an FRa-binding domain that comprises a VH and a VL on separate polypeptides. In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises an FRa-binding domain that is an scFv and an FRa-binding domain that comprises a VH and a VL on separate polypeptides. |00163] In some embodiments, a bivalent biaparatopic anti-FRa antibody or antigen binding fragment thereof comprises a single FRa-binding domain that is an scFv and a single FRa-binding domain that comprises a VH and a VL on separate polypeptides. In such embodiments, the scFv can be fused to a heavy chain constant region and the VH can be fused to a heavy chain constant region. In some embodiments, the constant regions have 2026205205 01 Jul 2026 ‘‘knob and hole” sequences. The “knob” sequence can be in the heavy chain constant region fused to the scFv, and the “hole” sequence can be fused to the constant region fused to the VH. Alternatively the “hole” mutation can be in the heavy chain constant region fused to the scFv, and the “knob” sequence can be fused to the constant region fused to the VH. Sequences of exemplary biparatopic anti-FRa antibodies or antigen binding fragments thereof of such formats are found in Table 7. |00164] In some embodiments, a tetravalent biparatopic anti-FRa antibody or antigen binding fragment thereof comprises two FRa-binding domains that are scFvs and two FRa-binding domains that comprises VHs and VLs on separate polypeptides. In such embodiments, the scFvs can be fused to the N- or C- terminal of the polypeptide comprising the VH. The scFvs can also be fused to the N- or C- terminal of the polypeptide comprising the VL.
[00165] A tetravalent bi paratopic anti-FRa antibody or antigen binding fragment thereof can comprise two polypeptides wherein the first polypeptide comprises a heavy chain constant region, a VH, and an scFv and the second polypeptide comprises a light chain constant region and a VL. A tetravalent biparatopic anti-FRa antibody or antigen binding fragment thereof can also comprise two polypeptides wherein the first polypeptide comprises a heavy chain constant region and a VH and the second polypeptide comprises a light chain constant region, a VL, and an scFv. Sequences of exemplary biparatopic anti-FRa antibodies or antigen binding fragments thereof of such formats are found in Table 6.
[00166] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof is a bi specific heterodimeric diabody, e.g., a tetrameric bispecific heterodimeric diabody. As used herein, the term “bispecific heterodimeric diabody” refers to a complex of two or more polypeptide chains or proteins, and each can comprise at least one antibody VI. and one antibody VH domain, and wherein the VL and VH domains in each polypeptide chain are from different antibodies.
[00167] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof disclosed herein comprise one or more resurfaced FRa-binding domains. In some embodiments, all of the FRa-binding domains in a biparatopic antibody or antigen binding fragment thereof are resurfaced. |00168| In some embodiments, the biparatopic antibodies or antigen-binding fragments thereof are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non-human species (e.g. mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and capability (“CDR grafted”) 2026205205 01 Jul 2026 (Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science 239:1534-1536 (1988)). 100169| In a further embodiment, the biparatopic antibodies or antigen-binding fragments thereof are a CDR-grafted or resurfaced antibody comprising at least one heavy chain variable region and at least one light chain variable region, wherein said heavy chain variable region comprises three complementarity-determining regions having amino acid sequences represented by SEQ ID NOs:7-9, respectively, and wherein said light chain variable region comprises three complementarity-determining regions having amino acid sequences represented by SEQ ID NOs: 1-3, respectively. 100170] In a further embodiment, the biparatopic antibodies or antigen-binding fragments thereof are a CDR-grafted or resurfaced antibody comprising at least one heavy chain variable region and at least one light chain variable region, wherein said heavy chain variable region comprises three complementarity-determining regions having amino acid sequences represented by SEQ ID NOs: 13, 14, and 9, respectively, and wherein said light chain variable region comprises three complementarity-determining regions having amino acid sequences represented by SEQ ID NOs: 1-3, respectively. 100171] In a further embodiment, the biparatopic antibodies or antigen-binding fragments thereof are a CDR-grafted or resurfaced antibody comprising at least one heavy chain variable region and at least one light chain variable region, wherein said heavy chain variable region comprises three complementarity-determining regions having amino acid sequences represented by SEQ ID NOs: 10-12, respectively, and wherein said light chain variable region comprises three complementarity-determining regions having amino acid sequences represented by SEQ ID NOs:4-6, respectively. 100172] In a further embodiment, the biparatopic antibodies or antigen-binding fragments thereof are a CDR-grafted or resurfaced antibody comprising at least one heavy chain variable region and at least one light chain variable region, wherein said heavy chain variable region comprises three complementarity-determining regions having amino acid sequences represented by SEQ ID NOs: 15, 16, and 12, respectively, and wherein said light chain variable region comprises three complementarity-determining regions having amino acid sequences represented by SEQ ID NOs;4-6, respectively. 100173] In a further embodiment, antibodies or antigen-binding fragments are provided having a humanized (e.g., resurfaced, CDR-grafted) heavy chain variable region that shares at least 90% sequence identity with an amino acid sequence corresponding to SEQ ID NOs:22-26, more preferably 95% sequence identity with SEQ ID NOs:22-26, most preferably 100% 2026205205 01 Jul 2026 sequence identity with SEQ ID NOs:22-26. In particular embodiments, the antibody includes conservative mutations in the framework region outside of the CDRs. 100174| Similarly, antibodies are provided having a humanized (eg., resurfaced, CDR-grafted) light chain variable region that shares at least 90% sequence identity with an amino acid sequence corresponding to SEQ ID NOs: 17-21, more preferably 95% sequence identity with SEQ ID NOs: 17-21, most preferably 100% sequence identity with SEQ ID NOs: 17-21. In particular embodiments, the antibody includes conservative mutations in the framework region outside of the CDRs.
[00175] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises a heavy chain constant region, such as an IgGl, IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD constant region. In some embodiments, the heavy chain constant region is an IgGl heavy chain constant region or an IgG4 heavy chain constant region. Furthennore, in some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof can comprise a light chain constant region, either a kappa light chain constant region or a lambda light chain constant region. In some embodiments, the light chain constant region is a kappa light chain constant region. |00176| In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises a first FRa-binding domain comprising VL and VH sequences selected from the group consisting of SEQ ID NOs: 19 and 24; 20 and 25; and 21 and 26, respectively) and a second FRa-binding domain that does not compete with huMovl9 for binding to FRa. In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises a first FRa-binding domain comprising VL and VH sequences of SEQ ID NOs:20 and 57, respectively) and a second FRa-binding domain that does not compete with huMov!9 for binding to FRa. 100177] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises a first FRa-binding domain comprising the VL and VH sequences selected from the group consisting of SEQ ID NOs: 17 and 22; and 18 and 23, respectively) and a second FRa-binding domain that does not compete with FR57 for binding to FRa. |00178] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises a FRa-binding domain that competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:22 and a VL amino acid sequence of SEQ ID NO: 17 2026205205 01 Jul 2026
[00179] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises a FRa-binding domain that competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:24 and a VL amino acid sequence of SEQ ID NO: 19. 1001801 In some embodiments, a bi paratopic anti-FRa antibody or antigen binding fragment thereof comprises (i) a first FRa-binding domain that competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:22 and a VL amino acid sequence of SEQ ID NO: 17 and (ii) a second FRa-binding domain that competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:24 and a VL amino acid sequence of SEQ ID NO :19. |00181] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises a FRa-binding domain that binds to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:22 and a VL amino acid sequence of SEQ ID NO: 17.
[00182] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises a FRa-binding domain that binds to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO 24 and a VL amino acid sequence of SEQ ID NO: 19. 100183] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises (i) a first FRa-binding domain that binds to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:22 and a VL amino acid sequence of SEQ ID NO: 17 and (ii) a second FRa-binding domain that binds to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:24 and a VL amino acid sequence of SEQ ID NO: 19. ]00184] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 19 and / or 24, respectively). |00185] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 19 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the 2026205205 01 Jul 2026 disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g, SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (eg, SEQ ID NOs: 19 and / or 57, respectively).
[00186] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg, SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 19 and / or 26, respectively). |00187] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 24, respectively). |00188| In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g, SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e g., SEQ ID NOs: 20 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (eg, SEQ ID NOs: 20 and / or 57, respectively). 100189] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 26, respectively). |00190| In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg, SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 24, respectively). |0019l] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg, SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ 2026205205 01 Jul 2026 ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e g., SEQ ID NOs: 21 and / or 57, respectively). 100192] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 26, respectively).
[00193] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huM0V19 (e.g., SEQ ID NOs: 19 and / or 24, respectively). |00194| In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e g., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 19 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (eg., SEQ ID NOs: 19 and / or 57, respectively)
[00195] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 19 and / or 26, respectively).
[00196] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 24, respectively). |00197| In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 57, respectively). 2026205205 01 Jul 2026 [00198| In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e g., SEQ ID NOs: 20 and / or 26, respectively). 100199] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 24, respectively). |00200| In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e g., SEQ ID NOs: 21 and / or 57, respectively) 100201] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 26, respectively). |00202] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 19 and / or 24, respectively). |00203] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (eg., SEQ ID NOs: 19 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 17 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 57, respectively).
[00204] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of 2026205205 01 Jul 2026 FR57 (e.g, SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g, SEQ ID NOs: 19 and / or 26, respectively). 100205] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 24, respectively).
[00206] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e g., SEQ ID NOs: 20 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 57, respectively). 100207] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 26, respectively).
[00208] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g, SEQ ID NOs: 21 and / or 24, respectively). |00209| In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg, SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g, SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e g, SEQ ID NOs: 21 and / or 57, respectively). |00210| In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg, SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huM0V19 (e.g, SEQ ID NOs: 21 and / or 26, respectively). 2026205205 01 Jul 2026
[00211] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e g., SEQ ID NOs: 19 and / or 24, respectively). 100212] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 19 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 22, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 57, respectively). |00213] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOVI9 (e g., SEQ ID NOs: 19 and / or 26, respectively). 100214] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 24, respectively). |00215| In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 20 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e g., SEQ ID NOs: 20 and / or 57, respectively) 100216] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (eg., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huM0V19 (e.g., SEQ ID NOs: 20 and / or 26, respectively). |00217] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of 2026205205 01 Jul 2026 FR57 (eg., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 24, respectively). 100218] In some embodiments, the bi paratopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (eg., SEQ ID NOs: 21 and / or 25, respectively). In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e.g., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 57, respectively). |00219| In some embodiments, the biparatopic antibodies or antigen binding fragments thereof of the disclosure comprise the variable light chain and / or variable heavy chain of FR57 (e g., SEQ ID NOs: 18 and / or 23, respectively) and the variable light chain and / or variable heavy chain of huMOV19 (e.g., SEQ ID NOs: 21 and / or 26, respectively). 1002201 In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises (i) an scFv that binds to the same epitope as FR57 and (ii) an scFv that binds to the same epitope as huMovl9. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO 27 and SEQ ID NO:30. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27 and SEQ ID NO 31. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27 and SEQ IDNO 32. |00221] In some embodiments, the anti-FRa biparatopic antibodies or antigen binding fragments thereof comprise SEQ ID NO:28 and SEQ ID NO:30. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28 and SEQ ID NO:3 1. In some embodiments, the anti-FRa biparatopic antibodies or antigen binding fragments thereof comprise SEQ ID NO:28 and SEQ ID NO:32.
[00222] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29 and SEQ ID NO:30. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29 and SEQ ID NO:31. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29 and SEQ ID NO:32. 100223] It is to be understood that the VH and VL sequences for SEQ ID NOs: 27-32 could be arranged in a different order. For example, the N-terminus to C-terminus orientation 2026205205 01 Jul 2026 as recited in SEQ ID NO27 is VH-(G4S)4-VL. However, disclosed herein are scFv polypeptide sequences in which orientations in which the VH and VL sequences are exchanged around the glycine-serine linker (e.g., VL-(G4S)4-VH).
[00224] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO: 19, and SEQ ID NO:24 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO: 19, and SEQ ID NO:25. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO: 19, and SEQ ID NO:57. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO: 19, and SEQ ID NO 26. |00225| In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO:20, and SEQ ID NO:24 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO:20, and SEQ ID NO:25. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO 27, SEQ ID NO:20, and SEQ ID NO:57 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO:20, and SEQ ID NO:26. 100226) In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises (i) an scFv that binds to the same epitope as FR57 and (ii) an FRa-binding domain comprising a VH and VL on separate polypeptides that binds to the same epitope as huMov!9. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO:21, and SEQ ID NO:24. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO:21, and SEQ ID NO:25 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:27, SEQ ID NO:21, and SEQ ID NO57 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO;27, SEQ IDN0:21, and SEQ ID NO26. 100227) In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO: 19, and SEQ ID NO:24 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO: 19, and SEQ ID NO:25. In some embodiments, the 2026205205 01 Jul 2026 biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO: 19, and SEQ ID NO:57. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO 19, and SEQ ID NO 26. 100228] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO:20, and SEQ ID NO:24. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO:20, and SEQ ID NO:25. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO:20, and SEQ ID NO:57. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO 20, and SEQ ID NO:26. |00229] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO;28, SEQ ID NO;21, and SEQ ID NO:24. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO:21, and SEQ ID NO:25. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO:21, and SEQ ID NO:57. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:28, SEQ ID NO:21,and SEQ IDNO 26. 100230] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO: 19, and SEQ ID NO:24 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO: 19, and SEQ ID NO:25. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO: 19, and SEQ ID NO:57. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO: 19, and SEQ ID NO 26 |00231] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NQ;20, and SEQ ID NO:24 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO:20, and SEQ ID NO:25. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO:20, and SEQ ID NO:57. In some embodiments, the biparatopic anti- 2026205205 01 Jul 2026 FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO:20, and SEQ ID NO:26. 100232] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO :21, and SEQ ID NO:24 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO:21, and SEQ ID NO:25. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO:21, and SEQ ID NO:57. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:29, SEQ ID NO:21,and SEQ ID NO 26.
[00233] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises (i) an scFv that binds to the same epitope as huMov!9 and (ii) an FRa-binding domain comprising a VH and VL on separate polypeptides that binds to the same epitope as FR57. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:30, SEQ ID NO: I 7, and SEQ ID NO 22. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:30, SEQ ID NO: 17, and SEQ ID NO:23. |00234| In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:30, SEQ ID NO: 18, and SEQ ID NO:22 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO 30, SEQ ID NO: 18, and SEQ ID NO 23 100235] In some embodiments, a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises (i) an scFv that binds to the same epitope as huMovl9 and (ii) an FRa-binding domain comprising a VH and VL on separate polypeptides that binds to the same epitope as FR57. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:3 1, SEQ ID NO: 18, and SEQ ID NO 22. In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:31, SEQ ID NO: 18, and SEQ ID NO 23
[00236] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO;31, SEQ ID NO; 17, and SEQ ID NO 22 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:31, SEQ ID NO: 17, and SEQ ID NO:23. 100237] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:32, SEQ ID NO: 17, and SEQ ID NO:22 In some 2026205205 01 Jul 2026 embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:32, SEQ ID NO: 17, and SEQ ID NO:23. 100238] In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:32, SEQ ID NO: 18, and SEQ ID NO:22 In some embodiments, the biparatopic anti-FRa antibodies or antigen binding fragments thereof comprise SEQ ID NO:32, SEQ ID NO: 18, and SEQ ID NO 23 100239] In some embodiments, the biparatopic antibodies or antigen binding fragments thereof comprise polypeptide sequences disclosed in Table 6 below. Tahle 6 Morrison format (C-terminus scFv) Fusion Proteins Name scFv Sequences Molecule-1: movl9-IgGl-FR57scFvl movl9-IgGl- FR57scFv-HC QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNW VKQSPGQSLEWIGRIHPYDGDTFYNQKFQGKATLTV DKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDY WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPGSGGGGSGGGGSGGGGSEVQLVESGG GLVQPGGSRRLSCAASGFTFSSFGMHWVRQAPGKGL EWVAYISSGSSTISYADSVKGRFTISRDNSKKTLLLQM TSLRAEDTAMYYCAREAYGSSMEYWGQGTLVTVSS GGGGSGGGGSGGGGSGGGGSEIVLTQSPATLSVTPGD RVSLSCRASQNINNNLHWYQQKPGQSPRLLIKYVSQS VSGIPDRFSGSGSGTDFTLSISSVEPEDFGMYFCQQSN SWPHYTFGQGTKLEIKRT (SEQ IDNO:33) huMovl9LC DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMH WYHQKPGQQPRLLIYRASNLEAGVPDRFSGSGSKTDF TLTISPVEAEDAATYYCQQSREYPYTFGGGTKLE1KRT VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHK VY ACE VTHQGLSSPVTKSFNRGEC (SEQ ID NO34) Molecule 2: FR57-IgGl-movl9scFvl FR57-IgGl-movl9scFv 1- HC EVQLVESGGGLVQPGGSRRLSCAASGFTFSSFGMHW VRQAPGKGLEWVAYISSGSST1SYADSVKGRFTISRD NSKKTLLLQMTSLRAEDTAMYYCAREAYGSSMEYW GQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK 2026205205 01 Jul 2026 SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGSGGGGSGGGGSGGGGSQVQLVQSGAEV VKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEW IGRIHPYDGDTFYNQKFQGKATLTVDKSSNTAHMELL SLTSEDFAVYYCTRYDGSRAMDYWGQGTTVTVSSG GGGSGGGGSGGGGSGGGGSDIVLTQSPLSLAVSLGQP AIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRA SNLEAGVPDRFSGSGSKTDFTLTISPVEAEDAATYYC QQSREYPYTFGGGTKLEIKRT (SEQ ID NO35) FR57LC EIVLTQSPATLSVTPGDRVSLSCRASQNINNNLHWYQ QKPGQSPRLL1KYVSQSVSGIPDRFSGSGSGTDFTLS1S SVEPEDFGMYFCQQSNSWPHYTFGQGTKLEIKRTVA APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKAD YEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:36) Molecule 3: FR57scFv2-mov!9-IgGl FR57scFv2-mov!9-IgGl-HC EIVLTQ SPATES VTPGDRVSLSCRASQNINNNLHWYQ QKPGQSPRLLIKYVSQSVSGIPDRFSGSGSGTDFTLSIS SVEPEDEGMYFCQQSNSWPHYTFGCGTKLEIKGGGG SGGGGSGGGGSGGGGSEVQLVQSGGGLVQPGGSRRL SCAASGFTFSSFGMHWXKQAPGKCLEWVAYISSGSST ISYADSVKGRFTISRDNSKKTLLLQMTSLRAEDTAMY YCAREAYGSSMEYWGQGTLVTVSSGGGGSGGGGSG GGGSQVQLVQSGAEVVKPGASVKISCKASGYTFTGY FMNWXTCQSPGQSLEWIGRIHPYDGDTFYNQKFQGKA TLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRA MDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTA ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPG (SEQ IDNOG7) huMovl9LCvl- 6 DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMH WYHQKPGQQPRLLIYRASNLEAGVPDRFSGSGSKTDF TLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKRT VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ 2026205205 01 Jul 2026 ID NO38) Molecule 4: FR57scFv3wt-mov!9-IgGl FR57scFv3wt-movl9-IgGl-HC EIVLTQ SPATES VTPGDRVSLSCRASQNINNNLHWYQ QKPGQSPRLLIKYVSQSVSGIPDRFSGSGSGTDFTLSIS SVEPEDFGMYFCQQSNSWPHYTFGQGTKLEIKGGGG SGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSRRL SCAASGFTFSSFGMHWVRQAPGKGLEWVAYISSGSS TISYADSVKGRFTISRDNSKKTLLLQMTSLRAEDTAM YYCAREAYGSSMEYWGQGTLVTVSSGGGGSGGGGS GGGGSQVQLVQSGAEVVKPGASVKISCKASGYTFTG YFMNWVKQSPGQSLEWIGRIIIPYDGDTFYNQKFQGK ATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSR AMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ S SGLYSL S SWT VPS S SLGTQT YICN VNHKPSNTK VD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPG (SEQ ID NO:39) huMov!9LCvl- 6 DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMH WYHQKPGQQPRLLIYRASNLEAGVPDRFSGSGSKTDF TLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKRT VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:40) 100240| In some embodiments, a biparatopic anti-FRa antibody or antigen-binding fragment thereof comprises the polypeptide sequences of SEQ ID NO:33 and SEQ ID NO:34. In some embodiments, a bi paratopic anti-FRa antibody or antigen-binding fragment thereof comprises the polypeptide sequences selected from SEQ ID NO:35 and SEQ ID NO:36. In some embodiments, a biparatopic anti-FRa antibody or antigen-binding fragment thereof comprises the polypeptide sequences selected from SEQ ID NO:37 and SEQ ID NO:38 In some embodiments, a biparatopic anti-FRa antibody or antigen-binding fragment thereof comprises the polypeptide sequences selected from SEQ ID NO:39 and SEQ ID NO:40. [00241J In some embodiments, the biparatopic antibodies or antigen binding fragments thereof comprise polypeptide sequences disclosed in Table 7 below. Table 7. Asymmetric-Fc molecules (Knob-in-hole) 2026205205 01 Jul 2026 Name Sequences Molecule 5: FR57scFv2-knob-Movl9-hole FR57scFv2-Fc-knob (C220S, T366W) EIVLTQSPATLSVTPGDRVSLSCRASQNINNNLHWYQ QKPGQSPRLLIKYVSQSVSGIPDRFSGSGSGTDFTLSIS SVEPEDEGMYFCQQSNSWPHYTFGCGTKLEIKGGGG SGGGGSGGGGSGGGGSEVQLV^SGGGLVQPGGSRRL SCAASGFTFSSFGMHWVRQAPGKCLEWVAYISSGSS TISYADSVKGRFTISRDNSKKTLLLQMTSLRAEDTAM YYCAREAYGSSMEYWGQGTLVTVSSGSEPKSSDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPG (SEQ ID NO41) Movl9-Fc-hole (T366S, L368A, Y407V) QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNW VKQSPGQSLEWIGRIHPYDGDTFYNQKFQGKATLTV DKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDY WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ VSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPG (SEQ ID NO 42) Movl9-LC DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMH WYHQKPGQQPRLLIYRASNLEAGVPDRFSGSGSKTDF TLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKRT VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ IDNO:43) Molecule 6: FR57scFv3wt-knob-Mov!9- FR57scFv3wt- Fc-knob (C220S, EIVLTQSPATLSVTPGDRVSLSCRASQNINNNLHWYQ QKPGQSPRLLIKYVSQSVSGIPDRFSGSGSGTDFTLSIS SVEPEDFGMYFCQQSNSWPHYTFGQGTKLEIKGGGG SGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSRRL 2026205205 01 Jul 2026 hole T366W) SCAASGFTFSSFGMHWVRQAPGKGLEWVAYISSGSS TISYADSVKGRFTISRDNSKKTLLLQMTSLRAEDTAM YYCAREAYGSSMEYWGQGTLVTVSSGSEPKSSDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPG (SEQ ID NO 44) Movl9-Fc-hole (T366S. L368A, Y407V) QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNW VKQSPGQSLEWIGRIHPYDGDTFYNQKFQGKATLTV DKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAMDY WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPK.PKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ VSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPG (SEQ ID NO 45) Movl9-LC DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMH WYHQKPGQQPRLLIYRASNLEAGVPDRFSGSGSKTDF TLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKRT VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK. ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO46) 100242] In one embodiment, a biparatopic anti-FRa antibody or antigen-binding fragment thereof comprises the polypeptides of SEQ ID NOs: 41-43. In one embodiment, a biparatopic anti-FRa antibody or antigen-binding fragment thereof comprises the polypeptides of SEQ ID NOs: 44-46. 1002431 The biparatopic antibodies or antigen binding fragments thereof of the present disclosure can further comprise a linker. In some embodiments, the linker can link a first 2026205205 01 Jul 2026 antibody or antigen binding fragment thereof to the second antibody or antigen binding fragment thereof from N-terminus to C-terminus. In other embodiments, the linker can link the second polypeptide to the first polypeptide from N-terminus to C-terminus.
