Phosphoglycolate dehydrogenase mutant, engineered bacteria and application thereof in producing l-serine

By mutating the 375th amino acid position of phosphoglycerate dehydrogenase, a highly active mutant was developed, solving the feedback inhibition problem in the existing technology and achieving a significant improvement in the biosynthetic efficiency of L-serine.

CN120796214BActive Publication Date: 2026-05-01HEFEI HECHEN BIOTECHNOLOGY CO LTD
View PDF 4 Cites 0 Cited by

Patent Information

Authority / Receiving Office
CN · China
Patent Type
Patents(China)
Current Assignee / Owner
HEFEI HECHEN BIOTECHNOLOGY CO LTD
Filing Date
2025-07-18
Publication Date
2026-05-01

AI Technical Summary

Technical Problem

Existing phosphoglycerate dehydrogenases have weak tolerance to feedback inhibition of L-serine, resulting in unsatisfactory biosynthetic efficiency.

Method used

By mutating the 375th amino acid position of phosphoglycerate dehydrogenase, a highly active mutant was developed, which relieved feedback inhibition, improved catalytic activity, and was combined with SerB and SerC enzymes for the biosynthesis of L-serine.

Benefits of technology

The microbial fermentation level of L-serine was significantly improved, with the highest L-serine concentration in the mutant engineered bacteria reaching 5.7 times that of the control bacteria, thus improving the synthesis efficiency.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN120796214B_ABST
    Figure CN120796214B_ABST
Patent Text Reader

Abstract

The application belongs to the technical field of genetic engineering, and particularly relates to a phosphoglycolate dehydrogenase mutant, an engineering bacterium and application of the engineering bacterium in L-serine production. The mutant contains a mutation of the 375th amino acid compared with a protein with an amino acid sequence as shown in SEQ ID NO:1. The mutant protein releases feedback inhibition, and the catalytic activity is significantly improved compared with the parent enzyme, thereby promoting the production of L-serine catalyzed by the phosphoglycolate dehydrogenase, and providing a new synthetic route and engineering bacterium for the production of L-serine.
Need to check novelty before this filing date? Find Prior Art

Description

Phosphoglycerate dehydrogenase mutants, engineered bacteria, and their applications in L-serine production. Technical Field

[0001] This invention belongs to the field of genetic engineering technology, specifically relating to phosphoglycerate dehydrogenase mutants, engineered bacteria, and their applications in producing L-serine. Background Technology

[0002] L-Serine, as a basic amino acid that makes up proteins, is an important source of one-carbon units in organisms. It is also a precursor for the synthesis of glycine, cysteine, tryptophan, and thymine, and has significant application value in the pharmaceutical, food, and skincare industries.

[0003] The intracellular synthesis of L-serine involves three steps: 3-phosphoglycerate is sequentially catalyzed by phosphoglycerate dehydrogenase (PGDH, encoded by the serA gene), phosphoserine transaminase (PAST, encoded by the serC gene), and phosphoserine phosphatase (PSP, encoded by the serB gene) to produce L-serine. The first step is the rate-limiting reaction in L-serine biosynthesis, and the enzyme PGDH catalyzing this reaction possesses NAD+. + L-serine is dependent on the activity of PDGH, which is strictly inhibited by feedback within the cell. To enhance the synthesis and metabolism of L-serine, it is necessary to first remove the feedback inhibition of the end product on the key enzyme PDGH.

[0004] However, existing phosphoglycerate dehydrogenases exhibit weak tolerance to feedback inhibition from serine, resulting in less than ideal serine biosynthesis efficiency. Therefore, developing phosphoglycerate dehydrogenases unaffected by serine feedback inhibition is crucial for efficient serine biosynthesis. Summary of the Invention

[0005] To address the shortcomings of existing technologies, the present invention aims to provide a phosphoglycerate dehydrogenase mutant and its application in the production of L-serine. This mutant protein relieves feedback inhibition and exhibits significantly enhanced catalytic activity compared to the parent enzyme, thereby promoting the production of L-serine catalyzed by phosphoglycerate dehydrogenase.

[0006] The technical solution of this invention is as follows:

[0007] The present invention provides a phosphoglycerate dehydrogenase mutant, which, compared with the protein shown in SEQ ID NO: 1, contains a mutation at amino acid position 375.

[0008] The present invention also provides the encoding gene of the above-mentioned phosphoglycerate dehydrogenase mutant.

[0009] The present invention also provides vectors, recombinant vectors or expression vectors containing the above-mentioned coding genes.

[0010] The present invention also provides a host cell containing the above-described coding gene or recombinant vector.

[0011] The present invention also provides the application of the above-mentioned phosphoglycerate dehydrogenase mutant, which uses the mutant protein to catalyze the conversion of 3-phosphoglycerate (3-PG) to 3-phosphohydroxypyruvate (3-PHP).

[0012] The present invention also provides a method for preparing the above-mentioned phosphoglycerate dehydrogenase mutant, which involves gene recombination and expression using the coding gene of the phosphoglycerate dehydrogenase mutant or an expression vector containing the coding gene.

[0013] The present invention also provides a method for producing L-serine, the method comprising the steps of introducing the phosphoglycerate dehydrogenase mutant into a microbial expression system containing SerB and SerC, and preparing L-serine with a suitable substrate under suitable conditions.

[0014] The present invention also provides a method for improving the activity of phosphoglycerate dehydrogenase, which is achieved by introducing an amino acid substitution at position Q375 into the parental phosphoglycerate dehydrogenase, the position corresponding to the amino acid sequence of phosphoglycerate dehydrogenase shown in SEQ ID NO: 1.

[0015] The beneficial effects of this invention are as follows:

[0016] 1. This invention modifies phosphoglycerate dehydrogenase by means of directed evolution of active sites and gene mutation, and screens out highly active mutants that are free from the feedback inhibition of L-serine.

[0017] 2. This invention combines an enhanced phosphoglycerate dehydrogenase with other enzymes in the L-serine synthesis pathway (e.g., SerB and SerC) for the biosynthesis of L-serine, effectively relieving the feedback inhibition of the first step of the catalytic reaction and improving the microbial fermentation level of L-serine.

[0018] 3. This invention is the first to discover the 375th active site of phosphoglycerate dehydrogenase from Escherichia coli. Mutation of the above key amino acid sites can effectively relieve L-serine feedback and improve enzyme activity, providing a key target for further enhancement of the enzyme's activity.

[0019] 4. Taking the *E. coli* expression system as an example, this invention obtained a genetically engineered bacterium containing the phosphoglycerate dehydrogenase mutant of this invention, and applied the genetically engineered bacterium to L-serine production. Compared with the unmutated engineered bacterium, the engineered bacterium containing the mutant of this invention exhibited high catalytic activity, with the highest L-serine concentration reaching 5.7 times that of the control bacterium. The mutant of this invention effectively improves