[00244] In one embodiment, the biparatopic antibodies or antigen binding fragments thereof comprises a linker sequence located between the first peptide, antibody or antigen binding fragment thereof and the second peptide, antibody or antigen binding fragment thereof. The linker can be of any length and can comprise at least 1,2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 50, or 60 or more amino acids. In other embodiments, a linker useful for the present disclosure has at least one amino acid and less than 100 amino acids, less than 90 amino acids, less than 80 amino acids, less than 70 amino acids, less than 60 amino acids, less than 50 amino acids, less than 40 amino acids, less than 30 amino acids, less than 20 amino acids, less than 19 amino acids, less than 18 amino acids, less than 17 amino acids, less than 16 amino acids, less than 15 amino acids, less than 14 amino acids, less than 13 amino acids, or less than 12 amino acids. In one embodiment, the linker sequence comprises glycine amino acid residues. In other instances, the linker sequence comprises a combination of glycine and serine amino acid residues. 100245| In some embodiments, such glycine / serine linkers can comprises any combination of the amino acid residues, including, but not limited to, the peptide GGGS (SEQ ID NO:49) or GGGGS (SEQ ID NO:50) or repeats of the same, including 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more repeats of these given peptides. The glycine / serine linkers disclosed herein comprises an amino acid sequence of (GS)n, (GGS)n, (GGGS)„, (GGGGSX or (GGGGS)ti, wherein n is an integer of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In one embodiment, the linker sequence is GGGGSGGGGSGGGGS (SEQ ID NO:51) (also noted as (Gly4Ser)s). In another embodiment, the linker sequence is GGGGSGGGGSGGGGSGGGGS (SEQ IDNO;52) (also noted as (Gly4Ser)4). 100246| In some embodiments, the biparatopic anti-FRa antibody comprises an altered (e.g., mutated or engineered) Fc region. For example, in some aspects, the Fc region has been altered to reduce or enhance the effector functions of the antibody, alter serum half-life or other functional properties of the antibody. Reduction or elimination of effector function is desirable in certain cases, for example in the case of antibodies whose mechanism of action involves blocking or antagonism, but not killing of the cells bearing a target antigen. Increased effector function is generally desirable when directed to undesirable cells, such as tumor and foreign cells, where the Fey Rs are expressed at low levels, for example, tumor- 2026205205 01 Jul 2026 specific B cells with low levels of FcyRIIB (e.g., non-Hodgkin’s lymphoma, CLL, and Burkitt’s lymphoma). Immunoconjugates of the invention possessing such conferred or altered effector function activity are useful for the treatment and / or prevention of a disease, disorder or infection in which an enhanced efficacy of effector function activity is desired. In some aspects, the Fc region is an isotype selected from IgM, IgA, IgG, IgE, or other isotype. |00247] Although the Fc Region of the biparatopic anti-FRa antibody or antigen-binding fragment may possess the ability to bind to one or more Fc receptors (e.g., FcyR(s)), in certain embodiments the antibody or antibody fragment comprises a variant Fc region having an altered binding to FcyRIA (CD64), FcyRIIA (CD32A), FcyRIIB (CD32B), FcyRIIIA (CD 16a) or FcyRIIlB (CD16b) (relative to the binding exhibited by a wild-type Fc Region), e.g., will have enhanced binding to an activating receptor and / or will have substantially reduced or no ability to bind to inhibitory receptor(s). Thus, the Fc region of the biparatopic anti-FRa antibody or antigen-binding fragment may include some or all of the CH2 domain and / or some or all of the CH3 domain of a complete Fc region, or may comprise a variant CH2 and / or a variant CH3 sequence (that may include, for example, one or more insertions and / or one or more deletions with respect to the CH2 or CH3 domains of a complete Fc Region). Such Fc regions may comprise non-Fc polypeptide portions, or may comprise portions of non-naturally complete Fc regions, or may comprise non-naturally occurring orientations of CH2 and / or CH3 domains (such as, for example, two CH2 domains or two CH3 domains, or in the N-terminal to C-terminal direction, a CH3 domain linked to a CH2 domain, etc.) 100248] Fc Region modifications identified as altering effector function are known in the art, including modifications that increase binding to activating receptors (e.g., FcyRIIA (CD16A) and reduce binding to inhibitory receptors (e.g., FcyRIIB (CD32B) (see, e.g., Stavenhagen, et al., Cancer Res. 57(18):8882-8890 (2007)). Table 8 lists exemplary single, double, triple, quadruple and quintuple substitutions (numbering is that of the EU index as in Kabat, and substitutions are relative to the amino acid sequence of SEQ ID NO:59) of exemplary^ modification that increase binding to activating receptors and / or reduce binding to inhibitory receptors. Table 8. Variations of Preferred Activating Fc Regions Single-Site Variations F243L R292G D270E R292P 2026205205 01 Jul 2026 Y300L P396L Double-Site Variations F243L and R292P F243L and Y300L F243L and P396L R292Pand Y300L D270E and P396L R292P and V3O5I P396Land Q419H P247L andN421K R292P and P396L Y300L and P396L R255L and P396L R292P and P305I K392Tand P396L Triple-Site Variations F243L, P247L and N421K P247L, D270E and N421K F243L, R292P and Y300L R255L, D270Eand P396L F243L, R292Pand V305I D270E. G316Dand R416G F243L, R292P and P396L D270E, K392T and P396L F243L, Y300L and P396L D270E, P396L and Q419H V284M, R292L and K370N R292P; Y300L and P396L Quadruple-Site Variations L234F, F243L, R292P and Y300L F243L, P247L, D270E and N421K L234F, F243L, R292P and Y300L F243L, R255L, D270E and P396L L235I. F243L, R292P and Y300L F243L; D270E, G316D and R416G L235Q, F243L, R292P and Y300L F243L, D270E, K392Tand P396L P247L, D270E, Y300L and N42IK F243L, R292P, Y300L, and P396L R255L. D270E, R292G and P396L F243L; R292P, V305I and P396L R255L, D270E, Y300L and P396L F243L. D270E. P396L and Q419H D270E, G316D? P396L and R416G Quintuple-Site Variations L235V, F243L, R292P, Y300Land P396L F243L, R292P, V305I, Y300L and P396L L235P. F243L, R292P, Y300L and P396L 100249] Exemplary variants of human IgGl Fc Regions with reduced binding to CD32B and / or increased binding to CD16A contain F243L, R292P, Y300L, V305I, or P396L 2026205205 01 Jul 2026 substitutions, wherein the numbering is that of the EU index as in Kabat. These amino acid substitutions may be present in a human IgGl Fc Region in any combination. In one embodiment, the variant human IgGl Fc Region contains a F243L, R292P and Y300L substitution. In another embodiment, the variant human IgG 1 Fc Region contains a F243L, R292P, Y300L, V3O5I and P396L substitution. 100250] In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment comprises an immunoglobulin heavy chain constant region containing a modification that decreases effector function (see, e.g., Idusogie et al., J. Immunol. 166:2571 -2575 (2001); Sazinsky el al., PNAS USA 105:20167-20172 (2008); Davis etal.,J. Rheumatol. 34:2204-2210 (2007); Bolt et al., Eur. J. Immunol. 23:403-411 (1993); Alegre et al., Transplantation 57:1537-1543 (1994); Xu et al., Cell Immunol. 200:16-26 (2000); Cole et al., Transplantation 68:563-571 (1999); Hutchins et al., PNAS USA 92:1I980-11984 (1995); Reddy etal.,J. Immunol. 164:1925-1933 (2000); WO97 / 11971, and WO07 / 106585; U.S. Appl. Publ. 2007 / 0148167A1; McEarchem et al., Blood 109:1185-1192 (2007); Strohl, Curr. Op. Biotechnol. 20:685-691 (2009); and Kumagai et al.,J. Clin. Pharmacol. 47:14891497 (2007), the contents of each of which is herein incorporated by reference in its entirety). 1002511 In some embodiments, it is preferred for the Fc region of the biparatopic anti-FRa antibody or antigen-binding fragment to exhibit decreased (or substantially no) binding to an effector receptor selected from the group consisting of: FcyRIA (CD64), FcyRIIA (CD32A)(allotypes R131 and H131), FcyRIIB (CD32B), FcyRIIIA (CD16a) (allotype V158 and Fl58) and FcyRIIIB (CD 16b)(allotype Fcylllb-NAl and FcyIIIb-NA2); relative to the binding exhibited by the wild-type IgG Fc Region (SEQ ID NO:59). In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment Fc region variant effector receptor binding affinity has been reduced to 1 / 10 or less, 1 / 50 or less, or 1 / 100 or less as, compared to the binding affinity of the corresponding antibody or antibody binding fragment comprising the wildtype Fc region of the corresponding immunoglobulin. 100252] In a specific embodiment, the biparatopic anti-FRa antibody or antigen-binding fragment comprises an IgG Fc region that exhibits reduced effector function (e.g., reduced ADCC) and comprise a modification at one or more amino acid positions selected from the group consisting of 233, 234, 235, 236, 237, 238, 239, 265, 266, 267, 269, 270, 271, 295, 296, 297, 298, 300, 324, 325, 327, 328, 329, 331, and 332, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. In one embodiment, the CH2-CH3 domain of the biparatopic anti-FRa antibody or antigen-binding fragment includes any 2026205205 01 Jul 2026 1, 2, 3, or 4 of the substitutions: L234A, L235A, D265A, N297Q, N297A, andN297G, wherein the numbering is that of the EU index as in Rabat. In another embodiment, the CH2-CH3 domains contain an N297Q substitution, an N297A substitution, or L234A and L235A substitutions, as these mutations abolish FcR binding. Alternatively, the biparatopic anti-FRa antibody or antigen-binding fragment comprises a CH2-CH3 domain of a naturally occurring Fc region that inherently exhibits decreased (or substantially no) binding to FcyRIIIA (CD 16a) and / or reduced effector function (relative to the binding and effector function exhibited by the wild-type IgGl Fc region (SEQ ID NO:59). In a specific embodiment, the Fc constant region of the biparatopic anti-FRa antibody comprises an IgG2 Fc region (SEQ ID NO:60) or an IgG4 Fc region (SEQ ID NO:61). Since the N297A, N297G, N297Q, L234A, L235A and D265A substitutions abolish effector function, in circumstances in which effector function is desired, these substitutions would preferably not be employed.
[00253] A preferred IgGl sequence for the CH2 and CH3 Domains of the Fc regioncontaining biparatopic anti-FRa antibody or antigen-binding fragment that has reduced or abolished effector function comprises the substitutions L234A / L235A (shown underlined) (SEQ ID NO :62): APEAAGGPSV FLFPPKPKDT LMISRTPEVT CVVVDVSHED PEVKFNWYVD GVEVHNAKTK PREEQYNSTY RWSVLTVLH QDWLNGKEYK CKVSNKALPA PIEKTISKAK GQPREPQVYT LPPSRDELTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPG |00254| A preferred IgGl sequence for the CH2 and CH3 Domains of the Fc regioncontaining biparatopic anti-FRa antibody or antigen-binding fragment that has reduced or abolished effector function comprises the substitution N297A (shown underlined) (SEQ ID NO:63): APELLGGPSV FLFPPKPKDT LMISRTPEVT CVVVDVSHED PEVKFNWYVD GVEVHNAKTK PREEQYASTY RWSVLTVLH QDWLNGKEYK CKVSNKALPA PIEKTISKAK GQPREPQVYT LPPSRDELTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPG
[00255] A preferred IgGl sequence for the CH2 and CH3 Domains of the Fc regioncontaining biparatopic anti-FRa antibody or antigen-binding fragment that has reduced or abolished effector function comprises the substitution N297Q (shown underlined) (SEQ ID NO:64): APELLGGPSV FLFPPKPKDT LMISRTPEVT CVVVDVSHED PEVKFNWYVD GVEVHNAKTK PREEQYQSTY RWSVLTVLH QDWLNGKEYK CKVSNKALPA 2026205205 01 Jul 2026 PIEKTISKAK GQPREPQVYT LPPSRDELTK NQVSLTCLVK GFYPSDIAVE WESNGQPENM YKTTPPVLDS DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPG |00256| In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment comprises an Fc (immunoglobulin) sequence selected from SEQ ID NO: 62, SEQ ID NO: 63, or SEQ ID NO:64. In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment comprises an Fc (immunoglobulin) sequence with reduced or abolished effector function (e.g., comprising the substitutions shown above in SEQ ID NO:62, SEQ ID NO:63, and / or SEQ ID NO:64) and comprises one or more knob-in-holc mutations as disclosed herein. In some embodiments, the Fc sequence comprises a knob mutation as disclosed herein. In some embodiments, the Fc sequence comprises a hole mutation as disclosed herein.
[00257] In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment comprises one or more modifications corresponding to: IgGl-C220S, C226S, C229S, P238S; IgGl-C226S, C229S; IgGl-C226S, C229S, E233P, L234V, L235A; IgGl-L234A, L235A; IgGl-L234F, L235E, P331S, IgGl-L234F, L235E, P331S; IgGl-H268Q, A330S, P331S; IgGl-G236R, L328R; IgGl-L235G, G236R, IgGl-N297A; IgGl-N325A, L328R; IgGl-N325L, L328R; lgGl-K326W, E333S; IgG2-V234A, G237A; IgG2-E333S; IgG2 H268Q, V309L, A330S, A331S; IgG4-S228P, L236E; IgG4-F234A, L235A; IgG4-F234A, G237A, E318A; IgG4-L235A, G237A, E318A, IgG4-L236E; IgG2-EU sequence 118-260; and IgG4-EU sequence 261-447; wherein the position numbering is according to the EU index as in Rabat. 100258] In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment comprises a heavy chain immunoglobulin constant domain that has reduced CDC activity. In particular aspects, biparatopic anti-FRa antibody or antigen-binding fragment comprises an IgGl heavy chain constant region containing a mutation that decreases CDC activity (see, e.g., WO 1997 / 11971 and WO 2007 / 106585, U.S. Appl. Publ. 2007 / 0148167A1; McEarchern et al., Blood 109:1185-1192 (2007); Hayden-Ledbetter et al., Clin. Cancer 15:2739-2746 (2009); Lazar et al., PNAS USA 103:4005-4010 (2006); Bruckheimer et al., Neoplasia 11:509-517 (2009); Strohl, Curr. Op. Biotechnol. 20:685-691 (2009); and Sazinsky et al., PNAS USA 105:20167-20172 (2008); each of which is herein incorporated by reference in its entirety). Examples of heavy chain constant domain sequence modifications that decrease CDC include one or more modifications corresponding to: IgGl-C226S, C229S, E233P, L234V, L235A; IgGl-C226S, P230S, IgGl-L234F, L235E, P331S; 2026205205 01 Jul 2026 IgGl-S239D, A330L, I332E; IgG2 EU sequence 118-260; IgG4-EU sequence 261-447; and IgG2-H268Q, V309L, A330S, A33 IS, according to the EU index |00259| In some embodiments, the provided biparatopic anti-FRa antibody or antigenbinding fragment comprises a heavy chain immunoglobulin constant domain that contains one or more half-life extending amino acid modifications (e.g., substitutions). Numerous mutations capable of increasing the half-life of an Fc region-containing molecule are known in the art and are encompassed as components of the biparatopic anti-FRa antibody or antigen-binding fragments provided herein. See, e.g., U.S. Patent Nos. 6,277,375; 7,083,784; 7,217,797, and 8,088,376; U.S. Publ. Nos. 2002 / 0147311; and 2007 / 0148164; and PCT Publication Nos. WO 1998 / 23289; WO 2009 / 058492; and WO 2010 / 033279, the contents of each of which is herein incorporated by reference in its entirety. |00260| The serum half-life of proteins comprising Fc regions may be increased by increasing the binding affinity of the Fc Region for FcRn. The term “half-life” as used herein means a pharmacokinetic property of a molecule that is a measure of the mean survival time of the molecules following their administration. Half-life can be expressed as the time required to eliminate fifty percent (50%) of a known quantity of the molecule from a subject’s (e.g., a human patient or other mammal) body or a specific compartment thereof, for example, as measured in serum, i.e., circulating half-life, or in other tissues. In general, an increase in half-life results in an increase in mean residence time (MRT) in circulation for the administered molecule.
[00261] In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment comprises a half-life extending amino acid substitution at one or more positions selected from the group consisting of: 238, 250, 252, 254, 256, 257, 256, 265, 272, 286, 288, 303, 305, 307, 308, 309, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424, 428, 433, 434, 435, and 436, wherein the amino acid position numbering is according to the EU index. In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment contains one or more amino acid substitutions of amino acid residues at positions 251-257, 285-290, 308-314, 385-389, and 428-436, wherein the amino acid position numbering is according to the EU index. In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment contains one or more of a substitution of the amino acid at Rabat position 252 with Tyr, Phe, Trp, or Thr; a substitution of the amino acid at Rabat position 254 with Thr; a substitution of the amino acid at Rabat position 256 with Ser, Arg, Gin, Glu, Asp, or Thr; a substitution of the amino acid at Rabat position 257 with Leu; a substitution of the amino acid at Rabat position 309 with Pro; a substitution of the amino acid 2026205205 01 Jul 2026 at Kabat position 311 with Ser; a substitution of the amino acid at Kabat position 428 with Thr, Leu, Phe, or Ser, a substitution of the amino acid at Kabat position 433 with Arg, Ser, Iso, Pro, or Gin; or a substitution of the amino acid at Kabat position 434 with Trp, Met, Ser, His, Phe, or Tyr. More specifically, the biparatopic anti-FRa antibody or antigen-binding fragment domain can contain amino acid substitutions relative to a wild-type human IgG constant domain including a substitution of the amino acid at Kabat position 252 with Tyr, a substitution of the amino acid at Kabat position 254 with Thr, and a substitution of the amino acid at Kabat position 256 with Glu. |00262] In some embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment comprises a least one substitution selected from: T250Q, M252Y, S254T, T256E, K288D, T307Q, V308P, A378V, M428L, N434A, N434S, N434H, N434Y, H435K, and Y436I, wherein the numbering is that of the EU index as in Kabat. In further embodiments, the biparatopic anti-FRa antibody or antigen-binding fragment comprises substitutions selected from; (a) M252Y, S254T and T256E; (b) M252Y and S254T, (c) M252Y and T256E; (d) T250Q and M428L; (e) T307Q and N434A; (f) A378V and N434A; (g) N434A and Y436I; (h) V308P and N434A; and (i) K288D and H435K. |00263| In a preferred embodiment, the biparatopic anti-FRa antibody or antigen-binding fragment contains a variant IgG Fc Region comprising any 1, 2, or 3 of the substitutions: M252Y, S254T and T256E. The disclosure further provides biparatopic anti-FRa antibody or antigen-binding fragments possessing variant Fc regions comprising: (a) one or more mutations which alter effector function and / or FcyR; and (b) one or more mutations which extend serum half-life. Table 9 : Immunoglobulin Sequences Exemplary IgGl Fc Region APELLGGPSVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEV'KFNWYVDG VEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQK.SLSLSPG (SEQ ID NO:59) Exemplary IgG2 Fc Region APPVAGPSVFLFPPKPKDTLM1SRTPEVTCVVVDVSHEDPEVQFNWYVDG VEVHNAKTKPREEQFNSTFRWSVLTVVHQDWLNGKEYKCKVSNKGLPAP IEKT1SKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD1AVEW ESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPG (SEQ ID NO:60) Exemplary lgG4 Fc Region APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVD GVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS S1EKT1SKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSD1AVE WESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHE 2026205205 01 Jul 2026 ALHNHYTQKSLSLSLG (SEQ ID NO:61) Exemplary L234A / L235A IgGl Fc Region APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPA P1EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQK.SLSLSPG (SEQ ID NO:62) Exemplary N297A IgGl Fc Region APELLGGPSVFLFPPK.PK.DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKT1SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQK.SLSLSPG (SEQ ID NO:63) Exemplary N297Q IgGl Fc Region APELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYtJSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA P1EKTISK.AK.GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQK.SLSLSPG (SEQ ID NO:64) III.Biparatopic Antibody Production [ 00264] Biparatopic antibodies or antigen binding fragments thereof that immunospecifically bind to FRa can be produced by any method known in the art for the synthesis of antibodies, for example, by chemical synthesis or by recombinant expression techniques. The methods described herein employ, unless otherwise indicated, conventional techniques in molecular biology, microbiology, genetic analysis, recombinant DNA, organic chemistry, biochemistry, PCR, oligonucleotide synthesis and modification, nucleic acid hybridization, and related fields within the skill of the art. These techniques are described, for example, in the references cited herein and are fully explained in the literature. See, e.g., Sambrook J et al., (2001) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Ausubel FM et al., Current Protocols in Molecular Biology, John Wiley & Sons (1987 and annual updates); Current Protocols in Immunology, John Wiley & Sons (1987 and annual updates) Gait (ed.) (1984) Oligonucleotide Synthesis: A Practical Approach, IRL Press; Eckstein (ed.) (1991) Oligonucleotides and Analogues: A Practical Approach, IRL Press; Biiren B et al., (eds.) (1999) Genome Analysis: A Laboratory Manual, Cold Spring Harbor Laboratory Press. 100265] Biparatopic antibodies or antigen binding fragments thereof as provided herein can be prepared by chemically linking two different monoclonal antibodies or by fusing two hybridoma cell lines to produce a hybrid-hybridoma. 2026205205 01 Jul 2026
[00266] In a specific embodiment, a biparatopic antibody or antigen binding fragment thereof described is prepared, expressed, created or isolated by any means that involves creation, e.g., via synthesis, genetic engineering of DNA sequences. In certain embodiments, such a biparatopic antibody or antigen binding fragment thereof comprises sequences (e.g., DNA sequences or amino acid sequences) that do not naturally exist within the antibody germline repertoire of an animal or mammal (e.g., human) zzz vivo. 100267] Methods of making bispecific, bivalent antibodies or antigen binding fragments thereof, are described, for instance in U.S. Pat. Nos. 5,731,168, 5,807,706, 5,821,333, and U.S. Appl. Publ. Nos. 2003 / 020734 and 2002 / 0155537; each of which is herein incorporated by reference in its entirety. Bispecific tetraval ent antibodies, and methods of making them are described, for instance, in Int. Appl. Publ. Nos. WO02 / 096948 and WO00 / 44788, the disclosures of both of which are herein incorporated by reference in its entirety. See generally, Int. Appl. Publ. Nos. WO93 / 17715, WO92 / 08802, WO91 / 00360, and WO92 / 05793; Tutt etal., J. Immunol. 147:60-69 (1991); U.S. Pat. Nos. 4,474,893; 4,714,681; 4,925,648; 5,573,920; and 5,601,819; and Kostelny et al., J. Immunol. 148:15471553 (1992), each of which is herein incorporated by reference in its entirety. 100268] One method for generating bispecific antibodies has been termed the "knobs-into-holes" strategy (see, e.g., Inti. Publ. WO2006 / 028936). The mispairing of Ig heavy chains is reduced in this technology by mutating selected amino acids forming the interface of the CH3 domains in IgG. At positions within the CH3 domain at which the two heavy chains interact directly, an amino acid with a small side chain (hole) is introduced into the sequence of one heavy chain and an amino acid with a large side chain (knob) into the counterpart interacting residue location on the other heavy chain. In some embodiments, compositions of the invention have immunoglobulin chains in which the CH3 domains have been modified by mutating selected amino acids that interact at the interface between two polypeptides so as to preferentially form a bispecific antibody. The bispecific antibodies can be composed of immunoglobulin chains of the same subclass (e.g.,IgG 1 or IgG3) or different subclasses (e.g., IgGl and IgG3, or IgG3 and IgG4) 100269] In one embodiment, a biparatopic antibody or antigen binding fragment thereof comprises a T366W mutation in the "knobs chain" and T366S, L368A, Y407V mutations in the "hole chain," and optionally an additional interchain disulfide bridge between the CH3 domains by, e.g., introducing a Y349C mutation into the "knobs chain" and a E356C mutation or a S354C mutation into the “hole chain;” R.409D, K370E mutations in the "knobs chain" and D399K, E357K mutations in the "hole chain;” a T366W mutation in the "knobs 2026205205 01 Jul 2026 chain" and T366S, L368A, Y407V mutations in the "hole chain;" R409D, K370E mutations in the "knobs chain" and D399K, E357K mutations in the "hole chain;" Y349C, T366W mutations in one of the chains and E356C, T366S, L368A, Y407V mutations in the counterpart chain; and Y349C, T366W mutations in one chain and S354C, T366S, L368A, Y407V mutations in the counterpart chain (numbering according to the EU numbering system). 100270] A bispecific antibody as described herein can also be generated according to the DuoBody technology platform (Genmab A / S) as described, e.g., in International Publication Nos. WO 2011 / 131746, WO 2011 / 147986, WO 2008 / 119353, and WO 2013 / 060867, and in Labrijn AF etal., (2013) PNAS 110(13): 5145-5150. The DuoBody technology can be used to combine one half of a first FRa-binding domain containing two heavy and two light chains with one half of a second FRa-binding domain containing two heavy and two light chains. The resultant heterodimer contains one heavy chain and one light chain from the first FRa-binding domain paired with one heavy chain and one light chain from the second FRa-binding domain. 100271 ] Biparatopic antibodies or antigen binding fragments thereof, in some instances, contain IgG4 and IgGl, IgG4 and IgG2, IgG4 and IgG2, IgG4 and IgG3, or IgGl and IgG3 chain heterodimers. Such heterodimeric heavy chain antibodies, can routinely be engineered by, for example, modifying selected amino acids forming the interface of the CH3 domains in human IgG4 and the IgGl or IgG3 so as to favor heterodimeric heavy chain formation. 100272] In particular embodiments, a biparatopic antibody or antigen binding fragment thereof can comprise chimeric FRa-binding domains or humanized FRa-binding domains. In certain embodiments, a biparatopic antibody or antigen binding fragment thereof can be a F(ab’)2 fragment. A F(ab’)2 fragment contains the two antigen-binding arms of a tetrameric antibody molecule linked by disulfide bonds in the hinge region. 100273] Biparatopic antibodies or antigen binding fragments thereof described herein can be generated by any technique known to those of skill in the art. For example, F(ab’)z fragments described herein can be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as pepsin. |00274| In a certain aspect, provided herein is a method of making biparatopic antibody or antigen binding fragment thereof comprising culturing a cell or cells described herein. In a certain aspect, provided herein is a method of making a biparatopic antibody or antigen binding fragment thereof comprising expressing {e.g., recombinantly expressing) the antibody or antigen-binding fragment using a cell or host cell described herein {e.g., a cell or 2026205205 01 Jul 2026 a host cell comprising polynucleotides encoding an antibody described herein). In a particular embodiment, the cell is an isolated cell. In a particular embodiment, the exogenous polynucleotides have been introduced into the cell. In a particular embodiment, the method further comprises the step of purifying the antibody or antigen-binding fragment obtained from the cell or host cell. |00275] FRa-binding domains can be prepared, e.g., from monoclonal antibodies, using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof. For example, monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow E & Lane D, Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling GJ et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563 681 (Elsevier, N.Y., 1981). The term “monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology. For example, monoclonal antibodies can be produced recombinantly from host cells exogenously expressing an antibody described herein. Monoclonal antibodies described herein can, for example, be made by the hybridoma method as described in Kohler G & Milstein C (1975) Nature 256: 495 or can, e.g., be isolated from phage libraries using the techniques as described herein, for example. Other methods for the preparation of clonal cell lines and of monoclonal antibodies expressed thereby are well known in the art (see, for example, Chapter 11 in: Short Protocols in Molecular Biology, (2002) 5th Ed., Ausubel FM et al., supra). 100276] Further, the FRa-binding domains described herein can also be generated using various phage display methods known in the art. In phage display methods, proteins are displayed on the surface of phage particles which carry' the polynucleotide sequences encoding them. In particular, DNA sequences encoding VH and VL domains are amplified from animal cDNA libraries (e.g., human or murine cDNA libraries of affected tissues). The DNA encoding the VH and VL domains are recombined together with a scFv linker by PCR and cloned into a phagemid vector. The vector is electroporated in E. coli and the E. coli is infected with helper phage. Phage used in these methods are typically filamentous phage including fd and Ml3, and the VH and VL domains are usually recombinantly fused to either the phage gene III or gene VIII. Phage expressing an antibody or fragment that binds to a particular antigen can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead. Examples of phage display methods that can be used to make the antibodies described herein include those disclosed in Brinkman U et al., (1995) J Immunol Methods 182: 41-50; Ames RS et al., (1995) J Immunol Methods 2026205205 01 Jul 2026 184: 177-186; Kettleborough CA etal., (1994) Eur J Immunol 24: 952-958; Persic L et al., (1997) Gene 187: 9-18; Burton DR & Barbas CF (1994) Advan Immunol 57: 191-280, PCT Application No. PCT / GB91 / 001134; International Publication Nos. WO 90 / 02809, WO 91 / 10737, WO 92 / 01047, WO 92 / 18619, WO 93 / 1 1236, WO 95 / 1 5982, WO 95 / 20401, and WO 97 / 13844; and U.S. Patent Nos. 5,698,426, 5,223,409, 5,403,484, 5,580,717, 5,427,908, 5,750,753, 5,821,047, 5,571,698, 5,427,908, 5,516,637, 5,780,225, 5,658,727, 5,733,743, and 5,969,108. |00277] As described in the above references, after phage selection, the antibody coding regions from the phage can be isolated and used to generate FRa-binding domains, including human FRa-binding domains, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described below. Techniques to recombinantly produce FRa-binding domains such as Fab, Fab’ and F(ab’)z fragments can also be employed using methods known in the art such as those disclosed in PCT publication No. WO 92 / 22324; Mullinax RL et al, (1992) BioTechniques 12(6): 864-9; Sawai H et al., (1995) Am J Reprod Immunol 34: 26-34; and Better M etal., (1988) Science 240: 10411043, 100278] In one aspect, to generate FRa-binding domains or antibodies, PCR primers including VH or VL nucleotide sequences, a restriction site, and a flanking sequence to protect the restriction site can be used to amplify the VH or VL sequences from a template, e.g., scFv clones. Utilizing cloning techniques known to those of skill in the art, the PCR amplified VH domains can be cloned into vectors expressing a VH constant region, and the PCR amplified VL domains can be cloned into vectors expressing a VL constant region, e.g., human kappa or lambda constant regions. The VH and VL domains can also be cloned into one vector expressing the necessary constant regions. The heavy chain conversion vectors and light chain conversion vectors are then co-transfected into cell lines to generate stable or transient cell lines that express antibodies, e.g., IgG, using techniques known to those of skill in the art. IV.Polynucleotides Encoding Biparatopic Antibodies |00279| In certain embodiments, the disclosure encompasses polynucleotides comprising a nucleic acid that encodes a biparatopic anti-FRa antibody or antigen binding fragment thereof, or a domain of such an antibody or fragment, e.g., a VH, a VL, a VH with a VL (e.g., 2026205205 01 Jul 2026 in an scFv), a heavy chain, a light chain, a heavy chain with an scFv, a light chain with an scFv, a constant region, or a constant region with an scFv. 100280| Accordingly, provided herein are polynucleotides encoding SEQ ID NOs: 17-40. Also provided herein are compositions comprising combinations of polynucleotides encoding any biparatopic anti-FRa antibody or antigen-binding fragment thereof (e.g., a composition comprising a polynucleotide encoding SEQ ID NO; 17 and a polynucleotide encoding SEQ ID NO:22, a composition comprising a polynucleotide encoding SEQ ID NO: 18 and a polynucleotide encoding SEQ ID NO:23, a composition comprising a polynucleotide encoding SEQ ID NO: 19 and a polynucleotide encoding SEQ ID NO:24, a composition comprising a polynucleotide encoding SEQ ID NO:20 and a polynucleotide encoding SEQ ID NO:25, a composition comprising a polynucleotide encoding SEQ ID NO:21 and a polynucleotide encoding SEQ ID NO:26, a composition comprising a polynucleotide encoding SEQ ID NO:33 and a polynucleotide encoding SEQ ID NO:34, a composition comprising a polynucleotide encoding SEQ ID NO35 and a polynucleotide encoding SEQ ID NO:36, a composition comprising a polynucleotide encoding SEQ ID NO:37 and a polynucleotide encoding SEQ ID NO:38, a composition comprising a polynucleotide encoding SEQ ID NO:39 and a polynucleotide encoding SEQ ID NO:40, a composition comprising a polynucleotide encoding SEQ ID NO:41, a polynucleotide encoding SEQ ID NO:42, and a polynucleotide encoding SEQ ID NO:43, or a composition comprising a polynucleotide encoding SEQ ID NO:44, a polynucleotide encoding SEQ ID NO:45, and a polynucleotide encoding SEQ ID NO 46 ) Also provided herein are compositions comprising combinations of polynucleotides encoding any biparatopic anti-FRa antibody or antigenbinding fragment thereof (e.g., a composition comprising a polynucleotide encoding SEQ ID NO:20 and a polynucleotide encoding SEQ ID NO:57.) 100281 ] In certain embodiments, the biparatopic anti-FRa antibody or antigen binding fragment thereof is encoded by the plasmids deposited with the American Type Culture Collection (ATCC), located at 10801 University Boulevard, Manassas, VA 20110 under the terms of the Budapest Treaty and having ATCC deposit nos. PTA-10774 (deposited in April 7, 2010), PTA-I259I5 (“MovI9-Fc-hole”; deposited to the ATCC on April 29, 2019 and received by the ATCC on April 30, 2019), and PTA-125916 (“FR57scFv2-Fc-knob”; deposited to the ATCC on April 29, 2019 and received by the ATCC on April 30, 2019). 100282| The polynucleotides of the invention can be in the form of RNA or in the form of DNA. DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) 2026205205 01 Jul 2026 strand. In some embodiments, the polynucleotide is a cDNA or a DNA lacking one more endogenous introns. 100283] In some embodiments, a polynucleotide is a non-naturally occurring polynucleotide. In some embodiments, a polynucleotide is recombinantly produced. 100284] In certain embodiments, the polynucleotides are isolated. In certain embodiments, the polynucleotides are substantially pure. In some embodiments, a polynucleotide is purified from natural components. [00285| In some embodiments, a polynucleotide provided herein is codon optimized for expression in a particular host (change codons in the human mRNA to those preferred by a bacterial host such as E. coli). V.Cells and Vectors 100286] Vectors and cells comprising the polynucleotides described herein are also provided. |00287] In certain aspects, provided herein are cells (e.g, host cells) expressing (e.g., recombinantly) antibodies, antigen binding fragments thereof described herein which specifically bind to FRa and comprising related polynucleotides and expression vectors. Provided herein are vectors (e.g., expression vectors) comprising polynucleotides comprising nucleotide sequences encoding anti-FRa antibodies or a fragment thereof for recombinant expression in host cells, preferably in mammalian cells. Also provided herein are host cells comprising such vectors for recombinantly expressing anti- FRa antibodies or antigenbinding fragment thereof described herein. In a particular aspect, provided herein are methods for producing an antibody or antigen binding fragments thereof described herein, comprising expressing such antibody or antigen binding fragments thereof in a host cell. [002881 Recombinant expression of an antibody or antigen binding fragment thereof described herein involves construction of an expression vector containing a polynucleotide that encodes the antibody or a fragment thereof (e.g., a heavy or light chain), a fusion protein comprising a heavy or light chain (e.g., a heavy or light chain fused to one or more variable domains (e g., an scFv)), a variable domain, a polypeptide comprising a VH and a VL (e.g., scFv), a constant domain, and / or a fusion protein comprising a constant domain (e.g., a constant domain fused to one or more variable domains (e.g, an ScFv)). Once a polynucleotide encoding an antibody or a fragment thereof described herein has been obtained, the vector for the production of the antibody or a fragment thereof can be produced 2026205205 01 Jul 2026 by recombinant DNA technology using techniques well known in the art. Thus, methods for preparing a protein by expressing a polynucleotide a nucleotide sequence encoding an antibody or fragment thereof are described herein. Methods which are well known to those skilled in the art can be used to construct expression vectors containing coding sequences for an antibody or a fragment thereof and appropriate transcriptional and translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Also provided are replicable vectors comprising a nucleotide sequence encoding an antibody or a fragment thereof, operably linked to a promoter. Such vectors can, for example, include the nucleotide sequence encoding the constant region of the antibody molecule (see, e.g., International Publication Nos. WO 86 / 05807 and WrO 89 / 01036, and U.S. Patent No. 5,122,464), and variable domains of the antibody can be cloned into such a vector for expression of the entire heavy, the entire light chain, or both the entire heavy and light chains. A nucleotide sequence encoding an additional variable domain or an FRa-binding domain (e.g., scFv) can also be cloned into such a vector for expression of fusion proteins comprising a heavy or light chain fused to an FRa-binding domain or fragment (e.g., VH or VL) thereof. 100289] An expression vector can be transferred to a cell (e.g., host cell) by conventional techniques and the resulting cells can then be cultured by conventional techniques to produce an antibody or fragment (e.g., a heavy or light chain, a fusion protein comprising a heavy or light chain (e.g., a heavy or light chain fused to one or more variable domains (e.g., an scFv), a variable domain, a polypeptide comprising a VH and a VL (e g , scFv), a constant domain, and / or a fusion protein comprising a constant domain (e.g., a constant domain fused to one or more variable domains (e.g., an ScFv) described herein. Thus, provided herein are host cells containing a polynucleotide encoding an antibody or a fragment thereof described herein operably linked to a promoter for expression of such sequences in the host cell.
[00290] In certain embodiments, for the expression of multiple-chained antibodies, vectors encoding all of chains, individually, can be co-expressed in the host cell for expression of the entire immunoglobulin molecule. 100291] In certain embodiments, a host cell contains a vector comprising polynucleotides encoding all of the chains of an antibody or antigen binding fragment thereof described herein. In specific embodiments, a host cell contains multiple different vectors encoding all of the chains of an antibody or antigen binding fragment thereof described herein.
[00292] A vector or combination of vectors can comprise polynucleotides encoding two polypeptides that interact to form an antibody or antigen binding fragment thereof described 2026205205 01 Jul 2026 herein: e.g., a first polynucleotide encoding a fusion protein comprising a heavy chain and an scFv with a second polynucleotide encoding a light chain; a first polynucleotide encoding a fusion protein comprising a light chain and an scFv with a second polynucleotide encoding a heavy chain; a first polynucleotide encoding a fusion protein comprising a heavy chain and a VH with a second polynucleotide encoding a fusion protein comprising a light chain and a VL, etc. Where the two polypeptides are encoded by polynucleotides in two separate vectors, the vectors can be transfected into a host cell at a ratio of 3 polynucleotides encoding a fusion protein comprising a heavy chain: 1 polynucleotide encoding a fusion protein comprising a light chain 100293] A vector or combination of vectors can comprise polynucleotides encoding three polypeptides that interact to form an antibody or antigen binding fragment thereof described herein: e.g., a first polynucleotide encoding a heavy chain, a second polynucleotide encoding a light chain, and a third polynucleotide encoding a fusion protein comprising a heavy chain constant domain, a VH, and a VL (optionally wherein the VH and VL are an scFv). Where the three polypeptides are encoded by polynucleotides in three separate vectors, the vectors can be transfected into a host cell at a ratio of 6 polynucleotides encoding a heavy chain: 3 polynucleotides encoding a light chain : I polynucleotide encoding a fusion protein. 100294] A vector or combination of vectors can comprise polynucleotides encoding four polypeptides that interact to form an antibody or antigen binding fragment thereof described herein: e.g., a first polynucleotide encoding a first heavy chain, a second polynucleotide encoding a second heavy chain, a third polynucleotide encoding a first light chain, and fourth polynucleotide encoding a second light chain. |00295| In some embodiments a host cell comprises the vector or combination of vectors described above. In other embodiments, two host cells, three host cells, or four host cells comprise the vector or combination of vectors described above. 100296] A variety of host-expression vector systems can be utilized to express antibody molecules or fragments thereof (e.g., a heavy or light chain, a fusion protein comprising a heavy or light chain (e g., a heavy or light chain fused to one or more variable domains (e g., an scFv), a variable domain, a polypeptide comprising a VH and a VL (e.g., scFv), a constant domain, and / or a fusion protein comprising a constant domain (e.g., a constant domain fused to one or more variable domains (e.g., an ScFv) described herein. Such host-expression systems represent vehicles by which the coding sequences of interest can be produced and subsequently purified, but also represent cells which can, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody or fragment thereof 2026205205 01 Jul 2026 described herein in situ. These include but are not limited to microorganisms such as bacteria (e.g., E. coli and B. subtilis) transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing antibody coding sequences; yeast (e.g., Saccharomyces Pichia) transformed with recombinant yeast expression vectors containing antibody coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing antibody coding sequences; plant cell systems (e.g., green algae such as Chlamydomonas remhardtii) infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing antibody coding sequences; or mammalian cell systems (e.g., COS (e.g., COS1 or COS), CHO, BHK, MDCK, HEK 293, NSO, PER C6, VERO, CRL7O3O, HsS78Bst, HeLa, and NIH 3T3, HEK-293T, HepG2, SP210, RI. 1, B-W, L-M, BSC1, BSC40, YB / 20 and BMT10 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g, the adenovirus late promoter; the vaccinia virus 7.5K promoter). In a specific embodiment, cells for expressing antibodies described herein or an antigen-binding fragment thereof are CHO cells, for example CHO cells from the CHO GS System™ (Lonza). In a specific embodiment, the expression of nucleotide sequences encoding antibodies described herein which immunospecifically bind FRa (e.g., human FRa) is regulated by a constitutive promoter, inducible promoter or tissue specific promoter. 100297] Once an antibody molecule or a fragment thereof (e g., a heavy or light chain, a variable domain, and / or a polypeptide comprising a VH and a VL (e.g., scFv)) described herein has been produced by recombinant expression, it can be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. Further, the antibodies described herein can be fused to heterologous polypeptide sequences described herein or otherwise known in the art to facilitate purification. VI. Iniinunoconjugates Containing Biparatopic Antibodies 100298] In one aspect, the present disclosure relates to immunoconjugates comprising a biparatopic FRa-binding agent (e.g., an antibody or an antigen-binding fragment thereof) described herein and a cytotoxic agent. The cytotoxic agent may be coupled or conjugated 2026205205 01 Jul 2026 either directly to the FRa-binding agent or indirectly, through a linker using techniques known in the art to produce an “immunoconjugate,” “conjugate,” or “ADC.” A. Exemplary Iminunoconjugates |00299] In a first embodiment, an immunoconjugate provided herein comprises a bi paratopic FRa antibody or antigen binding fragment thereof described herein covalently linked to a maytansinoid compound described herein through the e-amino group of one or more lysine residues located on the biparatopic FRa antibody or antigen binding fragment thereof. In one embodiment, the immunoconjugate is represented by formula (I): CB—:-L2—A—NH—CR1R2—S-Lj—D . q (D or a pharmaceutically acceptable salt thereof, wherein: CB is a biparatopic anti-FRa antibody or antigen binding fragment thereof; L2 is represented by one of the following formula: (L2d), or 2026205205 01 Jul 2026 (L2e); wherein: Rx, Ry, Rx and Ry .for each occurrence, are independently H, -OH, halogen, -0-(Cm alkyl), -SOsH, -NR4oR4iR42+, or a C1-4 alkyl optionally substituted with -OH, halogen, SOsH or NR40R4iR42+, wherein R40, R41 and R42 are each independently H or a Ci-4 alkyl; I and k are each independently an integer from 1 to 10; 11 is an integer from 2 to 5; kl is an integer from 1 to 5; and si indicates the site connected to the cell-binding agent CB and s3 indicates the site connected to the A group; A is an amino acid residue or a peptide comprising 2 to 20 amino acid residues; R1 and R2 are each independently H or a C 1.3alkyl; Li is represented by the following formula: -CR3R4-(CH2)i-s-C(=O)- wherein R ■ and R4 are each independently H or Me, and the -C(=O)- moiety in Li is connected to D; D is represented by the following formula: q is an integer from 1 to 20. In some embodiments q is an integer from 1 to 10. In some embodiments q is an integer from 2 to 5. In some embodiments, q is an integer from 3 to 4. |00300| In a 1st specific embodiment of the first embodiment, an immunoconjugate provided herein is represented by formula (I) described above, wherein Rx, Ry, Rx and Ry are 2026205205 01 Jul 2026 all H; and 1 and k are each independently an integer an integer from 2 to 6, and the remaining variables are as described above for formula (I). 100301] In a 2nd specific embodiment of the first embodiment, an immunoconjugate provided herein is represented by formula (I) described above, wherein A is a peptide containing 2 to 5 amino acid residues; and the remaining variables are as described above for formula (I) in the first embodiment or the Is* specific embodiment. In some embodiments, A is a peptide cleavable by a protease. In some embodiments, a peptide cleavable by a protease expressed in tumor tissue. In some embodiments, A is a peptide having an amino acid that is covalently linked with -NH-CR1R2-S-Li-D selected from the group consisting of Ala, Arg, Asn, Asp, Cit, Cys, selino-Cys, Gin, Glu, Gly, lie, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr and Vai, each independently as L or D isomer. In some embodiments, the amino acid connected to -NH-CR'R2-S-Li-D is an L amino acid. |00302] In a 3rd specific embodiment of the first embodiment, an immunoconjugate provided herein is represented by formula (I) described above, wherein A is selected from the group consisting of Gly-Gly-Gly, Ala-Vai, Val-Ala, D-Val-Ala, Val-Cit, D-Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Phe-Ala, Phe-N9-tosyl-Arg, Phe-N9-nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val-Ala-Val, Ala-Ala-Ala, D-Ala-Ala-Ala, Ala-D-Ala-Ala, Ala-Ala-D-Ala, Ala-Leu-Ala-Leu (SEQ ID NO: 54), p-Ala-Leu-Ala-Leu (SEQ ID NO 55), Gly-Phe-Leu-Gly (SEQ ID NO 56), Val-Arg, Arg-Arg, Val-D-Cit, Val-D-Lys, Val-D-Arg, D-Val-Cit, D-Val-Lys, D-Val-Arg, D-Val-D-Cit, D-Val-D-Lys, D-Val-D-Arg, D-Arg-D-Arg, Ala-Ala, Ala-D-Ala, D-Ala-Ala, D-Ala-D-Ala, Ala-Met, Gln-Val, Asn-Ala, Gln-Phe, Gin-Ala, D-Ala-Pro, and D-Ala-tBu-Gly, wherein the first amino acid in each peptide is connected to L? group and the last amino acid in each peptide is connected to -NH-CR1R2-S-L1-D; and the remaining variables are as described for formula (I) in the first embodiment or the 1st specific embodiment. |00303| In a 4th specific embodiment of the first embodiment, an immunoconjugate provided herein is represented by formula (I) described above, wherein R1 and R2 are both H; and the remaining variables are as described for formula (I) in the first embodiment or the 1st, 2nd, or 3 rd specific embodiment. 100304] In a 5th specific embodiment of the first embodiment, an immunoconjugate provided herein is represented by formula (I) described above, wherein Li is -(CH2)4-6-C(=O)-; and the remaining variables are as described for formula (I) in the first embodiment or the Is', 2nd, 3rd or 4th specific embodiment. 2026205205 01 Jul 2026
[01] In a 6th specific embodiment of the first embodiment, an immunoconjugate provided herein is represented by formula (I) described above, wherein D is represented by the following formula: and the remaining variables are as described for formula (I) in the first embodiment or the Ist, 2nd, 3rd, 4th or 5th specific embodiment. 100305] In a 7,h specific embodiment, an immunoconjugate provided herein is represented by the following formula: 2026205205 01 Jul 2026 or a pharmaceutically acceptable salt thereof, wherein: CBA^ N— H is the biparatopic anti-FRa antibody or antigen-binding fragment thereof connected to the Li group through a Lys amine group, CBA^s js biparatopic anti-FRa antibody or antigen-binding fragment thereof connected to the L2 group through a Cys thiol group; R ’ and R4 are each independently H or Me; ml, m3, nl, rl, si andtl are each independently an integer from 1 to 6; m2, n2, r2, s2 and t2 are each independently an integer from 1 to 7; t3 is an integer from 1 to 12; Di is represented by the following formula: q is an integer from 1 to 20. In some embodiments q is an integer from 1 to 10. In some embodiments q is an integer from 2 to 5. In some embodiments, q is an integer from 3 to 4. In a more specific embodiment, Di is represented by the following formula: 2026205205 01 Jul 2026 100306| In a 8th specific embodiment an immunoconjugate provided herein is represented by the following formula: wherein: m! and m3 are each independently an integer from 2 to 4; m2 is an integer from 2 to 5; rl is an integer from 2 to 6; r2 is an integer from 2 to 5; and the remaining variables are as described in the 7,h specific embodiment. 100307] In a 9th specific embodiment, for the immunoconjugates described in the 7th or 8’11 specific embodiment, A is Ala-Ala-Ala, Ala-D-Ala-Ala, Ala-Ala, D-Ala-Ala, Vai-Ala, D-Val-Ala, D-Ala-Pro, or D-Ala-tBu-Gly. In a more specific embodiment, for the immunoconjugates described in the 7111 or 8th specific embodiment, A is L-Ala-D-Ala-L-Ala. |00308| In a 10th specific embodiment, an immunoconjugate provided herein is represented by the following formula: o 2026205205 01 Jul 2026 CBA- 2026205205 01 Jul 2026 or a pharmaceutically acceptable salt thereof, wherein: A is Al a-Ala-Ala, Ala-D-Ala-Ala, Ala-Al a, D-Ala-Ala, Vai-Al a, D-Vai-Ala, D-Ala-Pro, or D-Ala-tBu-Gly, and Di is represented by the following formula: and the remaining variables are as described in the 7th, 8th or 9th specific embodiment. In a more specific embodiment, A is L-Ala-D-Ala-L-Ala. In a more specific embodiment, Di is represented by the following formula: |00309| In a 11th specific embodiment, an immunoconjugate provided herein is represented by the following formula: wherein Di is represented by the following formula: 2026205205 01 Jul 2026 In a more specific embodiment, Di is represented by the following formula:
[00310] In a I2,h specific embodiment, an immunoconjugate provided herein is represented by the following formula: wherein: CB A is a biparatopic anti-FRa antibody or antigen-binding fragment thereof, wherein said antibody or antigen-binding fragment thereof comprises (i) light chain complementary determining regions L-CDR1, L-CDR2, and L-CDR3 having the sequences of SEQ ID NOs: 2026205205 01 Jul 2026 1-3 and heavy chain complementary determining regions H-CDRI, H-CDR2, and H-CDR3 having the sequences of SEQ ID NOs:7-9 and (ii) light chain complementary determining regions L-CDR1, L-CDR2, and L-CDR3 having the sequences of SEQ ID NOs:4-6 and heavy chain complementary determining regions H-CDRI, H-CDR2, and H-CDR3 having the sequences of SEQ ID NOs:10-12, respectively; q is 1 or 2, Di is represented by the following formula; 1003111 In certain embodiments, for the immunoconjugate of formula (1-4) or (1-6), the a biparatopic anti-FRa antibody or antigen-binding fragment thereof comprises a VL comprising the amino acid sequence of SEQ ID NO: 18, a VH comprising the amino acid sequence of SEQ ID NO:23, a VL comprising the amino acid sequence of SEQ ID NO: 19, and a VH comprising the amino acid sequence of SEQ ID NO:24. |00312| In a 13"' specific embodiment, an immunoconjugate provided herein is represented by the following formula: wherein: CBA is a biparatopic anti-FRa antibody or antigen-binding fragment thereof, wherein said antibody or antigen-binding fragment thereof comprises (i) light chain complementary determining regions L-CDR1, L-CDR2, and L-CDR3 having the sequences of SEQ ID NOs: 1-3 and heavy chain complementary determining regions H-CDRI, H-CDR2, and H-CDR3 having the sequences of SEQ ID NOs:7-9 and (ii) light chain complementary determining 2026205205 01 Jul 2026 regions L-CDR1, L-CDR2, and L-CDR3 having the sequences of SEQ ID NOs:4-6 and heavy chain complementary determining regions H-CDR1, H-CDR2, and H-CDR3 having the sequences of SEQ ID NOs: 10-12, respectively; q is an integer from 1 to 10, e.g., 1 or 10; and Di is represented by the following formula:
[00313] In certain embodiments, for the immunoconjugate of formula (1-2), the a biparatopic anti-FRa antibody or antigen-binding fragment thereof comprises a VL comprising the amino acid sequence of SEQ ID NO: 18, a VH comprising the amino acid sequence of SEQ ED NO23, a VL comprising the amino acid sequence of SEQ ID NO: 19, and a VH comprising the amino acid sequence of SEQ ID NO:24. In certain embodiments, for the immunoconjugate of formula (1-2), the a biparatopic anti-FRa antibody or antigenbinding fragment thereof comprises polypeptides having the amino acid sequences of SEQ ID NOs: 41, 42, and 43. 100314] In a 14,h embodiment, an immunoconjugate provided herein comprises an biparatopic anti-FRa antibody coupled to a maytansinoid compound DM21C (also referred to as Mal-LDL-DM or MalC5-LDL-DM or compound 17a) represented by the following structural formula: wherein the biparatopic anti-FRa antibody or antigen binding fragment thereof comprises (i) a light chain variable region and a heavy chain variable region having the sequences of SEQ ID NO: 18 and SEQ ID NO:23, respectively, and (ii) a light chain variable region and a heavy chain variable region having the sequences of SEQ ID NO19 and SEQ ID NO:24, respectively; and Di is represented by the following formula: 2026205205 01 Jul 2026 100315] In one embodiment, the immunoconjugate is represented by the following structural formula: wherein: CBA is a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises (i) a light chain variable region and a heavy chain variable region having the sequences of SEQ ID NO: 18 and SEQ ID NO:23, respectively, and (ii) a light chain variable region and a heavy chain variable region having the sequences of SEQ ID NO: 19 and SEQ ID NO:24, respectively, and q is 1 or 2. |00316| In certain embodiments, for compositions (e.g., pharmaceutical compositions) comprising immunoconjugates of the 14th specific embodiment, DAR is in the range of 1.5 to 2.2, 1.7 to 2.2 or 19 to 2 1. In some embodiment, the DAR is 1.7, 1.8, 1.9, 2.0 or 2.1.
[00317] In a 15th specific embodiment, an immunoconjugate provided herein comprises a biparatopic anti-FRa antibody or antigen-binding fragment thereof coupled to a maytansinoid compound DM21 (also referred to as DM2 IL, LDL-DM, or compound 14c) represented by the following structural formula: 2026205205 01 Jul 2026 via y-maleimidobutyric acid N-succinimidyl ester (GMBS) or a N- (y-maleiinidobutryloxy)sulfosuccinimide ester (sulfo-GMBS or sGMBS) linker. The biparatopic anti-FRcc antibody or antigen binding fragment thereof comprises (i) a light chain variable region and a heavy chain variable region having the sequences of SEQ ID NO: 18 and SEQ ID NO:23, respectively, and (ii) a light chain variable region and a heavy chain variable region having the sequences of SEQ ID NO: 19 and SEQ ID NO:24, respectively. |00318| The GMBS and sulfo-GMBS (or sGMBS) linkers are known in the art and can be presented by the following structural formula: GMBS
[00319] In one embodiment, the immunoconjugate is represented by the following structural formula: wherein: CBA is a biparatopic anti-FRa antibody or antigen binding fragment thereof comprises (i) a light chain variable region and a heavy chain variable region having the sequences of SEQ ID NO: 18 and SEQ ID NO:23, respectively, and (ii) a light chain variable region and a heavy chain variable region having the sequences of SEQ ID NO: 19 and 2026205205 01 Jul 2026 SEQ ID NO:24, respectively, and q is an integer from 1 to 10, eg., 1 or 10. In some embodiments q is an integer from 2 to 5. In some embodiments, q is an integer from 3 to 4
[00320] In certain embodiments, for immunoconjugates of the 15th specific embodiment, the a biparatopic anti-FRa antibody or antigen-binding fragment thereof comprises polypeptides having the amino acid sequences of SEQ ID NOs: 41, 42, and 43. |00321] In certain embodiments, for compositions (eg., pharmaceutical compositions) comprising immunoconjugates of the 15th specific embodiment, DAR is in the range of 3.0 to 4.0, 3.2 to 3 8, 3.1 to 3.7, or 3.4 to 3.7. In some embodiments, the DAR is 3.2, 3.3, 3.4, 3.5, 3.5, 3.7, or 3 8. In some embodiments, the DAR is 3.5.
[00322] In certain embodiments, for compositions comprising lysine conjugates, DAR is in the range of 1.5 to 3.1. In some embodiments, the DAR is about 2.0.
[00323] In certain embodiments, for compositions (e.g, pharmaceutical compositions) comprising immunoconjugates of the first embodiment, or the 1st, 2nd, 3rd, 4th, 5th, 6th, 7th, 8th, 9th, 10th, 11th, 12th, 13th, 14th or 15th specific embodiment, the average number of the cytotoxic agent per antibody molecule (i.e., average value of q), also known as Drug-Antibody Ratio (DAR) in the composition is in the range of 1.0 to 8.0. In some embodiments, DAR is in the range of 1.0 to 5.0, 1.0 to 4.0, 1.5 to4.0, 2.0 to 4.0, 2.5 to 4.0, 1.0 to 3.4, 1.0 to 3 0, 3.0 to 4.0, 3.1 to 3.5, 3.1 to 3.7, 3.4 to 3.6, 1.5 to 2.5, 2.0 to 2.5, 1.7 to 2.3, or 1.8 to 2.2. In some embodiments, the DAR is less than 4.0, less than 3.8, less than 3.6, less than 3.5, less than 3.0 or less than 2.5. In some embodiments, the DAR is in the range of 3 1 to 3.7. In some embodiments, the DAR is in the range of 3.1 to 3.4. In some embodiments, the DAR is in the range of 3.3 to 3.7. In some embodiments, the DAR is in the range of 3.5 to 3.9. In some embodiments, the DAR is 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7 or 3.8. In some embodiments, the DAR is 3.5. In some embodiments, the DAR is in the range of 1.8 to 2.0 In some embodiments, the DAR is in the range of 1.7 to 1.9. In some embodiments, the DAR is in the range of 1.9 to 2.1. In some embodiments, the DAR is 1.9, 2.0 or 2.1. In some embodiments, for the immunoconjugates of the present invention comprising a biparatopic anti-FRa antibody or an antigen-binding fragment thereof linked to the maytansinoid compound through one or more cysteine thiol group, the DAR is in the range of 1.5 to 2.5, 1.8 to 2.2, 1.1 to 1.9 or 1.9 to 2.1. In some embodiments, the DAR is 1.8, 1.9, 2.0 or 2.1 B. Linkers 2026205205 01 Jul 2026
[00324] Any suitable linkers known in the art can be used in preparing the immunoconjugates of the present disclosure. In certain embodiments, the linkers are bifunctional linkers. As used herein, the term “bifunctional linker” refers to modifying agents that possess two reactive groups; one of which is capable of reacting with a cell binding agent while the other one reacts with the maytansinoid compound to link the two moieties together. Such bifunctional crosslinkers are well known in the art (see, for example, Isalm and Dent in Bioconjugation chapter 5, p218-363, Groves Dictionaries Inc. New York, 1999). For example, bifunctional crosslinking agents that enable linkage via a thioether bond include W-succinimidyl-4-(N-maleimidomethyl)-cyclohexane-l-carboxylate (SMCC) to introduce maleimido groups, or with Ar-succinimidyl-4-(iodoacetyl)-aminobenzoate (SLAB) to introduce iodoacetyl groups. Other bifunctional crosslinking agents that introduce maleimido groups or haloacetyl groups on to a cell binding agent are well known in the art (see US Patent Publication Nos. 2008 / 0050310, 20050169933, available from Pierce Biotechnology Inc. P.O. Box 117, Rockland, IL 61105, USA) and include, but not limited to, bis-maleimidopolyethyleneglycol (BMPEO), BM(PEO)2, BM(PEO)3, N-(P-maleimidopropyloxy)succinimide ester (BMPS), y-maleimidobutyric acid N-succinimidyl ester (GMBS), £-maleimidocaproic acid N-hydroxysuccinimide ester (EMCS), 5-maleimidovaleric acidNHS, HBVS, N-succinimidyl-4-(N-maleimidomethyl)-cyclohexane-l-carboxy-(6-amidocaproate), which is a “long chain” analog of SMCC (LC-SMCC), m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), 4-(4-N-maleimidophenyl)-butyric acid hydrazide or HC1 salt (MPBH), N-succinimidyl 3-(bromoacetamido)propionate (SBAP), N-succinimidyl iodoacetate (SIA), K-maleimidoundecanoic acid N-succinimidyl ester (KMUA), N-succinimidyl 4-(p-maleimidophenyl)-butyrate (SMPB), succinimidyl-6-(p-maleimidopropionamido)hexanoate (SMPH), succinimidyl-(4-vinylsulfonyl)benzoate (SVSB), dithiobis-maleimidoethane (DTME), 1,4-bis-maleimidobutane (BMB), l,4-bismaleimidyl-2,3-dihydroxybutane (BMDB), bis-maleimidohexane (BMH), bis-maleimidoethane (BMOE), sulfosuccinimidyl 4-(N-maleimido-methyl)cyclohexane-1-carboxylate (sulfo-SMCC), sulfosuccinimidyl(4-iodo-acetyl)aminobenzoate (sulfo-SIAB), m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester (sulfo-MBS), N-(y-maleimidobutryloxy)sulfosuccinimide ester (sulfo-GMBS or sGMBS), N-(e-maleimidocaproyloxy)sulfosuccimido ester (sulfo-EMCS), N-(k-maleimidoundecanoyloxy)sulfosuccinimide ester (sulfo-KMUS), and sulfosuccinimidyl 4-(p-malei midophenyl)butyrate (sulfb-SMPB) 2026205205 01 Jul 2026
[00325] Heterobi functional crosslinking agents are bifunctional crosslinking agents having two different reactive groups. Heterobifunctional crosslinking agents containing both an amine-reactive A'-hydroxysuccinimide group (NHS group) and a carbonyl-reactive hydrazine group can also be used to link the cytotoxic compounds described herein with a cell-binding agent (e.g., antibody). Examples of such commercially available heterobifunctional crosslinking agents include succinimidyl 6-hydrazinonicotinamide acetone hydrazone (SANH), succinimidyl 4-hydrazidoterephthalate hydrochloride (SHTH) and succinimidyl hydrazinium nicotinate hydrochloride (SHNH). Conjugates bearing an acid-labile linkage can also be prepared using a hydrazine-bearing benzodiazepine derivative of the present disclosure. Examples of bifunctional crosslinking agents that can be used include succinimidyl-p-formyl benzoate (SFB) and succinimidyl-p-formylphenoxyacetate (SFPA). 1003261 Bifunctional crosslinking agents that enable the linkage of cell binding agent with cytotoxic compounds via disulfide bonds are known in the art and include A-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), jV-succinimidyl-4-(2-pyridyldithio)pentanoate (SPP), N-succinimidyl-4-(2-pyridyldithio)butanoate (SPDB), jV-succinimidyl-4-(2-pyridyldithio)2-sulfo butanoate (sulfo-SPDB or sSPDB) to introduce dithiopyridyl groups. Other bifunctional crosslinking agents that can be used to introduce disulfide groups are known in the art and are disclosed in U.S. Patents 6,913,748, 6,716,821 and US Patent Publications 2009 / 0274713 and 2010 / 0129314, each of which is herein incorporated by reference in its entirety. Alternatively, crosslinking agents such as 2-iminothiolane, homocysteine thiolactone or S-acetylsuccinic anhydride that introduce thiol groups can also be used. C. Cytotoxic Agents
[00327] In some embodiments, provided herein are cytotoxic agents that can be used for making the immunoconjugates of the present disclosure. The cytotoxic agent used in the immunoconjugates provided herein can be any compound that results in the death of a cell, or induces cell death, or in some manner decreases cell viability, and includes, for example, maytansinoids and maytansinoid analogs, benzodiazepines, taxoids, CC-1065 and CC-1065 analogs, duocarmycins and duocarmycin analogs, enediynes, such as calicheamicins, dolastatin and dolastatin analogs including auristatins, tomaymycin derivatives, leptomycin derivatives, methotrexate, cisplatin, carboplatin, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil and morpholino doxorubicin. In certain embodiments, the cytotoxic agents are maytansinoids and maytansinoids analogs. 2026205205 01 Jul 2026
[00328] Examples of suitable maytansinoids include esters of maytansinol and maytansinol analogs. Included are any drugs that inhibit microtubule formation and that are highly toxic to mammalian cells, as are maytansinol and maytansinol analogs
[00329] Exemplary cytotoxic agents were described previously in WO 2018 / 160539 Al and WO 2011 / 106528, each of which is herein incorporated by reference in its entirety. |00330| The immunoconjugates provided herein can comprise a maytansinoid compound represented by the following formula: L2'—A—NH—CR1R2—S-L,—D (jj) or a pharmaceutically acceptable salt thereof, wherein: L2 is represented by the following structural formulas: (L2c’); (L2d’);or (L2e’); wherein: Rx, Ry, Rx and Ry for each occurrence, are independently H, -OH, halogen, -0-(Ci4 alkyl), -SO3H, -NR4oR4iR42+, or a C14 alkyl optionally substituted with -OH, halogen, -SO3H or NR4DR41R42. wherein R40, R41 and R42 are each independently H or a Ci4 alkyl, 2026205205 01 Jul 2026 1 and k are each independently an integer from 1 to 10; Jcb is -C(=O)OH or -COE, wherein -COE is a reactive ester, A is an amino acid or a peptide comprising 2 to 20 amino acids; R1 and R2 are each independently H or a Cualkyl; Li is represented by the following formula: -CRR'-fCIlA^-Ct-OH wherein R3 and R4 are each independently H or Me, and the -C(=O)- moiety in Li is connected to D; D is represented by the following formula: and q is an integer from 1 to 20. In some embodiments q is an integer from 1 to 10. In some embodiments q is an integer from 2 to 5. In some embodiments, q is an integer from 3 to 4. 100331] In some embodiments, the maytansinoid of the present invention is represented by the following formula: A' NH—CR1R2-S-L1—D or a pharmaceutically acceptable salt thereof, wherein: A’ is an amino acid or a peptide comprising 2 to 20 amino acids (i.e., A-NHi); R1 and R2 are each independently H or a C 1.3alkyl; Li is -CRR4-(CH2)i-s-C(=O)-; R’ and R4 are each independently H or Me; 2026205205 01 Jul 2026 D is represented by the following formula: ; and q is an integer from 1 to 20. In some embodiments q is an integer from 1 to 10. In some embodiments q is an integer from 2 to 5. In some embodiments, q is an integer from 3 to 4. |00332] In some embodiments, the maytansinoid of the present invention is represented by the following formula: O HS—(CRxRy)k—C—A—NH—CR1R2-S-L—D or a pharmaceutically acceptable salt thereof, wherein: Rx and Ry, for each occurrence, are independently H, -OH, halogen, -0-(Cm alkyl), -SO?H, -NR4oR4iR42+, or a Ci-4 alkyl optionally substituted with -OH, halogen, SO?H or NR4<jR4lR42+, wherein R40, R41 and R42 are each independently H or a C1-4 alkyl; k is an integer from 1 to 10 A is an amino acid residue or a peptide comprising 2 to 20 amino acid residues; R1 and R2 are each independently H or a C1-3alkyl; Li is -OR3 R+-(CHi)i-8-0(=0)-; R3 and R4 are each independently H or Me, D is represented by the following formula: ' ; and q is an integer from 1 to 20. In some embodiments q is an integer from 1 to 10. In some embodiments q is an integer from 2 to 5. In some embodiments, q is an integer from 3 2026205205 01 Jul 2026 to 4 100333| In some embodiments, for maytansinoid compounds of formulas (II), (III) or (IV), the variables are as described in the first embodiment, or in the 1st, 2nd, 3rd, 4th, 5th, 6th, 7th, 8th, gUi IQth or 11 th Specjflc embodiment in the first embodiment. |00334| In a specific embodiment, the maytansinoid compound is represented by the following formula: 100335| Additional examples of suitable maytansinol esters include those having a modified aromatic ring and those having modifications at other positions. Such suitable maytansinoids are disclosed in U.S. Patent Nos. 4,424,219; 4,256,746; 4,294,757; 4,307,016; 4,313,946; 4,315,929; 4,331,598; 4,361,650; 4,362,663,4,364,866, 4,450,254; 4,322,348; 4,371,533, 5,208,020, 5,416,064; 5,475,092; 5,585,499, 5,846,545, 6,333,410; 7,276,497 and 7,473,796. In addition, several descriptions for producing such antibody-maytansinoid 2026205205 01 Jul 2026 conjugates are provided in U.S. Patent Nos. 6,333,410, 6,441,163, 6,716,821, and 7,368,565, each of which is herein incorporated by reference in its entirety. 100336] In some embodiments, the immunoconjugate comprises N2 -deacetyl-N1 -(3-mercapto-l-oxopropyl)-maytansine (DMI), N1 -deacetyl-N-2 (4-mercapto-l-oxopentyl)-maytansine (termed DM3), N2 -deacetyl-N2 -(4-mercapto-4-methyl-l-oxopentyl) maytansine (DM4), both of which were previously described in PCT Application Publication No. WO 2011 / 106528 Al and U.S. Patent No. 8,557,966 B2, each of which is herein incorporated by reference in its entirety. D. Drug Conjugation |00337] The immunoconjugates comprising a biparatopic FRa-binding antibody or antigen-binding fragment thereof covalently linked to a cytotoxic agent (e.g., maytansinoid) described herein can be prepared according to any suitable methods known in the art. 100338] In certain embodiments, the immunoconjugates of the first embodiment can be prepared by a first method comprising the steps of reacting the biparatopic FRa-binding antibody or antigen-binding fragment thereof with the maytansinoid compound of formula (II) described in the second embodiment. 100339] In certain embodiments, the immunoconjugates of the first embodiment can be prepared by a second method comprising the steps of: (a) reacting the maytansinoid compound of formula (III) or (IV) with a linker compound described herein to form a cytotoxic agent-maytansinoid compound having an aminereactive group or a thiol-reactive group bound thereto (e.g., compound of formula (II)) that can be covalently linked to the biparatopic FRa-binding antibody or antigen-binding fragment thereof; and (b) reacting the biparatopic FRa-binding antibody or antigen-binding fragment thereof with the maytansinoid-linker compound to form the immunoconjugate. 100340] In certain embodiments, the immunoconjugates of the first embodiment can be prepared by a third method comprising the steps of 2026205205 01 Jul 2026 (a) reacting the biparatopic FRa-binding antibody or antigen-binding fragment thereof with a linker compound described herein to form a modified biparatopic FRa-binding antibody or antigen-binding fragment thereof having an amine-reactive group or a thiol-reactive group bound thereto that can be covalently linked to the maytansinoid compound of formula (III) or (IV); and (b) reacting the modified biparatopic FRa-binding antibody or antigen-binding fragment thereof with the maytansinoid compound of formula (III) or (IV) to form the immunoconjugate. 100341 ] In certain embodiments, for the second, third or fourth methods described above, the linker compound is represented by any one of the formula (alL) - (alOL): 2026205205 01 Jul 2026 (alOL), wherein X is halogen, Jd -SH, or -SSRd; Rd is phenyl, nitrophenyl, dinitrophenyl, carboxynitrophenyl, pyridyl or nitropyridyl; Re is an alkyl; and U is -H or SO3H or a pharmaceutically acceptable salt thereof. 100342] In one embodiment, the linker compound is GMBS or sulfo-GMBS (or sGMBS) represented by represented by formula (a9L), wherein U is -H or SOrH or a pharmaceutically acceptable salt thereof 100343] In a specific embodiment, the immunoconjugate of the present invention is represented by the following formula; the immunoconjugate can be prepared by the second, third or fourth method described above, wherein the linker compound is GMBS or sulfo-GMBS represented by represented by formula (a9L), wherein U is -H or SOrH or a pharmaceutically acceptable salt thereof; and the maytansinoid compound is represented by formula (D-l) described above. In a more specific embodiment, the immunoconjugate of formula (1-1) is prepared by reacting the maytansinoid compound of formula (D-l) with the linker compound GMBS or sulfo-GMBS to form a maytansinoid-linker compound, followed by reacting the biparatopic FRa-binding antibody or antigen-binding fragment thereof with the maytansinoid-linker compound. In an even more specific embodiment, the maytansinoid linker compound is not purified before reacting with the biparatopic FRa-binding antibody or antigen-binding fragment thereof. 100344] In another specific embodiment, the immunoconjugate is represented by the following formula; 2026205205 01 Jul 2026 and the immunoconjugate can be prepared by the second, third or fourth method described above, wherein the linker compound is GMBS or sulfo-GMBS represented by represented by formula (a9L), wherein U is -H or SChH or a pharmaceutically acceptable salt thereof; and the maytansinoid compound is represented by formula (D-2) described above. In a more specific embodiment, the immunoconjugate of formula (1-2) is prepared by reacting the maytansinoid compound of formula (D-2) with the linker compound GMBS or sulfo-GMBS to form a maytansinoid-linker compound, followed by reacting the biparatopic FRa-binding antibody or antigen-binding fragment thereof with the maytansinoid-linker compound. In an even more specific embodiment, the maytansinoid linker compound is not purified before reacting with the biparatopic FRa-binding antibody or antigen-binding fragment thereof.
[02] In another specific embodiment, the immunoconjugate is represented by the following formula: and the immunoconjugate is prepared according to the first method described above by reacting the biparatopic FRa-binding antibody or antigen-binding fragment thereof with the maytansinoid compound of formula (D-3) described above. 100345| In another specific embodiment, the immunoconjugate is represented by the following formula: and the immunoconjugate is prepared according to the first method described above by 2026205205 01 Jul 2026 reacting the biparatopic FRa-binding antibody or antigen-binding fragment thereof with the maytansinoid compound of formula (D-4) described above. 1003461 In another specific embodiment, the immunoconjugate is represented by the following formula: < J q (I-5); and the immunoconjugate is prepared according to the first method described above by reacting the anti-FRa antibody or an anti gen-bin di ng fragment thereof with the maytansinoid compound of formula (D-5) described above. 100347] In another specific embodiment, the immunoconjugate is represented by the following formula: N > q (1-6), and the immunoconjugate is prepared according to the first method described above by reacting the biparatopic FRa-binding antibody or antigen-binding fragment thereof with the maytansinoid compound of formula (D-6) described above. [003481 In some embodiments, the immunoconjugates represented by formulas 1-3 through 1-6 disclosed above are prepared according to the methods described in U.S. Provisional Application 62 / 821,707 filed on March 21, 2019 and related U.S. Application No. 16 / 825,127.
[00349] In some embodiments, the immunoconjugates prepared by any methods described above is subject to a purification step. In this regard, the immunoconjugate can be purified from the other components of the mixture using tangential flow filtration (TFF), non-adsorptive chromatography, adsorptive chromatography, adsorptive filtration, selective precipitation, or any other suitable purification process, as well as combinations thereof.
[00350] In some embodiments, the immunoconjugate is purified using a single purification step (e.g., TFF). Preferably, the conjugate is purified and exchanged into the appropriate 2026205205 01 Jul 2026 formulation using a single purification step (eg., TFF). In other embodiments of the invention, the immunoconjugate is purified using two sequential purification steps. For example, the immunoconjugate can be first purified by selective precipitation, adsorptive filtration, absorptive chromatography or non-absorptive chromatography, followed by purification with TFF. One of ordinary skill in the art will appreciate that purification of the immunoconjugate enables the isolation of a stable conjugate comprising the cell-binding agent chemically coupled to the cytotoxic agent. |00351] Any suitable TFF systems may be utilized for purification, including a Pellicon type system (Millipore, Billerica, Mass.), a Sartocon Cassette system (Sartorius AG, Edgewood, N. Y.), and a Centrasette type system (Pall Corp., East Hills, N.Y.) 100352] Any suitable adsorptive chromatography resin may be utilized for purification. Preferred adsorptive chromatography resins include hydroxyapatite chromatography, hydrophobic charge induction chromatography (HCIC), hydrophobic interaction chromatography (HIC), ion exchange chromatography, mixed mode ion exchange chromatography, immobilized metal affinity chromatography (IMAC), dye ligand chromatography, affinity chromatography, reversed phase chromatography, and combinations thereof. Examples of suitable hydroxyapatite resins include ceramic hydroxyapatite (CHT Type I and Type II, Bio-Rad Laboratories, Hercules, Calif), HA Ultrogel hydroxyapatite (Pall Corp., East Hills, N.Y ), and ceramic fluoroapatite (CFT Type I and Type II, Bio-Rad Laboratories, Hercules, Calif). An example of a suitable HCIC resin isMEP Hypercel resin (Pall Corp., East Hills, N.Y ). Examples of suitable HIC resins include Butyl-Sepharose, HexyLSepharose, Phenyl-Sepharose, and Octyl Sepharose resins (all from GE Healthcare, Piscataway, N.J.), as well as Macro-prep Methyl and Macro-Prep t-Butyl resins (Biorad Laboratones, Hercules, Calif). Examples of suitable ion exchange resins include SP-Sepharose, CM-Sepharose, and Q-Sepharose resins (all from GE Healthcare, Piscataway, N.J.), and Unosphere S resin (Bio-Rad Laboratories, Hercules, Calif). Examples of suitable mixed mode ion exchangers include Bakerbond ABx resin (JT Baker, Phillipsburg N.J.) Examples of suitable IMAC resins include Chelating Sepharose resin (GE Healthcare, Piscataway, N.J.) and Profinity IMAC resin (Bio-Rad Laboratories, Hercules, Calif). Examples of suitable dye ligand resins include Blue Sepharose resin (GE Healthcare, Piscataway, N.J.) and Affi-gel Blue resin (Bio-Rad Laboratories, Hercules, Calif). Examples of suitable affinity resins include Protein A Sepharose resin (e.g., MabSelect, GE Healthcare, Piscataway, N.J.), where the cell-binding agent is an antibody, and lectin affinity resins, e.g., Lentil Lectin Sepharose resin (GE Healthcare, Piscataway, N.J.), where the cell-binding agent 2026205205 01 Jul 2026 bears appropriate lectin binding sites. Alternatively an antibody specific to the cell-binding agent may be used. Such an antibody can be immobilized to, for instance, Sepharose 4 Fast Flow resin (GE Healthcare, Piscataway, N.J.). Examples of suitable reversed phase resins include C4, C8, and C18 resins (Grace Vydac, Hesperia, Calif). 100353| Any suitable non-adsorptive chromatography resin may be utilized for purification. Examples of suitable non-adsorptive chromatography resins include, but are not limited to, SEPHADEXTM G-25, G-50, G-100, SEPHACRYLTM resins (e g , S-200 and S-300), SUPERDEXTM resins (e.g, SUPERDEXTM 75 and SUPERDEXTM 200), BIOGEL® resins (eg., P-6, P-10, P-30, P-60, and P-100), and others known to those of ordinary skill in the art. Vil.Composition and Kits 100354] Provided herein are compositions comprising an immunoconjugate, antibody, or antigen-binding fragment thereof described herein having the desired degree of purity in a physiologically acceptable carrier, excipient or stabilizer (Remington’s Pharmaceutical Sciences (1990) Mack Publishing Co., Easton, PA). Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed. 100355] A pharmaceutical composition may be formulated for a particular route of administration to a subject. For example, a pharmaceutical composition can be formulated for parenteral, e.g., intravenous, administration. The compositions to be used for m vivo administration can be sterile. This is readily accomplished by filtration through, e.g., sterile filtration membranes. 100356] The pharmaceutical compositions described herein are in one embodiment for use as a medicament. Pharmaceutical compositions described herein can be useful in treating a condition such as cancer. Examples of cancer that can be treated as described herein include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include fallopian tube cancer, squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval 2026205205 01 Jul 2026 cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancers. The cancer can be an FRa-expressing cancer. 100357] A pharmaceutical composition provided herein can comprise immunoconjugates and the pharmaceutical composition (immunoconjugates in the pharmaceutical composition) can have an average of 1 to 20 drugs per biparatopic antibody or antigen-binding fragment thereof. In some embodiments, a pharmaceutical composition comprises an average of 1 to 10 drugs per biparatopic antibody or antigen-binding fragment thereof. In some embodiments, a pharmaceutical composition comprises an average of 2 to 5 drugs per biparatopic antibody or antigen-binding fragment thereof. In some embodiments, a pharmaceutical composition comprises an average of 3 to 4 drugs per biparatopic antibody or antigen-binding fragment thereof. VllLMethods and Uses 100358] The biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates of the disclosure are useful in a variety of applications including, but not limited to, therapeutic treatment methods, such as the treatment of cancer. In certain embodiments, the agents are useful for inhibiting tumor growth and / or reducing tumor volume. The methods of use may be in vitro or in vivo methods. 100359] The present disclosure provides for methods of treating cancer comprising administering a therapeutically effective amount of a biparatopic anti-FRa antibody, antigen binding fragment thereof, or immunoconjugate to a subject (e.g., a subject in need of treatment). In certain embodiments, the cancer is a cancer including, but are not limited to, fallopian tube cancer, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer (e.g., triple negative breast cancer (TNBC)), colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancers. 100360] More particular examples of such cancers include ovarian cancer, epithelial ovarian cancer, ovarian primary peritoneal cancer, or fallopian tube cancer. In certain embodiments, the cancer is ovarian cancer. In certain embodiments, the ovarian cancer is 2026205205 01 Jul 2026 epithelial ovarian cancer (EOC) In certain embodiments, the ovarian cancer (e.g., an EOC) is platinum resistant, relapsed, or refractory. In certain embodiments, the cancer is peritoneal cancer. In certain embodiments, the peritoneal cancer is primary peritoneal cancer. In certain embodiments, the cancer is endometrial cancer. In certain embodiments, the endometrial cancer is serous endometrial cancer. In certain embodiments, cancer is lung cancer. In certain embodiments, the lung cancer is non-small cell lung cancer (NSCLC). In certain embodiments, the lung cancer is lung cancer is adenocarcinoma or bronchioloalveolar carcinoma. In certain embodiments, the cancer is uterine cancer. 100361] In certain embodiments, the cancer is platinum refractory In certain embodiments, the cancer is primary platinum refractory. In certain embodiments, the cancer is platinum sensitive. 1003621 In certain embodiments, the cancer is lMGN853-resistant. |00363] In certain embodiments, the cancer is a metastatic or advanced cancer. 100364] In certain embodiments, the cancer expresses the folate receptor to which the FRa-binding agent or antibody binds. In certain embodiments, the cancer overexpresses the human FRa. 100365| In some embodiments, the biparatopic anti-FRa antibody, antigen binding fragment thereof, immunoconjugate, or pharmaceutical composition comprising the same is administered to a patient with an increased expression level of FRa, for example, as described in U.S. Published Application No. 2012 / 0282175 or International Published Application No. WO 2012 / 135675, both of which are incorporated by reference herein in their entireties. Exemplary antibodies, assays, and kits for the detection of FRa are provided in WO 2014 / 036495 and WO 2015 / 031815, both of which are incorporated by reference herein in their entireties. Thus, in some embodiments, the FRa protein expression is measured by immunohistochemistry (IHC) and given a staining intensity score and / or a staining uniformity score by comparison to controls (e.g., calibrated controls) exhibiting defined scores (e.g. an intensity score of 3 is given to the test sample if the intensity is comparable to the level 3 calibrated control or an intensity of 2 (moderate) is given to the test sample if the intensity is comparable to the level 2 calibrated control). A staining uniformity that is "heterogeneous" (i.e., at least 25% and less than 75% cells stained) or "homogeneous" (i.e., at least 75% cells stained) instead of "focal" (i.e., greater than 0% and less than 25% cells stained) is also indicative of increased FRa expression. The staining intensity and staining uniformity scores can be used alone or in combination (e.g., 2 homo, 2 hetero, 3 homo, 3 hetero, etc.). In another example, an increase in FRa expression can be determined 2026205205 01 Jul 2026 by detection of an increase of at least 2-fold, at least 3-fold, or at least 5-fold) relative to control values (e.g., expression level in a tissue or cell from a subject without cancer or with a cancer that does not have elevated FRa values). In some embodiments, the staining uniformity score is based on the percent of stained cells. 100366] In some embodiments, the cancer is a cancer that expresses FRa at a level of 1 hetero or higher by IHC. In some embodiments, the cancer is a cancer that expresses FRa at a level of 2 hetero or higher by IHC. In some embodiments, the cancer is a cancer that expresses FRa at a level of 3 hetero or higher by IHC. In some embodiments, the cancer is a lung cancer that expresses FRa at a level of 2 hetero or higher by IHC. In some embodiments, the cancer is a lung cancer that expresses FRa at a level of 3 hetero or higher by IHC. In some embodiments, the cancer is an ovarian cancer that expresses FRa at a level of 2 hetero or higher by IHC. In some embodiments, the cancer is an ovarian cancer that expresses FRa at a level of 3 hetero or higher by IHC. In some embodiments, the cancer is an endometrial cancer that expresses FRa at a level of 2 hetero or higher by IHC. In some embodiments, the cancer is an endometrioid cancer that expresses FRa at a level of 1 hetero or higher by IHC. 100367] In some embodiments, at least one cell in sample obtained from a patient has an FRa score of at least 1. In some embodiments, at least one cell in sample obtained from a patient has an FRa score of at least 2 (moderate). In some embodiments, at least one cell in sample obtained from a patient has an FRa score of at least 3. 100368] In some embodiments, at least 25% of the cells in a sample obtained from a patient have a FRa IHC score of at least 1. In some embodiments, at least 33% of the cells in a sample obtained from a patient have a FRa IHC score of at least 1. In some embodiments, at least 50% of the cells in a sample obtained from a patient have a FRa IHC score of at least 1. In some embodiments, at least 66% of the cells in a sample obtained from a patient have a FRa IHC score of at least 1 In some embodiments, at least 75% of the cells in a sample obtained from a patient have a FRa IHC score of at least 1. 100369] In some embodiments, at least 25% of the cells in a sample obtained from a patient have a FRa IHC score of at least 2 (moderate). In some embodiments, at least 33% of the cells in a sample obtained from a patient have a FRa IHC score of at least 2 (moderate). In some embodiments, 25-75% of the cells in a sample obtained from a patient have a FRa IHC score of at least 2 (moderate). In some embodiments, at least 50% of the cells in a sample obtained from a patient have a FRa IHC score of at least 2 (moderate). In some embodiments, at least 66% of the cells in a sample obtained from a patient have a FRa IHC 2026205205 01 Jul 2026 score of at least 2 (moderate). In some embodiments, at least 75% of the cells in a sample obtained from a patient have a FRa IHC score of at least 2 (moderate). 1003701 In some embodiments, at least 25% of the cells in a sample obtained from a patient have a FRa IHC score of at least 3. In some embodiments, at least 33% of the cells in a sample obtained from a patient have a FRa IHC score of at least 3. In some embodiments, at least 50% of the cells in a sample obtained from a patient have a FRa IHC score of at least 3. In some embodiments, at least 66% of the cells in a sample obtained from a patient have a FRa IHC score of at least 3. In some embodiments, at least 75% of the cells in a sample obtained from a patient have a FRa IHC score of at least 3. 100371] In some embodiments, FRa expression can be measured by immunohistochemistry' and given a visual score where FRa positive may refer to greater than or equal to 50% of tumor cells with FRa membrane staining visible at less than or equal to 10X microscope objective. In some embodiments, FRa expression can be measured by immunohistochemistry and given a visual score where FRa positive may refer to greater than or equal to 66% of tumor cells with FRa membrane staining visible at less than or equal to 10X microscope objective. In some embodiments, FRa expression can be measured by immunohistochemistry' and given a visual score where FRa positive may refer to greater than or equal to 75% of tumor cells with FRa membrane staining visible at less than or equal to 10X microscope objective.
[00372] In certain embodiments, the subject is a human. 100373] The present disclosure further provides methods for inhibiting tumor growth using the biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates described herein. In certain embodiments, the method of inhibiting the tumor growth comprises contacting a tumor with the biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates provided herein in vitro For example, an immortalized cell line or a cancer cell line that expresses FRa is cultured in medium to which biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates are added to inhibit tumor growlh. In some embodiments, tumor cells are isolated from a patient sample such as, for example, a tissue biopsy, pleural effusion, or blood sample and cultured in medium to which biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates are added to inhibit tumor growth. 100374| In some embodiments, the method of inhibiting tumor growth comprises contacting the tumor or tumor cells with the biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates in vivo. In certain embodiments, contacting a 2026205205 01 Jul 2026 tumor or tumor cell with a biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates is undertaken in an animal model. For example, biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates can be administered to xenografts expressing one or more tumors that have been grown in immunocompromised mice (e.g. NOD / SCID mice) to inhibit tumor growth. In some embodiments, cancer stem cells are isolated from a patient sample such as, for example, a tissue biopsy, pleural effusion, or blood sample and injected into immunocompromised mice that are then administered biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates to inhibit tumor cell growth 100375] In certain embodiments, the method of inhibiting tumor growth comprises administering to a subject a therapeutically effective amount of biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates. In certain embodiments, the subject is a human. In certain embodiments, the subject has a tumor or has had a tumor removed. 1003761 Administration can be parenteral, including intravenous, administration. 100377] The amount of biparatopic immunoconjugate, antibody or antigen-binding fragment thereof, or composition which will be effective in the treatment of a condition will depend on the nature of the disease. The precise dose to be employed in a composition will also depend on the route of administration, and the seriousness of the disease. 100378| In some embodiments, provided herein are biparatopic anti-FRa antibodies, antigen binding fragments thereof, immunoconjugates, or pharmaceutical compositions comprising the same for use as a medicament. In some aspects, provided herein are biparatopic anti-FRa antibodies, antigen binding fragments thereof, immunoconjugates, or pharmaceutical compositions for use in a method for the treatment of cancer. In some aspects, provided herein are biparatopic anti-FRa antibodies, antigen binding fragments thereof, immunoconjugates, or pharmaceutical compositions for use in a method for the treatment of cancer in a subject, comprising administering to the subject an effective amount of the biparatopic anti-FRa antibodies, antigen binding fragments thereof, immunoconjugates, or pharmaceutical compositions provided herein |00379| In one aspect, biparatopic anti-FRa antibodies, antigen binding fragments thereof, and immunoconjugates of the disclosure are useful for detecting the presence of FRa, e.g., in a biological sample. The term "detecting" as used herein encompasses quantitative or qualitative detection. In certain embodiments, a biological sample comprises a cell or tissue. In certain embodiments, such tissues include normal and / or cancerous tissues that express 2026205205 01 Jul 2026 FRa at higher levels relative to other tissues. In certain embodiments, FRa overexpression detects the presence of ovarian cancer, lung cancer, brain cancer, breast cancer, uterine cancer, renal cancer or pancreatic cancer.
[00380] In certain embodiments, the method of detecting the presence of FRa in a biological sample comprises contacting the biological sample with a biparatopic anti-FRa antibody, antigen binding fragment thereof, or immunoconjugate under conditions permissive for binding of biparatopic anti-FRa antibody, antigen binding fragment thereof, or immunoconjugate, and detecting whether a complex is formed between the biparatopic anti-FRa antibody, antigen binding fragment thereof, or immunoconjugate and FRa. 100381] In certain embodiments, a biparatopic anti-FRa antibody, antigen binding fragment thereof, or immunoconjugate is labeled. Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction. 100382] Embodiments of the present disclosure can be further defined by reference to the following non-limiting examples, which describe in detail preparation of certain antibodies of the present disclosure and methods for using antibodies of the present disclosure. It will be apparent to those skilled in the art that many modifications, both to materials and methods, can be practiced without departing from the scope of the present disclosure. EXAMPLES 1003831 It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application. Example 1. Generation of biparatopic antibodies Expression of bispecific antibodies
[00384] As described previously, a panel of murine anti-FRa antibodies were generated by standard hybridoma technology and humanized using a resurfacing method (see, e.g., WO 2011 / 106528 Al). Antibodies were classified into two bins depending upon whether they compete with Movl9 for binding (Bin 1) or not (Bin 2: FRa Antibody A, FRa Antibody B, FRa Antibody C, and FR57) using a FACS competition assay. Briefly, M9346A-biotinylated 2026205205 01 Jul 2026 antibody at 1.5xlO-9M was mixed with FRa Antibody A, FRa Antibody B, FRa Antibody C, and FR57 at a range of concentrations, generally from 5x10 "8 M to 5x10’11 M. As a control of complete binding competition, non-biotinylated M9346A antibody was used. The mixture was added to 96-well plates containing 20,000 FRa-positive KB cells per well, and the plates were incubated on ice for one hour. The cells were than washed with cold phosphate buffered saline / 1% bovine serum albumin, and bound huM9346A-biotin was detected with a streptavidin-PE reagent The samples were analyzed using a FACSCalibur flow cytometer. As shown in FIG. 1, only control antibody M9346A competed with huM9346A-biotin for binding; none of the four analyzed FR- antibodies interfered with huM9346A-biotin for binding. |00385| Using the variable regions (VH and VL) of Bini and Bin 2 antibodies, several biparatopic molecules were constructed using two different formats: Morrison’s format and Asymmetric-Fc. Briefly, for Morrison’s format based molecules, sequences corresponding to the VH and VL region of either Bini or Bin2 antibodies were connected by a (G4S)4 linker to create a single chain fragment (scFv) which was then fused to the C or N-terminus of the heavy chain of either Bin 2 or Bini IgGl using a (G4S)3 linker. The asymmetric-Fc based biparatopic molecules were created with FR57scFv and Movl9 Fab using the Knobs-in-holes technology (Protein Eng. 1996 Jul;9(7):617-21.'Knobs-into-holes' engineering of antibody CH3 domains for heavy chain heterodimerization. Ridgway JB, Presta LC, Carter, P). Briefly, FRl-57scFv was fused to an engineered Fc region containing the C220S (mutate unpaired cysteine to serine) and knob mutation (T366W); and the Movl9 Fab region to an engineered Fc containing the hole mutation (T366S, L368A and Y407V). Unless otherwise noted, all numberings are based on the EU system. FIG. 2 shows the various antibody formats evaluated in subsequent experiments. |00386| The sequences of certain constructed molecules are provided in Tables 6-7. The genes corresponding to these bispecific antibodies were codon-optimized, synthesized and cloned into plasmids using standard molecular biology techniques. The ratio of the light and heavy chain plasmids for transfections was kept at 1:3 for Morrison’s based molecules; and 9:3:1 (Movl9LC: Movl9 HC-hole:FR57scFv-knob) for asymmetric-Fc based molecules. As shown in FIG. 3, several heavy chain and light chain plasmid transfection ratios were explored for producing asymmetric-Fc based molecules, with the ratio of 9:3:1 showing a minimal amount of homodimers. 2026205205 01 Jul 2026
[00387] All the bi specific antibody molecules were produced transiently in 293 T. Briefly, for 293T transfections, the expression constructs were transiently produced in suspension adapted HEK-293T cells using PEI as transfection reagent in shake flasks. The PEI transient transfections were performed as previously described (Durocher et al., Nucleic Acids Res. 30(2):E9 (2002)), except the HEK-293T cells were grown in Freestyle 293 and the culture volume was left undiluted after the addition of the PEI-DNA complexes. The transfections were incubated for a week and harvested. Antibody Purification 1003881 The filtered supernatant was purified using a scheme that essentially consists of two chromatography steps: protein A affinity and ceramic hydroxyapatite (CHT). Briefly, the filtered supernatant was loaded on a protein A column which had been pre-equilibrated with IX PBS (pH 7.3±0.1). The column was washed with IX PBS (pH 7.3±0.1) to reduce nonspecific host cell proteins. The bound antibody was eluted using 25mM acetic acid containing 50mM sodium chloride (pH 3.2) and neutralized immediately with IM Tris-base to a pH of 7.0±0,2. The neutralized pool was diluted 1:10 in CHT binding buffer (15mM sodium phosphate, pH 7.0±0.1) and loaded onto a Type II CHT column (40 pm particle size) preequilibrated with CHT binding buffer. The bound protein was eluted using a linear gradient (15mM to 160mM sodium phosphate in 10 column volumes), and fractions of interest (high percent monomers by size exclusion chromatography, SEC) were pooled, dialyzed against IX PBS (pH 7.3±0.1), and filter sterilized. The final antibody concentration was determined by measuring absorbance at 280 nm and an extinction coefficient of 1.44 mL mg'1 cm'1. 100389] All the purification experiments were conducted on an AKTA purification system which was equipped with in-line UV, conductivity and pH probes. The SEC analysis was performed using an Agilent HPLC 1100 system by injecting 40 pg of a sample on a TSKgel G3000SWXL column (7.8 x 300 mm) which also had an in-line guard column (6.0 x 40 mm) to extend column life. The mobile phase contained 50 mm sodium phosphate buffer and 400 mm sodium perchlorate, the flow rate was 1.0 mL / min, and the elution isocratic. 2026205205 01 Jul 2026 Example 2. Effect of biparatopic antibody format on antibody production, stability, and functional activity Binding characteristics of parental (Bin 1 and Bin 2) antibodies
[00390] Table 10 summarizes the kinetic parameters of binding of Bini and Bin 2 antibodies with recombinant FRa antigen. KD values were obtained via biolayer interferometry performed on Octet96 system (Fortebio) essentially according to manufacturer’s recommended procedure. Briefly, anti-human- or anti-murine -Fc sensors were presoaked in IX Kinetic Buffer (Fortebio) for 10 min and incubated with 5 pg / mL of either Bin 1 or Bin 2 IgG for 5 min The sensors were then sequentially moved to 1X Kinetic Buffer for 5 min to determine baseline, serial dilutions of antigen for association (10 min), and IX Kinetic Buffer for dissociation (10 min). The raw data was collected, processed and fitted to a simple 1:1 binding model using Fortebio analysis software to determine the kinetic parameters Kon and Koff. Table 10. Name KD (M) Kon (1 / Ms) Koff(l / s) Movl9 (Bin 1) 6x10'10 5xl05 3x1 O'4 FR57 (Bin 2) lx IO'9 3xl05 4x1 O'4 FRa Antibody A (Bin 2) 4x1 O'9 IxlO5 4x1 O'4 FRa Antibody B (Bin 2) lx IO’8 3xl05 4x10’3 FRa Antibody C (Bin 2) 3x1 O'9 3xl05 7x1 O'4 Stability of biparatopic antibodies 1003911 Biparatopic antibodies were created by combining Mov 19 antibody with an antibody recognizing another nonoverlapping epitope. In particular, IgGs based on Morrison’s format were generated by fusing scFv from one of the Bin IgGs to the C or N terminus of an IgG from another bin. Table 11 lists all the combinations which were explored. The scFvs fused to the C-terminus were in VH-VL orientation; and those fused to the N-terminus were in VL-VH orientation. Movl9 was explored as a scFv only on the C-terminus in both VH-VL and VL-VH orientations with or without Brinkmann’s VH44- 2026205205 01 Jul 2026 VL100 disulfide stabilizing mutations (PNAS 1993 August; 90 (16): 7538-754. A recombinant immunotoxin containing a disulfide-stabilized Fv fragment. U Brinkmann, Y Reiter, S H Jung, B Lee, and I Pastan). Table 11. Name Titer (mg / L): 293T % Monomer post protein A Change in %monomer over 1 week scFv location Morrison's format Movl9 -Gl-FRa Antibody-A-scFvl * 2.35 93 >5% C-terminus Movl9 -Gl-FRa-Antibody-B-scFvl 2.24 <70 C-terminus Movl9 -Gl-FRa- Antibody-C-scFvl 0.4 <70 C-terminus Movl9-Gl- FR57scFvl* 4.43 91 <0.1% C-terminus F Ra-Antibody-A- Gl-Movl9scFvl* 6.37 75 C-terminus FRa-Antibody-B- Gl-Movl9scFvl 9.35 <70 C-terminus FRa-Antibody-C -Gl-Movl9scFvl 10.1 <70 C-terminus FRa-Antibody-C-Gl-Movl9scFv2 1.38 <70 C-terminus FRa-Antibody-C -Gl-Movl9scFv3 2.78 <70 C-terminus 2026205205 01 Jul 2026 FR57-G1- Movl9scFvl* 5 73 >5% C-terminus F Ra-Antibody-A-scFv2-Gl-Movl9* 11.2 72 >5% N-terminus FRa- Antibody -B-scFv2-Gl-Movl9* 12.0 89 >5% N-terminus FRa-Antibody-C -scFv2-Gl -Mov 19* 6.2 83 >5% N-terminus FR57scFv2-Gl- Movl9* 13.3 90 <0.1% N-terminus Asymmctric-Fc FR57scFv2-knob / Movl9-hole 26 87 N.A FR57scFv3wt-knob / Movl9-hole 15 70 N.A 1003921 As shown in Table 9, a significant number of biparatopic molecules based on Morrison’s format had low percent monomers post-protein A affinity purification. Since scalability or manufacturability could be a challenge for constructs with low percent monomer or titer, eight constructs (indicated by asterisks in Table 9) that exhibited higher titers and % monomers greater than 70 were selected for further evaluation These eight constructs were further polished using ceramic hydroxyapatite chromatography to greater than 95% purity and subjected to further characterization. To account for the effects of overall molecule conformation or potential structural changes of the scFv arms on the binding of the biparatopic arms, the binding efficiency of each arm of the eight Morrison’s constructs was assayed by a competition FACS assay. Briefly, FRa-positive T47D cells were incubated with 0.8 nM of a Morrison’s antibody mixed with a corresponding murine parental antibody at a range of concentrations, generally from 50 nM to 0.2 nM. After incubation on ice for 2 hours, cells were washed from unbound antibodies, and bound Morrison’s antibody was 2026205205 01 Jul 2026 detected with secondary anti-human FITC-labeled antibody. Reduced binding of the Morrison’s antibody in the presence of increasing concentration of the parental antibody indicated an effect on binding of the second set of arms. As shown in FIGs. 4A-4H and Table 12, five out of eight Morrison’s antibodies had either completely inactive or partially affected arms. Among the three Morrison’s antibodies having both sets of functional arms, two antibodies (FRa-Antibody-A-scFv2-Movl9-IgGl and FRa-Antibody-C-scFv2-Movl9-IgGl) exhibited stability issues. Based on these data, FR57scFv2-Movl9-IgGl (“Tetravalent”) was selected for further evaluation. Table 12. Tetraval ent Ab Arm binding (according to competition FACS) Fab scFv Mov 19 :FRa-Antibody-A-scFv Active Inactive FRa-Antibody-A:Movl9scFv Active Partially affected Movl9:FR57scFv Active Partially affected FR57:Movl9scFv Active Inactive FRa-Antibody-A-scFv: Mov 19 Active Active FRa-Antibody-B-scFv: Mov 19 Partially affected Active FRa-Antibody-C-scFv: Mov 19 Active Active FR57scFv:Movl9 Active Active 100393] In a separate experiment, two bi paratopic molecules based on the asymmetric-Fc format (FR57scFv2-knob-Movl9-hole and FR57scFv3wt-knob-Movl9-hole) were also expressed. FR57scFv2-knob-Movl9-hole (“KIH”) exhibited higher % monomer and titer and was selected for further evaluation. As shown in FIG. 5, this molecule runs as a single band (corresponding to ~125 kDa) in gel electrophoresis under non-reducing conditions and breaks down into 3 bands (one corresponding to light chain (~25 kDa) and two corresponding to heavy chains (FR57scFv-Fc-knob and Movl9-HC-hole) of similar size (~ 50 kDa each)) 2026205205 01 Jul 2026 under reducing conditions. These results suggest that FR57scFv2-knob-Movl9-hole is assembled correctly in cell-culture and does not fall apart during purification. 100394] Next, the stability of the FR57scFv2-knob-Movl9-hole molecule was assessed by heating the molecule at 40°C (cone: 10 mg / mL in 1X PBS) for 2 weeks and performing an SEC analysis essentially using the procedures described in Example 1. FIG. 6 shows the SEC overlay of a Day 0 and Day 14 sample. In particular, no aggregation or cleavage was observed, suggesting good stability of the molecule. Antibody binding and processing 100395| The effect of antibody format on antibody binding and processing was assessed in vitro with using 3[H]-antibodies. Briefly, FRa-positive KB cells were exposed to a saturating concentration of the parental, KIH biparatopic, or Morrison’s antibody for 30 min at 37°C, washed in PBS to remove any unbound antibody, resuspended in fresh culture medium, and incubated at 37°C in a humidified 6% CO2 atmosphere for 22 h. The amount of protein-free radioactivity (processed antibody) and protein-associated radioactivity (unprocessed antibody) was assessed following acetone extraction and liquid scintillation counting, and the data were used to calculate the antibody binding sites per cell (ABC), % processed antibody, and amount of processed antibody. A preliminary experiment showed that processing of the parental antibodies M9346A and huFR57 was similar. Accordingly, only one parental antibody (M9346A) was used in further experiments.
[00396] Both biparatopic formats (KIH and tetravalent) showed increased amount of antibody processed compared to the parental antibody (FIGs. 7C and 7D). Intriguingly, mechanisms of improved delivery / processing of the two biparatopic formats were different. The KIH biparatopic antibody had higher ABC and similar internalization efficiency as the monospecific parental antibody (FIGs. 7A-7D), while the Morrison’s tetravalent antibody showed improved internalization efficiency with ABC values comparable to the parental antibody (FIGs.7C and 7D). The amount of antibody degraded for the two biparatopic formats was similar (FIGs. 7E and 7F) Example 3. Preparation of biparatopic FRa-targeting immunoconjugates Preparation of FR57scfv-huMovl9-sulfo-SPDB-DM4 conjugates 100397] The molar concentration of FR57scfv-huMovl9, sulfo-SPDB, and DM4 were calculated according to Beer’s law using the UV / Vis absorbance values at 280, 343, and 412 2026205205 01 Jul 2026 nm and the extinction coefficients respectively. The linker concentration was determined by reacting the linker with 25 mM DTT in 50 mM potassium phosphate buffer, 50 mM sodium chloride with 2 mM EDTA at pH 7.5 and measuring thiopyridine release at 343 nm. The drug concentration was determined by reacting DM4 with 10 mM DTNB [5,5-dithiobis-(2-nitrobenzoic acid)] in 50 mM potassium phosphate buffer, 50 mM sodium chloride with 2 mM EDTA at pH 7.5 and measuring absorbance at 412 nm. 100398) Prior to antibody conjugation, sulfo-SPDB-DM4 in-situ mixture was prepared by reacting 1.5 mM sulfo-SPDB with 1.95 mM DM4 in 30% aqueous [15 mM potassium phosphate pH 7.6) and 70% organic [(N-N-dimethylacetamide, DMA, SAFC)] at 25°C for 90 min. During the conjugation reaction, a solution of 2.5 mg / mL of antibody was reacted with 8 to 8.5 -fold molar excess of sulfo-SPDB-DM4 over antibody in 15 mM potassium phosphate pH 7.6 with 10% DMA (v / v), for 15-20 hours at 25°C. The reaction was purified into 10 mM acetate, 9% sucrose, 0.01% Tween 20, pH 5.0 formulation buffer using Sephadex 25 desalting columns on AKTA and filtered through a syringe filter with a 0.22 pm PVDF membrane. )00399) The molar ratio of DM4 conjugated to antibody (DAR) and the percentage of unconjugated maytansinoid species were determined as described below. The purified conjugate was found to have 3.4 mol DM4 / mol antibody by UV-Vis, 99.8% monomer by SEC, and below 2% free drug by HPLC Hisep column analysis. 100400] DAR was determined by measuring the UV / Vis absorbance at 252 and 280 nm and calculating the Ab concentration and DM4 concentration using binomial equations that account for the contribution of each component. The amount of unbound maytansinoid present in the final FR57scfv-huMovl9-sulfo-SPDB-DM4 conjugate sample was calculated from the resulting peak areas observed in samples analyzed via HISEP column (25 cm x 4.6 mm, 5 pm). The percent free maytansinoid (% FM) present in the conjugate sample was calculated using the following equation: % Free Maytansinoid = (Reverse-phase PA 252 due to DM4) / (Reverse-phase PA 252 due to DM4 + Flow through PA 252 due to DM4) x 100%. Preparation of Knob-in-Hole (KIH)-FR57scfv-huMovl9-sulfo-SPDB-DM4 conjugate 100401] Prior to antibody conjugation, sulfo-SPDB-DM4 in-situ mixture was prepared by reacting 1.5 mM sulfo-SPDB with 1.95 mM DM4 in 30% aqueous [15 mM potassium phosphate pH 7.6) and 70% organic [(N-N-dimethylacetamide, DMA, SAFC)] at 25°C for 90 min. During the conjugation reaction, a solution of 3.0 mg / mL of antibody was reacted with 10-fold molar excess of sulfo-SPDB-DM4 over antibody in 15 mM potassium phosphate pH 2026205205 01 Jul 2026 7.6 with 11% DMA (v / v), for 15-20 hours at 25°C. The reaction was purified twice into 10 mM succinate, 250 mM glycine, 0.5% sucrose, 0.01% Tween 20, pH 5.5 formulation buffer using NAP desalting columns and filtered through a syringe filter with a 0.22 pm PVDF membrane. The purified conjugate was found to have 2.9 mol DM4 / mol antibody by UV-Vis, 90.6% monomer by SEC, and below 1% free drug by HPLC Hisep column analysis. Preparation of FR57scfv-huMovl9-DM21 conjugates
[00402] The molar concentration of FR57scfv-huMov 19, sulfo-GMBS, and DM2 1 were calculated according to Beer’s law using the UV / Vis absorbance values at 280, 343, and 412 nm and extinction coefficients respectively. The linker concentration was determined by reacting the linker with 50 mM DTT in 25 mM DTT in 50 mM potassium phosphate buffer, 50 mM sodium chloride with 2 mM EDTA at pH 7.5 and measuring thiopyridine release at 343 nm. The drug concentration was determined by reacting DM21 with 10 mM DTNB [5,5-dithiobis-(2-nitrobenzoic acid)] in 50 mM potassium phosphate buffer, 50 mM sodium chloride with 2mM EDTA at pH 7.5 and measuring absorbance at 412 nm 100403] Prior to conjugation, sulfo-GMBS-DM21 in-situ mixture was prepared by reacting 1.5mM sulfo-GMBS with 1,95 mM DM21 in 60 / 40 (v / v) DMA and succinate buffer pH 5.0 respectively. The conjugation was carried out with 6.5 linker excess of sulfo-GMBS-DM21 over antibody at 2.5 mg / mL in 60 mM 4-(2-Hydroxyethyl)-l-piperazinepropanesulfonic acid (EPPS) pH 8.0 with 10% DMA (v / v). After a 20-22 hour incubation at 25°C, the reaction was purified into 10 mM succinate, 250 mM glycine, 0.5% sucrose, 0.01% Tween 20, pH 5.5 using NAP desalting columns and filtered through a 0.22 pm PVDF membrane filter. 1004041 The molar ratio of DM21 conjugated to antibody (DAR) and the percentage of unconjugated maytansinoid species were determined as described below. The purified conjugate was found to have 3.7 mol DM21 / mol antibody by UV-Vis, 98% monomer by SEC, and below 2 % free drug by HPLC Hisep column analysis. |00405| The molar ratio of DM21 conjugated to antibody (DAR) was determined by measuring the UV / Vis absorbance at 252 and 280 nm and calculating the Ab concentration and DM21 concentration using binomial equations that account for the contribution of each component. The amount of unbound maytansinoid present in the final FR57scfv-huMovl9-GMBS-DM21L conjugate sample was calculated from the resulting peak areas observed in samples analyzed via HISEP column (25 cm x 4.6 mm, 5 pm). The percent free maytansinoid (% FM) present in the conjugate sample was calculated using the following equation: % Free Maytansinoid = (Reverse-phase PA 252 due to DM21) / (Reverse-phase PA 252 due to DM21 + Flow through PA 252 due to DM21) x 100%. 2026205205 01 Jul 2026 Preparation of - Knob-in-Hole (KIH)-FR57scfv-huMovl9-GMBS-DM21L conjugates
[00406] Initial batches of KIH-FR57scfv-huMov 19-GMBS-DM2 IL were prepared using lower concentrations of drug and linker in the in-situ mixture and lower antibody concentration during the conjugation process. Briefly, prior to conjugation, sulfo-GMBS-DM21 in-situ mixture was prepared by reacting 1.5 mM sulfo-GMBS with 1.95 mM DM21 in 60 / 40 (v / v) DMA and succinate buffer pH 5.0, respectively. The conjugation was carried out with 7.5 linker excess of sulfo-GMBS-DM21 over antibody at 2.5 mg / mL in 60 mM 4-(2-Hydroxyethyl)-1-piperazinepropanesulfonic acid (EPPS) pH 8.0 with 10% DMA (v / v). After a 20-22 hour incubation at 25°C, the reaction was purified twice into 10 mM succinate, 250 mM glycine, 0.5% sucrose, 0.01% Tween 20, pH 5.5 using NAP desalting columns and filtered through a 0.22 pm PVDF membrane filter. The purified conjugate was found to have 3.1 mol DM21 / mol antibody by UV-Vis, 99.1% monomer by SEC, and below 2 % free drug by HPLC Hisep column analysis. 100407] Later batches of KIH-FR57scfv-huMovl9-GMBS-DM21L for use in pharmacokinetic and efficacy studies were prepared using higher concentrations of drug and linker in the in-situ mixture and higher antibody concentration during the conjugation process. Briefly, prior to conjugation, sulfo-GMBS-DM21 in-situ mixture was prepared by reacting 3 mM sulfo-GMBS with 3.9 mM DM21 in 60 / 40 (v / v) DMA and succinate buffer pH 5.0 respectively. The conjugation was carried out with 6.5-7 linker excess of sulfo-GMBS-DM21 over antibody at 5.7-6 mg / mL in 60 mM 4-(2-Hydroxyethyl)-l-piperazinepropanesulfonic acid (EPPS) pH 8.0 with 10% DMA (v / v). After a 20-22 hour incubation at 25°C, the reaction was purified into 10 mM succinate, 250 mM glycine, 0.5% sucrose, 0.01% Tween 20, pH 5.5 using Sephadex-25 desalting columns on AKTA and filtered through a 0.22 pm PVDF membrane filter. The purified conjugate was found to have 3.1 mol DM21 / mol antibody by UV-Vis, 98.7% monomer by SEC, and below 2 % free ding by HPLC Hisep column analysis. 100408| A composition comprising the KIH-FR57scfv-huMovl9-GMBS-DM2IL construct with a DAR of 3 5 is referred to as “IMGN151 ” Example 4. Effect of biparatopic antibody format on immunoconjugate efficacy In vitro cytotoxicity of biparatopic immunoconjueates 100409] The effect of the biparatopic antibody format on immunoconjugate cytotoxicity was assessed in vitro using KB, Igrov-1, and T47D cells. Sulfo-SPDB-DM4 conjugates of 2026205205 01 Jul 2026 the parental, KIH, and Morrison’s antibodies were prepared according to the methods described in Example 3 The conjugates were diluted in the appropriate culture medium and added to wells of 96-well flat-bottom plates containing 1 x 103 cells / well. The plates were incubated at 37°C, 6% CO? for 5 days. Cell viability was determined by the WST-8 assay in accordance with the manufacturer’s protocol, and IC50 were generated using a sigmoidal dose-response (variable slope) nonlinear regression curve fit (GraphPad Software Inc). Table 13 Cell Line FRa Density (X 1000), anti- FRa conventional Ab-PE FACS Ab-suIfo-SPDB-DM4, IC50, nM Parental (M9346A) Bivalent, KIH Tetravalent, Morrison KB - 4,000 0.1 0.09 0.07 Igrov-1 500 2.0 0.2 0.2 T47D 100 20.0 0.2 1.0 |00410| Both of the biparatopic sulfo-SPDB-DM4 conjugates were more active than the parental antibody conjugate against two out of the three tested moderate to low FRa-expressing cell lines (Igrov-1 and T47D). The only cell line equally sensitive to the three conjugates was KB, which has very high level of target expression. The KIH conjugate demonstrated greater cytotoxic activity than the Morrison’s format conjugate against the T47D cell line (i.e., cells with lowest level of target expression). However, both KIH conjugate and the Morrison’s format conjugate were equally active against two other lines analyzed. In vivo anti-tumor activity of a tetraval ent biparatopic ADC in SCID mice bearing OV-90 human ovarian carcinoma xenografts [00411 ] The effect of the tetravalent biparatopic antibody format on immunoconjugate therapeutic efficacy was assessed in vivo using an OV-90 xenograft model. Mice were randomized into groups (n = 6 per group) by tumor volume and subsequently dosed on day 7 post inoculation. The groups included a control group dosed with formulation buffer, Tetravalent-s-SPDB-DM4 at 2.5 and 5 mg / kg and M-S-SPDB-DM4 at 2.5 and 5 mg / kg. All 2026205205 01 Jul 2026 mice were administered a single intravenous dose of the above compounds. The study was terminated on day 80 post inoculation 100412] Tumor volumes were measured two times per week in three dimensions using a caliper. The volume was expressed in mm3 using the formula Volume = % (Length x Width x Height) (Cancer Chemother. Pharmacol. 1989(24): 148-154. Determination of subcutaneous tumor size in athymic (nude) mice. MM Tomayko and CP Reynolds). Body weights were measured twice per week as a rough index of test agent toxicity. Activity was assessed as described in Cancer Res. 1991 Sept. (51): 4845-4852. Experimental Antitumor Activity of Taxotere (RP 56976, NSC 628503), a Taxol Analogue. M Bissery, D Guenard, F Gueritte-Voegelein, et al. |00413] The results of the study are shown in FIG. 8 and Table 14. The Tetraval ent-s-SPDB-DM4 conjugate was active at both the 2.5 and 5 mg / kg doses, with T / Cs of 13% and 11%, respectively. The 2.5 mg / kg dose had a T-C of 32 days, LCK of 1 25 (active), 2 / 6 PRs and 0 / 6 CRs. The 5 mg / kg dose had a T-C of 47 days, LCK of 1.84 (active), 2 / 6 PRs, 2 / 6 CRs and 1 / 6 TFS The M-S-SPDB-DM4 conjugate was active at the 2.5 mg / kg dose with a T / C of 26% and highly active at the 5 mg / kg dose with a T / C of 3%. The 2.5 mg / kg dose had a T-C of 25 days, LCK of 0.98 (inactive) and no regressions. The T-C and LCK could not be determined for the 5 mg / kg group due to necrosis at low tumor volumes. However, there were 4 / 6 PR, 3 / 6 CRs and 3 / 6 TFS in the group. There was minimal body weight losses of 25% in all groups of the study with nadir on day 13 post inoculation. Results from this study indicate that the tetravalent ADC format does not provide an improvement in activity over the parental conjugate. Table 14 Group (s- SPDB-DM4) Ab Dose (mg / kg) % T / C (D27) PR CR Result Tetravalent 2.5 13% 2 / 6 0 / 6 Active Tetravalent 5 11% 2 / 6 2 / 6 Active M 2.5 26% 0 / 6 0 / 6 Active M 5 3% 4 / 6 3 / 6 Highly Active 2026205205 01 Jul 2026 In vivo anti-tumor activity of a tetravalent biparatopic ADC in SCID mice bearing IGROV-1 human ovarian carcinoma xenografts 100414] The effect of the tetravalent biparatopic antibody format on immunoconjugate therapeutic efficacy was assessed in vivo using an IGROV-1 xenograft model. Mice were randomized into groups (n = 8 per group) by tumor volume and subsequently dosed on day 11 post inoculation. The groups included a control group dosed with formulation buffer, Tetravalent-s-SPDB-DM4 at 100 pg / kg and M-S-SPDB-DM4 at 100 pg / kg. To account for possible under-dosing of the tetravalent conjugate due to differences in molecular weight between the tetravalent antibody and the parental antibody (i.e, a difference of 50 kDa), doses were normalized by payload in this study and all further studies. All mice were administered a single intravenous dose of the above compounds. The study was terminated on day 81 post inoculation. Tumor measurements and calculations were determined as described in the subsection above (“In vivo anti-tumor activity of a tetravalent biparatopic ADC in SCID mice bearing OV-90 human ovarian carcinoma xenografts”). 100415| The results of the study are shown in FIG. 9 and Table 15. The Tetraval ent-s-SPDB-DM4 and parental M-S-SPDB-DM4 conjugates were both active at 100 pg / kg, with T / Cs of 21% and 15%, respectively. T-C and LCK could not be determined for either group due to necrosis at low tumor volumes. The tetravalent conjugate had 2 / 8 PRs, 1 / 8 CR and 0 / 8 TFS, while the M-S-SPDB-DM4 had 3 / 8 PRs, 1 / 8 CR and 0 / 8 TFS. There was minimal weight loss for most groups in the study with the exception of the 100 pg / kg tetravalent ADC, which had 8% body weight loss at nadir on day 14 post inoculation. Again, results from this study indicate that the tetravalent ADC format does not provide an improvement in activity over the parental conjugate. Table 15 Group (S-SPDB-DM4) DM Dose (gg / kg) %T / C (D31) PR CR Result Tetravalent 100 21% 2 / 8 1 / 8 Active M 100 15% 3 / 8 1 / 8 Active In vivo anti-tumor activity of a KIH biparatopic ADC in SCID mice bearing OV-90 human ovarian carcinoma xenografts 2026205205 01 Jul 2026
[00416] The effect of the KIH biparatopic antibody format on immunoconjugate therapeutic efficacy was assessed in vivo using an OV-90 xenograft model. Mice were randomized into groups (n = 6 per group) by tumor volume and subsequently dosed on day 7 post inoculation. The groups included a control group dosed with formulation buffer, KIH-s-SPDB-DM4 at 40, 20 and 10 pg / kg and M-S-SPDB-DM4 at 20 pg / kg. All mice were administered a single intravenous dose of the above compounds. The study was terminated on day 80 post inoculation. Tumor measurements and calculations were determined as described in subsection “In vivo anti-tumor activity of a tetravalent biparatopic ADC in SCID mice bearing OV-90 human ovarian carcinoma xenografts”. 100417] The results of the study are shown in FIG. 10 and Table 16. The KIH-s-SPDB-DM4 conjugate was highly active at 40 pg / kg, active at 20 pg / kg and inactive at 10 pg / kg, with T / Cs of 6%, 12% and 83%, respectively. The 40 pg / kg dose group had a T-C of 29 days, LCK of 1.84 (active), 3 / 6 PRs, 2 / 6 CRs and 0 / 6 TFS. The 20 pg / kg dose group had a T-C of 38 days, LCK of 1.32 (active) and no regressions. The 10 pg / kg group had a T-C of 2 days, LCK of 0.09 (inactive) and no regressions. The parental M-S-SPDB-DM4 conjugate was inactive at 20 pg / kg with a T / C of 81% and no regressions. T-C and LCK could not be determined for this group due to necrosis at low tumor volumes. There was no body weight loss observed in this study. In contrast to the studies performed with the tetravalent conjugate, KIH-S-SPDB-DM4 was shown to be appreciably more active than the M-S-SPDB-DM4. Based on the results of these studies, the KIH format was selected over the tetravalent format for further evaluation. Table 16. Group (s-SPDB-DM4), effector dose %T / C Regressions Results Partial Complete KIH 40 pg / kg 6% 3 / 6 2 / 6 Highly Active KIH 20 pg / kg 12% 0 / 6 0 / 6 Active KIH 10 pg / kg 83% 0 / 6 0 / 6 Inactive M 20 pg / kg 81% 0 / 6 0 / 6 Inactive 2026205205 01 Jul 2026 Example 5. In vitro activity of a Knob-in-hole biparatopic antibody conjugated to DM21 In vitro cytotoxicity of a Knob-in-holc biparatopic antibody conjugated to DM21
[00418] The in vitro cytotoxicity of a KIH biparatopic antibody conjugated to DM21 was assessed in multiple cell lines according to the protocol described in Example 4 (“In vitro cytotoxicity of biparatopic immunoconjugates”). In an earlier study, the activity of two parental DM21 conjugates (M-DM21 and huFR57-DM21) was shown to be very similar (FIG. 11). In all further studies, the activity of KIH-DM21 was compared to conjugates of the parental M antibody (M-S-SPDB-DM4 and M-DM21) to assess the contribution of the biparatopic format and DM21 payload to overall cytotoxicity of KIH-DM21. |00419| KIH-DM21 was appreciably more active than the two parental conjugates against three out of the five cell lines tested (Igrov-1, T47D and JHOS-4). (FIGs. 12A-12E.) Additionally, the two conjugates with the DM21 linker / payload (KIH-DM21 and M-DM21) were similarly active against Jeg-3 cells, while the M-S-SPDB-DM4 conjugate demonstrated less activity against this cell line. Only one cell line (KB), which exhibits the highest FRa level of expression, was similarly sensitive to all three conjugates. Accordingly, these results show that KIH-DM21 exhibits increased activity against most tested cell lines relative to conjugates of the parent antibody (M-S-SPDB-DM4 and M-DM21). |00420| Additionally, the binding, internalization, and processing of KIH-DM21 and the parent monospecific antibodies were compared using 3H-antibodies. In tumor cells with medium (JHOS-4) and high (KB) FRa expression KIH-DM21 boosted antibody binding events and processing by 100% and 170%, respectively. Bystander killing activity of a Knob-in-hole biparatopic antibody conjugated to DM21 |00421 ] The ability of KIH-DM21 to kill FRa- cells in a mixed cell culture was assessed in vitro using multiple cell lines. Consistent with the other in vitro cytotoxicity experiments, the parental antibody conjugates M-DM21 and M-S-SPDB-DM4 were used as controls. Mixed cultures of target-positive cells (KB, Igrov-1, Jeg-3 or T47D) and target-negative cells Namalwa / luc (i.e., Namalwa cells expressing luciferase) were exposed to 0.5nM of the conjugates. This concentration of conjugate is not toxic to the target-negative cells when the cells are incubated alone. Various percentages of target-positive cells in the mixed cultures (from 9% to 50%) were then tested. After a 5 day exposure, the inhibition of cell 2026205205 01 Jul 2026 proliferation of target-negative cells in the mixture was determined by One Gio (Promega) according to the manufacturer’s protocol. Table 17 FRu+ cell line FRa expression (by FACS with conventional Ab-PE) % of FRa+ cells necessary to produce enough metabolites to kill 90% FRa+ cells IMGN853 M-DM21 KIH-DM21 KB -2,000,000 30 30 Less than 10 Igov-1 500,000 More than 50 35 10 Jeg-3 150,000 More than 50 40 40 T47D 100,000 More than 70 More than 70 65 100422] In all mixed cultures tested, KIH-DM21 had the highest bystander activity, followed by M-DM21. M-S-SPDB-DM4 was the least active conjugate, as shown in FIGs. 13A- 13Dand Table 17. |00423] Collectively, these data indicate that the KIH biparatopic format combined with the DM21 linker / payload results in increased in vitro efficacy relative to the parental antibody conjugated to DM21 or S-SPDB-DM4. Example 6. In vivo efficacy of a KIH biparatopic imniunoconjugate / n vivo anti-tumor activity of a KIH biparatopic ADCs in SCID mice bearing OV-90 human ovarian carcinoma xenografts |00424| The in vivo efficacy of KIH-DM21 was assessed and compared to KIH-s-SPDB-DM4 in an OV-90 xenograft model with low FRa expression (H-score of 30). Mice were randomized into groups (n = 6 per group) by tumor volume and subsequently dosed on day 7 post inoculation. The groups included a control group dosed with formulation buffer, KIH-s-SPDB-DM4 at 40, 20 and 10 gg / kg, KIH-DM21 at 40, 20 and 10 gg / kg, M-DM21 at 20 gg / kg and M-S-SPDB-DM4 at 20 gg / kg. All mice were administered a single intravenous dose of the above compounds. The study was terminated on day 80 post inoculation. Tumor measurements and calculations were determined as described in Example 4 subsection “In vivo anti-tumor activity of a tetravalent biparatopic ADC in SCID mice bearing OV-90 human ovarian carcinoma xenografts”. 2026205205 01 Jul 2026
[00425] The results of the study are shown in FIGs. 14A-14B and Table 18. The KIH-s-SPDB-DM4 40 pg / kg dose group had a T-C of 29 days, LCK of 1.84 (active), 3 / 6 PRs, 2 / 6 CRs and 0 / 6 TFS. The 20 pg / kg dose group had a T-C of 38 days, LCK of 1.32 (active) and no regressions. The 10 pg / kg group had a T-C of 2 days, LCK of 0.09 (inactive) and no regressions. The parental M-S-SPDB-DM4 conjugate was inactive at 20 pg / kg with a T / C of 81% and no regressions. T-C and LCK could not be determined for this group due to necrosis at low tumor volumes. The KIH-DM21 conjugate was highly active at all doses, with a T / C of 1% for the 40 pg / kg dose, 7% for the 20 pg / kg dose and 9% for the 10 pg / kg dose. The 40 pg / kg dose had a T-C of 53 days, LCK of 2.49 (active), 5 / 6 PRs, 5 / 6 CRs and 3 / 6 TFS. The 20 pg / kg dose had a T-C of 42 days, LCK of 1.98 (active), 3 / 6 PRs, 2 / 6 CRs and 1 / 6 TFS. The 10 pg / kg dose had 2 / 6 PRs and 0 / 6 CRs. T-C and LCK could not be determined for this group due to necrosis at low tumor volumes. The M-DM21 conjugate was active at 20 pg / kg with a T / C of 22%, T-C of 30 days, LCK of 1.41 (active) and no regressions. There was no body weight loss observed in this study. In summary, DM21 conjugates were more active than S-SPDB-DM4 conjugates in both the parental and KIH biparatopic formats in this study. In addition, the biparatopic KIH conjugates were more active than their parental counterparts at matching 20 pg / kg doses within the same linker / payload format. Based on these results, KIH-DM21 was selected forevaluation in additional xenograft models. Table 18. Group, effector dose %T / C Regressions Results Partial Complete KIH-DM21 40 pg / kg 1% 5 / 6 5 / 6 Highly Active KIH-DM21 20 pg / kg 7% 3 / 6 2 / 6 Highly Active KIH-DM21 10 pg / kg 9% 2 / 6 0 / 6 Highly Active KIH-S-SPDB-DM4 40 pg / kg 6% 3 / 6 2 / 6 Highly Active KIH-S-SPDB-DM4 20 pg / kg 12% 0 / 6 0 / 6 Active KIH-S-SPDB-DM4 10 pg / kg 83% 0 / 6 0 / 6 Inactive M-DM21 20 pg / kg 22% 0 / 6 0 / 6 Active M-S-SPDB-DM4 20 pg / kg 81% 0 / 6 0 / 6 Inactive 2026205205 01 Jul 2026 In vivo anti-tumor activity of a KIH biparatopic ADC in SCID mice bearing Ishikawa human endometrial adenocarcinoma xenografts 100426| The in vivo efficacy of a KIH biparatopic antibody conjugated to DM21 was assessed in an Ishikawa xenograft model with medium FRa expression (H-score of 100). 100427] Mice were randomized into groups (n = 6 per group) by tumor volume and subsequently dosed on day 11 post inoculation. The groups included a control group dosed with formulation buffer, KIH-DM21 at 100, 50 and 25 pg / kg, M-DM21 at 100 and 50 pg / kg and M-S-SPDB-DM4 at 100 pg / kg. All mice were administered a single intravenous dose of the above compounds. The study was terminated on day 90 post inoculation. Tumor measurements and calculations were determined as described in Example 4 subsection “In vivo anti-tumor activity of a tetravalent biparatopic ADC in SCID mice bearing OV-90 human ovarian carcinoma xenografts”. |00428| The results of the study are shown in FIG. 15 and Table 19. The KIH-DM21 conjugate was highly active at 100 and 50 pg / kg but inactive at 25 pg / kg, with a T / Cs of 0%, 9% and 78%, respectively. The 100 pg / kg dose had a T-C of > 63 days, LCK of > 3.33 (highly active), 6 / 6 PRs, 5 / 6 CRs and 4 / 6 TFS. The 50 pg / kg dose had 3 / 6 PRs and 0 / 6 CRs. The T-C and LCK could not be determined for this group due to necrosis at low tumor volumes. The 25 pg / kg dose had a T-C of 2 days, LCK of 0.11 (inactive) and no regressions. The M-DM21 conjugate was highly active at 130 pg / kg and active at 70 pg / kg, with T / Cs of 0% and 11%, respectively. The 130 pg / kg dose had a T-C of > 63 days, LCK of > 3.33 (highly active), 6 / 6 PRs, 6 / 6 CRs and 0 / 6 TFS. The 50 pg / kg dose had a T-C of 27 days, LCK of 1.43 (active), 4 / 6 PRs, 2 / 6 CRs and 0 / 6 TFS. The M-S-SPDB-DM4 conjugate at 100 pg / kg dose was highly active with a T / C of 1%, 6 / 6 PRs and 3 / 6 CRs. T-C and LCK could not be determined for this group due to necrosis at low tumor volumes. There was minimal body weight losses between 1-5% in all groups in the study. In summary, KIH-DM21 was appreciably more active than the parental conjugates M-DM21 and M-S-SPDB-DM4 when dosed at 100 pg / kg. Although all three conjugates were highly active at 100 pg / kg, the duration of the response was much longer for the KIH biparatopic ADC than for the parental antibody conjugates. Table 19 Group, effector dose %T / C Regressions TFS Results Partial Complete 2026205205 01 Jul 2026 KIH-DM21 100 pg / kg 0% 6 / 6 5 / 6 4 / 6 Highly Active KIH-DM21 50 pg / kg 9% 3 / 6 0 / 6 0 / 6 Highly Active KIH-DM21 25 pg / kg 78% 0 / 6 0 / 6 0 / 6 Inactive M-DM21 -130 pg / kg 0% 6 / 6 6 / 6 0 / 6 Highly Active M-DM21 ~70 pg / kg 11% 4 / 6 2 / 6 0 / 6 Active M-S-SPDB-DM4 100 Mg / kg 1% 6 / 6 0 / 6 0 / 6 Highly Active In vivo anti-tumor activity of a KIH biparatopic ADC in SCI!) mice bearing IGROV-1 human ovarian carcinoma xenografts 100429| The in vivo efficacy of a KIH biparatopic antibody conjugated to DM21 was assessed in an IGROV-1 xenograft model with medium FRa expression (H-score of 140). Mice were randomized into groups (n = 8 per group) by tumor volume and subsequently dosed on day 10 post inoculation. The groups included a control group dosed with formulation buffer, KIH-DM21 at 100 and 50 pg / kg, M-DM21 at 130 and 70 pg / kg and M-s-SPDB-DM4 at 100 and 50 pg / kg. All mice were administered a single intravenous dose of the above compounds. The study was terminated on day 120 post inoculation. Tumor measurements and calculations were determined as described in Example 4 subsection “In vivo anti-tumor activity of a tetravalent biparatopic ADC in SCID mice bearing OV-90 human ovarian carcinoma xenografts” 100430| The results of the study are shown in FIG. 16 and Table 20. The KIH-DM21 conjugate was active at both 100 and 50 pg / kg, with a T / Cs of 19% and 12%, respectively. The 100 pg / kg dose had aT-C of > 99 days, LCK of >2.87 (highly active), 7 / 8 PRs, 6 / 8 CRs and 0 / 8 TFS. The 50 pg / kg dose had a T-C of 53 days, LCK of 1.53 (active), 5 / 8 PRs, 3 / 8 CRs and 0 / 8 TFS. The M-DM21 conjugate was active at both 130 pg / kg and 70 pg / kg, with T / Cs of 13% and 16%, respectively. The 130 pg / kg dose had a T-C of > 99 days, LCK of > 2.87 (highly active), 8 / 8 PRs, 7 / 8 CRs and 2 / 8 TFS. The 70 pg / kg dose had a T-C of 36 days, LCK of 1.04 (active), 3 / 8 PRs, 2 / 8 CRs and 0 / 8 TFS. The M-S-SPDB-DM4 conjugate was active at both the 100 and 50 pg / kg doses, with T / Cs of 17% and 34%, respectively. The 100 pg / kg dose had a T-C of 23 days, LCK of 0.67 (inactive), 3 / 8 PRs, 2 / 8 CRs and 0 / 8 TFS. The 50 pg / kg dose had a T-C of 17 days, LCK of 0.49 (inactive) and no regressions. There was minimal body weight loss of 1-5% in most groups, with the exception of the M-DM21 at 50 2026205205 01 Jul 2026 pg / kg (6%) and M-S-SPDB-DM4 at 50 pg / kg (7%) at nadir on day 16 post-inoculation. In summary, the parental M-S-SPDB-DM4 conjugate exhibited less in vivo efficacy than the DM21 conjugates. Additionally, KIH-DM21 and the parental M-DM21 were similarly active at the two doses tested. Table 20 Group %T / C Regressions Results Partial Complete KIH-DM21 100 Pg / kg 19% 7 / 8 6 / 8 Active KIH-DM21 50 Pg / kg 12% 5 / 8 3 / 8 Active M-DM21 100 Mg / kg 13% 8 / 8 7 / 8 Active M-DM21 50 pg / kg 16% 3 / 8 2 / 8 Active M-S-SPDB-DM4 100 Pg / kg 17% 3 / 8 2 / 8 Active M-s_SPDB-DM4 50 pg / kg 34% 0 / 8 0 / 8 Active In vivo anti-tumor activity of a KIH biparatopic ADC in SCID mice bearing KB human cervical carcinoma xenografts 100431 ] The in vivo efficacy of a KIH biparatopic antibody conjugated to DM21 was assessed in a KB xenograft model with high FRo expression (H-score of 300). Mice were randomized into groups (n - 6 per group) by tumor volume and subsequently dosed on day 6 post inoculation when tumors reached -100 mm3. The groups included a control group dosed with formulation buffer, K1H-DM21 at 50 and 25 pg / kg, M-DM21 at 50 and 25 pg / kg and M-S-SPDB-DM4 at 50 and 25 pg / kg. All mice were administered a single intravenous dose of the above compounds. The study was terminated on day 120 post inoculation. Tumor measurements and calculations were determined as described in Example 4 subsection “In vivo anti-tumor activity of a tetravalent biparatopic ADC in SCID mice bearing OV-90 human ovarian carcinoma xenografts”. 2026205205 01 Jul 2026
[00432] The results of the study are shown in FIG. 17 and Table 21. The KIH-DM21 conjugate was highly active at both 50 and 25 gg / kg, with a T / Cs of 0%, T-Cs of >100 days and LCKs of > 6.41 (highly active) for both doses. The 100 gg / kg dose had 6 / 6 PRs, 6 / 6 CRs and 6 / 6 TFS while the 25 gg / kg dose had 6 / 6 PRs, 5 / 6 CRs and 5 / 6 TFS. The M-DM21 conjugate was highly active at both 50 gg / kg and 25 gg / kg, with T / Cs of 0% and 2%, respectively. Both doses had T-Cs of > 100 days and LCKs of > 6.41 (highly active). The 50 gg / kg dose had 6 / 6 PRs, 6 / 6 CRs and 6 / 6 TFS while the 25 gg / kg dose had 5 / 6 PRs, 4 / 6 CRs and 4 / 6 TFS. The M-S-SPDB-DM4 conjugate was highly active at both 50 and 25 gg / kg, with T / Cs of 0% and 8%, respectively. The 50 gg / kg dose had a T-C of > 100 days, LCK of > 6.41 (highly active), 6 / 6 PRs, 6 / 6 CRs and 5 / 6 TFS. The 25 gg / kg dose had a T-C of 24 days, LCK of 1.54 (active), 3 / 6 PRs, 1 / 6 CRs and 1 / 6 TFS. There was minimal body weight loss seen in the M-DM21 and M-S-SPDB-DM4 groups of 2-4% at nadir on day 8 post inoculation. In summary, the response of M-S-SPDB-DM4 at 25 gg / kg was transient, while administration of M-S-SPDB-DM4 at 50 gg / kg resulted in long-lasting complete regression in most mice. Administration of M-DM21 and KIH-DM21 at both the 25 gg / kg and 50 gg / kg doses resulted in long-lasting complete regression in most mice. 1004331 Collectively, the in vivo efficacy studies described here indicate that KIH-DM21 was the most active conjugate in most xenograft models tested, followed by M-DM21 and M-S-SPDB-DM4. Table 21 Group %T / C Regressions TFS Results Partial Complete KIH-DM21 50 gg / kg 0% 6 / 6 6 / 6 6 / 6 Highly Active KIH-DM21 25 gg / kg 0% 6 / 6 5 / 6 5 / 6 Highly Active M-DM21 50 Pg / kg 0% 6 / 6 6 / 6 6 / 6 Highly Active M-DM21 25 Pg / kg 2% 5 / 6 4 / 6 4 / 6 Highly Active M-s-SPDB- DM4 50 0% 6 / 6 6 / 6 5 / 6 Highly Active 2026205205 01 Jul 2026 Mg^g M-s-SPDB- DM4 25 8% 3 / 6 1 / 6 1 / 6 Highly Active In vivo anti-tumor activity of a KIH bi paratopic ADC in SCID mice bearinn IMGN853-resistant KB human cervical carcinoma xenografts
[00434] The in vivo efficacy of a KIH biparatopic antibody conjugated to DM21 was assessed in an lMGN853-resistant KB xenograft model. Parental KB cells were grown in the presence of 1 nM DM I -Me. After a stably grown culture was established, cells were subcloned and clones were grown, characterized and frozen. Subclone 6A was selected for this study and mice were inoculated subcutaneously. Mice were randomized into groups (n = 6 per group) by tumor volume and subsequently dosed on day 5 post inoculation when tumors reached -100 mm3. The groups included a control group dosed with formulation buffer, KIH-L-DM21 at 40 and 20 pg / kg, M-L-DM21 at 40 and 20 pg / kg and M-s-SPDB-DM4 at 40 and 20 pg / kg. All mice were administered a single intravenous dose of the above compounds. The study was terminated on day 78 post inoculation. Tumor measurements and calculations were determined as described in the OV-90 human ovarian carcinoma xenografts experiments above. |00435] The results of the study are shown in Figure 19 and Table 22. The KIH-L-DM21 conjugate was highly active at both 40 and 20 pg / kg, with a T / Cs of 0%. The 40 pg / kg dose group had a T-C of >60 days, LCKs of > 3.41 (highly active), 6 / 6 PRs, 6 / 6 CRs and 6 / 6 TFS. The 20 pg / kg dosing group had a T-C of 46 days, LCK of 2.61 (active), 6 / 6 PRs, 4 / 6 CRs and 1 / 6 TFS. The M-L-DM21 conjugate was highly active at both 40 pg / kg and 20 pg / kg, with T / Cs of 0% and 2%, respectively. The 40 pg / kg dose group had a T-C of > 60 days, LCKs of > 3.41 (highly active), 6 / 6 PRs, 6 / 6 CRs and 6 / 6 TFS. The 20 pg / kg dose group had a T-C of 28 days, LCK of 1.59 (active), 5 / 6 PRs, 2 / 6 CRs and 2 / 6 TFS. The M-S-SPDB-DM4 conjugate was highly active at 40 pg / kg but inactive at 20 pg / kg, with T / Cs of 0% and 63%, respectively. The 40 pg / kg dose had a T-C of 41 days, LCK of 2.33 (active), 6 / 6 PRs, 6 / 6 CRs and 0 / 6 TFS The 20 pg / kg dose had a T-C of 6 days, LCK of 0.34 (inactive), 0 / 6 PRs, 0 / 6 CRs and 0 / 6 TFS. There was minimal body weight loss seen in the KIH-L-DM21 20 pg / kg group, with 3% lost at nadir on day 8 post inoculation. In summary, KIH-L-DM21 was 2026205205 01 Jul 2026 comparably efficacious to M-L-DM21 and both KIH-L-DM21 and M-L-DM21 were more efficacious than M-S-SPDB-DM4 in this model. Table 22. Group %T / C Regressions TFS Results Partial Complete KIH-L-DM21 40 0% 6 / 6 6 / 6 6 / 6 Highly Active KIH-L-DM21 20 0% 6 / 6 4 / 6 1 / 6 Highly Active M-L-DM21 40 0% 6 / 6 6 / 6 6 / 6 Highly Active M-L-DM21 20 2% 5 / 6 2 / 6 2 / 6 Highly Active M-S-SPDB-DM4 40 0% 6 / 6 6 / 6 0 / 6 Highly Active M-S-SPDB-DM4 20 63% 0 / 6 0 / 6 0 / 6 Inactive Example 7. Biparatopic immunoconjugate pharmacokinetics and tolerability
[00436] The toxicity and toxicokinetic profile of a biparatopic FRa-targeting immunoconjugate was assessed in cynomolgus monkey following a single dose Briefly, KIH-DM21 was administered as a 10 minute slow bolus infusion at dose levels of 10 or 13 mg / kg to two male monkeys / dose level. The animals were observed out to 28-days postdose to evaluate the recovery, persistence or progression of any effects. Body weights, clinical observations, and food consumption were evaluated, and blood samples were collected for clinical pathology parameters (hematology, serum chemistry, and coagulation) and toxicokinetic parameters. |00437] All animals survived until the end of the study. There were no KIH-DM21 related effects on body weights, hematology, or serum chemistry parameters. KIH-DM21-related clinical observations noted in a single 10 Ab mg / kg group animal were reddened hind limb on Days 8 and 12, with no clinical findings noted for the remainder of the nondosing period. 2026205205 01 Jul 2026 KIH L DM21 related higher fibrinogen values were noted on Days 4 and 8 in both dose groups. Values were similar to pretreatment values by end of the nondosing period (Day 29). 1004381 K1H-DM21 ADC shows biphasic pharmacokinetics following a single intravenous administration to monkeys. The mean terminal phase 11 / 2 of ADC was 156 hours at 10 mg / kg dose. The mean tl / 2 for total antibody (TAb) was longer than that observed for the ADC (184 hours at 10 mg / kg dose). Comparisons of ADC and TAb concentration time profile indicated that the KIH-DM21 immunoconjugate was more stable than IMGN853 at a 10 mg / kg dose. KIH-DM21 has a longer terminal phase half-life and larger exposure metrics (AUCco value) than IMGN853 at 10 mg / kg dose. Table 23 PK parameters FRa biparatopic ADC IMGN853 Dose Group 10 mg / kg (N=2, m) 10 mg / kg (N=10) ADC Tab ADC TAb Half-life (hr) 156 184 98.2 168.9 AUCo-inf (hr* pg / mL) 35,400 42,200 25,583 30,587 100439] As shown in FIGs. 18A and 18B, the FRa biparatopic immunoconjugate and IMGN853 were both well tolerated at 10 and mg / kg, and the biparatopic immunoconjugate was similarly well tolerated at 13 mg / kg. Additionally, as shown in Table 23, the FRa biparatopic immunoconjugate was more stable than IMGN853 at a 10 mg / kg dose. In particular, the biparatopic immunoconjugate exhibited a terminal half-life -60 hours longer than IMGN853 and a total exposure-40% higher than IMGN853.
Claims
1. A biparatopic antibody or antigen binding fragment thereof that specifically binds a human folate receptor 1 (FRa), wherein the antibody or antigen-binding fragment comprises.(a) a first FRa-binding domain that comprises a first variable heavy chain (VH) and a first variable light chain (VL) and that bind to a first epitope of FRa, and(b) a second FRa-binding domain that comprises a second VH and a second VL and that binds to a second epitope of FRa.
2. The biparatopic antibody or antigen binding fragment thereof of claim 1, wherein the first FRa-binding domain specifically binds to the same FRa epitope as an antibody comprising a VH amino acid sequence selected from the group consisting of SEQ ID NOs:24, 25, 26, and 57, and a VL amino acid sequence selected from the group consisting of SEQ ID NOs:19, 20, and 21,3. The biparatopic antibody or antigen binding fragment thereof of claim 1, wherein the first FRa-binding domain competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence selected from the group consisting of SEQ ID NOs:24, 25, 26, and 57, and a VL amino acid sequence selected from the group consisting of SEQ ID NOs:19, 20, and 21.
4. The biparatopic antibody or antigen binding fragment thereof of any one of claims 13, wherein the second FRa-binding domain specifically binds to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:22 or 23 and a VL amino acid sequence of SEQ ID NO: 17 or 185. The biparatopic antibody or antigen binding fragment thereof of any one of claims 13, wherein the second FRa-binding domain competitively inhibits binding to the same FRa epitope as an antibody comprising a VH amino acid sequence of SEQ ID NO:22 or 23 and a VL amino acid sequence of SEQ ID NO: 17 or 18.
6. The biparatopic antibody or antigen binding fragment thereof of any one of claims 15, wherein the first VII comprises VH CDRI-3 comprising the amino acid sequences of (a)2026205205 01 Jul 2026SEQ ID NOs: 10-12 or (b) SEQ ID NOs: 15, 16, and 12, respectively and the first VL comprises VL CDR1-3 comprising the amino acid sequences of SEQ ID NOs: 4-6, respectively.
7. The biparatopic antibody or antigen binding fragment thereof of any one of claims 1 -6, wherein the first VH comprises the amino acid sequence selected from the group consisting of SEQ ID NOs:24, 25, 26, and 57, and / or wherein the first VL comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 20, and 21.
8. The biparatopic antibody or antigen binding fragment thereof of any one of claims 1 -7, wherein the second VH comprises VH CDR1-3 comprising the amino acid sequences of (a) SEQ ID NOs: 7-9 or (b) SEQ ID NOs: 13, 14, and 9, respectively and the second VL comprises VL CDR1-3 comprising the amino acid sequences of SEQ ID NOs: 1-3, respectively.
9. The biparatopic antibody or antigen binding fragment thereof of any one of claims 1 -8, wherein the second VH comprises the amino acid sequence of SEQ ID NO:22 or 23 and / or wherein the second VL comprises the amino acid sequence of SEQ ID NO: 17 or 18.
10. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 19, wherein the first VH and VL pair and / or the second VH and VL pair is murine, nonhuman, humanized, chimeric, resurfaced, or human.
11. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 110, wherein said antibody or antigen-binding fragment thereof binds to human FRa but not FOLR2 or FOLR312. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 111, wherein the first FRa-binding domain is an single-chain variable fragment (scFv).
13. The biparatopic antibody or antigen-binding fragment thereof of claim 12, wherein the scFv of the first FRa binding domain has a peptide orientation of VH-linker-VL.2026205205 01 Jul 202614. The biparatopic antibody or antigen-binding fragment thereof of claim 12, wherein the scFv of the first FRa binding domain has a peptide orientation of VL-linker-VH.
15. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 111, wherein the second FRa-binding domain is an single-chain variable fragment (scFv).
16. The biparatopic antibody or antigen-binding fragment thereof of claim 15, wherein the scFv of the second FRa binding domain has a peptide orientation of VH-linker-VL.
17. The biparatopic antibody or antigen-binding fragment thereof of claim 15, wherein the scFv of the second FRa binding domain has a peptide orientation of VL-linker-VH.
18. The biparatopic antibody or antigen binding fragment thereof of any one of claims 1317, wherein the linker is glycme-serine linker.
19. The biparatopic antibody or antigen binding fragment thereof of any one of claims 118, wherein the second FRa-binding domain comprises an amino acid sequence selected from SEQ ID NOs' 27-29.
20. The biparatopic antibody or antigen binding fragment thereof of any one of claims 1 -18, wherein the first FRa-binding domain comprises an amino acid sequence selected from SEQ ID NOs: 30-32.
21. I he biparatopic antibody or antigen binding fragment thereof of any one of claims 120, comprising the amino acid sequence of (i) SEQ ID NOs.33 and 34, (ii) SEQ ID NOs: 35 and 36, (iii) SEQ ID NOs: 37 and 38, or (iv) SEQ ID NOs: 39 and 40.
22. The biparatopic antibody or antigen binding fragment thereof of any one of claims 1 -20, comprising the amino acid sequences of SEQ ED NOs: 41-43.
23. The biparatopic antibody or antigen binding fragment thereof of any one of claims 120, comprising the amino acid sequences of SEQ ID NOs: 44-462026205205 01 Jul 202624. The biparatopic antibody or antigen binding fragment thereof of any one of claims 123, wherein the biparatopic antibody or antigen binding fragment thereof is a tetravalent bi paratopic antibody or antigen binding fragment thereof25. The biparatopic antibody or antigen binding fragment thereof of any one of claims 1 -23, wherein the biparatopic antibody or antigen binding fragment thereof is a bivalent biparatopic antibody or antigen binding fragment thereof26. The biparatopic antibody or antigen binding fragment thereof of any one of claims 1 -25, wherein the bispecific antibody or antigen-binding fragment thereof comprises FRa-binding domains selected from the group consisting of tandem scFvs, a diabody, a triabody, a tetrabody, and a knob-in-hole structure.
27. The biparatopic antibody or antigen binding fragment thereof of any one of claims 120, and 22-26, which has a knob-in-hole (KIH) structure.
28. The biparatopic antibody or antigen binding fragment thereof of claim 27, wherein the FRa binding domain comprising SEQ ID NOs: 1-3 and 7-9 is on the knob side of the KIH structure.
29. The biparatopic antibody or antigen binding fragment thereof of claim 27, wherein the FRa binding domain comprising SEQ ID NOs: i-3 and 7-9 is on the hole side of the KIH structure.
30. The biparatopic antibody or antigen binding fragment thereof of any one of claims 2729, wherein the FRa binding domain comprising SEQ ID NOs. 4-6 and 10-12 is on the knob side of the KIH structure.
31. The biparatopic antibody or antigen binding fragment thereof of any one of claims 2729, wherein the FRa binding domain comprising SEQ ID NOs. 4-6 and 10-12 is on the hole side of the KIH structure.2026205205 01 Jul 202632. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 131, which comprises a full length antibody.
33. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 132, wherein the first FRa-binding domain is a full length antibody.
34. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 133, wherein the second FRa-binding domain is a full length antibody.
35. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 131, which comprises an antigen-binding fragment.
36. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 135, wherein the first FRa-binding domain is an antigen-binding fragment.
37. The biparatopic antibody or antigen-binding fragment thereof of any one of claims 136, wherein the second FRa-binding domain is an antigen-binding fragment.
38. A biparatopic antibody or antigen binding fragment thereof comprising the amino acid sequences of SEQ ID NOs: 41-4339. A combination of isolated nucleic acid molecules encoding the biparatopic antibody or antigen binding fragment thereof of claims 1-38.
40. An isolated vector comprising one of the nucleic acid molecules of claim 39.
41. A host cell comprising the combination of isolated nucleic acid molecules of claim 39, or the isolated vector of claim 40.
42. The host cell of claim 41, which is selected from the group consisting of E. coli, Pseudomonas, Bacillus, Streptomyces, yeast, CHO, YB / 20, NS0, PER-C6, HEK-293T, N1H-3T3, HeLa, BHK, Hep G2, SP2 / 0, Rl.l, B-W, L-M, COS 1, COS 7, BSC1, BSC40, BMT10 cell, plant cell, insect cell, and human cell in tissue culture.2026205205 01 Jul 202643. A pharmaceutical composition comprising the biparatopic antibody or antigen of any one of claims 1-38, the combination of nucleic acid molecule of claim 39, the vector of claim 40, or the host cell of claim 41 or 42, and a pharmaceutically acceptable carrier or excipient.
44. A pharmaceutical composition comprising the biparatopic antibody of any one of claims 1-38, and a pharmaceutically carrier or excipient.
45. A method of making the biparatopic antibody of any one of claims 1-23 comprising (a) culturing a cell expressing said antibody; and (b) isolating the antibody from said cultured cell.
46. The method of claim 45, wherein said cell is a eukaryotic cell.
47. An immunoconjugate represented by the following formula:CB—:-L2—A—NH—CR1R2-S-L—D .q (1)or a pharmaceutically acceptable salt thereof, wherein:CB is the biparatopic antibody or an antigen-binding fragment thereof of any one of claims 1-38;L2 is represented by one of the following formula:2026205205 01 Jul 2026wherein:Rx, Ry, Rx and Ry. for each occurrence, are independently H, -OH, halogen, -O-(Ci-4 alkyl), -SO3H, -NR4oR4iR42+, or a C1-4 alkyl optionally substituted with -OH, halogen, SO3H or NR4oR4iR42+, wherein R40, R41 and R42 are each independently H or a C1-4 alkyl;I and k are each independently an integer from 1 to 10;11 is an integer from 2 to 5, kl is an integer from 1 to 5; and si indicates the site connected to the cell-binding agent CB and s3 indicates the site connected to the A group;A is an amino acid residue or a peptide comprising 2 to 20 amino acid residues;R1 and R2 are each independently H or a Ci-3alkyl;Li is represented by the following formula:-CR3R4-(CH3)i-g-C(=O)-wherein R3 and R4 are each independently H or Me, and the -C(=O)- moiety in Li is connected to D,D is represented by the following formula:2026205205 01 Jul 2026q is an integer from 1 to 20.
48. The immunoconjugate of claim 47, wherein Rx, Ry, Rx and Ry are all H; and I and k are each independently an integer an integer from 2 to 6.
49. The immunoconjugate of claim 47 or 48, wherein A is a peptide containing 2 to 5 amino acid residues.
50. The immunoconjugate of claim 49, wherein A is selected from the group consisting of Gly-Gly-Gly, Ala-Vai, Vai-Ala, D-Val-Ala, Val-Cit, D-Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Phe-Ala, Phe-N9-tosyl-Arg, Phe-N9-nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val-Ala-Val, Ala-Ala-Ala, D-Ala-Ala-Ala, Ala-D-Ala-Ala, Ala-Ala-D-Ala, Ala-Leu-Ala-Leu (SEQ ID NO 54), |3-Ala-Leu-Ala-Leu (SEQ IDNO 55), Gly-Phe-Leu-Gly (SEQ ID NO:56), Val-Arg, Arg-Arg, Val-D-Cit, Val-D-Lys, Val-D-Arg, D-Val-Cit, D-Val-Lys, D-Val-Arg, D-Val-D-Cit, D-Val-D-Lys, D-Val-D-Arg, D-Arg-D-Arg, Ala-Ala, Ala-D-Ala, D-Ala-Ala, D-Ala-D-Ala, Ala-Met, Gln-Val, Asn-Ala, Gln-Phe, Gin-Ala, D-Ala-Pro, and D-Ala-tBu-Gly, wherein the first amino acid in each peptide is connected to L2 group and the last amino acid in each peptide is connected to -NH-CR'R^S-Li-D51. The immunoconjugate of any one of claims 47-50, wherein R1 and R2 are both H.
52. The immunoconjugate of any one of claims 47-51, wherein Li is -(CH2)i-6-C(=O)-.
53. The immunoconjugate of any one of claims 47-52, wherein D is represented by thefollowing formula:Y - j i nn u1 °H54. The immunoconjugate of any one of claims 47-53, wherein the immunoconjugate is represented by the following formula:2026205205 01 Jul 2026or a pharmaceutically acceptable salt thereof, wherein:CBAv'-N—H is the biparatopic antibody or an antigen-binding fragment thereof of any one of claims 1-38 connected to the L2 group through a Lys amine group;CBA-s js tfoe biparatopic antibody or an antigen-binding fragment thereof of any one of claims 1-38 connected to the L2 group through a Cys thiol group;2026205205 01 Jul 202655.R' and R4 are each independently H or Me;ml, m3, nl, rl,sl andtl are each independently an integer from 1 to 6;m2, n2, r2, s2 and t2 are each independently an integer from 1 to 7;t3 is an integer from I to 12;Di is represented by the following formula:The immunoconjugate of claim 54, wherein the immunoconjugate is represented by the following formula:wherein:m 1 and m3 are each independently an integer from 2 to 4;m2 is an integer from 2 to 5;rl is an integer from 2 to 6; andr2 is an integer from 2 to 5.
56. The immunoconjugate of claim 54 or 55, wherein A is Ala-Ala-Ala, Ala-D-Ala-Ala, Ala-Ala, D-Ala-Ala, Val-Ala, D-Val-Ala, D-Ala-Pro, or D-Ala-tBu-Gly2026205205 01 Jul 202657. The immunoconjugate of claim 54, wherein the immunoconjugate is represented bythe following formula:_Qn vU'w'vaoCBA-CBA-2026205205 01 Jul 2026or a pharmaceutically acceptable salt thereof, wherein:A is Ala-Ala-Ala, Ala-D-Ala-Ala, Ala-Ala, D-Ala-Ala, Vai-Ala, D-Val-Ala, D-Ala-Pro, or D-Ala-tBu-Gly, andDi is represented by the following formula:
58. The immunoconjugate of claim 57, wherein the immunoconjugate is represented by the following formula:2026205205 01 Jul 2026wherein Di is represented by the following formula:
59. The immunoconjugate of claim 47, wherein the immunoconjugate is represented bythe following formula:2026205205 01 Jul 2026wherein:CBA is the biparatopic antibody or an antigen-binding fragment thereof of any one of claims 1-38;q is an integer from 1 to 10;Di is represented by the following formula:
60. An immunoconjugate represented by the following formula:or a pharmaceutically acceptable salt thereof, wherein:CBA is the biparatopic antibody or an antigen-binding fragment comprising the amino acid sequences of SEQ ID NOs: 41-43;Di is represented by the following formula:2026205205 01 Jul 2026q is an integer from 1 to 10.
61. An immunoconjugate having the formula (A) - (L) - (C), wherein:(A) is a biparatopic antibody or antigen binding fragment of any one of claims 1-38,(L) is a linker; and(C) is a cytotoxic agent, wherein said linker (L) links (A) to (C)62. The immunoconjugate of claim 61, wherein said linker is selected from the group consisting of a cleavable linker, a non-cleavable linker, a hydrophilic linker, and a dicarboxylic acid based linker.
63. The immunoconjugate of claim 62, wherein said linker is selected from the group consisting of N-(y maleimidobutryloxy)sulfosuccinimide ester (sulfo-GMBS or sGMBS), y maleimidobutyric acid N-succinimidyl ester (GMBS), N-succinimidyl 4-(2-pyridyldithio)-2-sulfobutanoate (sulfo-SPDB); N-succinimidyl 4-(2-pyridyldithio)pentanoate (SPP) or N-succinimidyl 4-(2- pyridyldithio)-2-sulfopentanoate (sulfo-SPP); N-succinimidyl 4-(2-pyridyldithio)butanoate (SPDB), N-succinimidyl 4- (maleimidomethyl) cyclohexanecarboxylate (SMCC); N-sulfosuccinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (sulfoSMCC); N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB); and N-succinimidyl-[(N-maleimidopropionamido)-tetraethyleneglycol] ester (NHS-PEG4-mal eimide).
64. The immunoconjugate of any one of claims 61-63, wherein the linker is sulfo-GMBS.
65. The immunoconjugate of any one of claims 61-63, wherein the linker is GMBS.2026205205 01 Jul 202666. The immunoconjugate of any one of claims 61-63, wherein the linker is sulfo-SPDB.
67. The immunoconjugate of any one of claims 61-66, wherein said cytotoxic agent isselected from the group consisting of a maytansinoid, maytansinoid analog, benzodiazepine, taxoid, CC-1065, CC-1065 analog, duocarmycin, duocarmycin analog, calicheamicin, dolastatin, dolastatin analog, auristatin, tomaymycin derivative, and leptomycin derivative or a prodrug of the agent.
68. The immunoconjugate of any one of claims 61-67, wherein said cytotoxic agent is a maytansinoid.
69. The immunoconjugate of claim 68, wherein said maytansinoid is DM4.
70. The immunoconjugate of claim 68, wherein said maytansinoid is DM21.
71. The immunoconjugate of any one of claims 61-70, further comprising a second (C).
72. The immunoconjugate of claim 71, further comprising a third (C).
73. The immunoconjugate of claim 72, further comprising a fourth (C).
74. A composition comprising at least one immunoconjugate of any one of claims 61-73, wherein the immunoconjugates comprise an average of 3-4 C per A.
75. A pharmaceutical composition comprising the immunoconjugate of any one of claims 47-74 and a pharmaceutically acceptable carrier.
76. The pharmaceutical composition of claim 75, wherein the pharmaceutical composition comprises an average of 2 to 5 drugs per antibody or antigen-binding fragment thereof.2026205205 01 Jul 202677. The pharmaceutical composition of claim 75, wherein the pharmaceutical composition comprises an average of 3 to 4 drugs per antibody or antigen-binding fragment thereof.
78. A method of treating a cancer in a subject, comprising administering to the subject a therapeutically effective amount of the antibody or antigen binding fragment thereof of claims 1-38, the immunoconjugate of any one of claims 47-73, or the composition of claims 43, 44, or 74-77.
79. The method of claim 78, wherein the cancer is ovarian cancer, uterine cancer, peritoneal cancer, fallopian tube cancer, endometrial cancer, lung cancer, orbrain cancer.
80. The method of claim 78, wherein the cancer is ovarian cancer.
81. The method of claim 80, wherein the ovarian cancer is platinum-resistant epithelial ovarian cancer.
82. The method of claim 80, wherein the ovarian cancer is relapsed epithelial ovarian cancer.
83. The method of claim 80, wherein the ovarian cancer is platinum-refractory epithelial ovarian cancer.
84. The method of claim 78, wherein the cancer is uterine cancer.
85. The method of claim 78, wherein the cancer is peritoneal cancer.
86. The method of claim 78, wherein the cancer is fallopian tube cancer.
87. The method of claim 78, wherein the cancer is endometrial cancer.
88. The method of claim 78, wherein the cancer is lung cancer.
89. The method of claim 78, wherein the cancer is brain cancer.
90. The method of any one of claims 78-89, wherein the cancer is IMGN853-resistant.
91. The method of any one of claims claim 78-90, which further comprises administrationof a steroid.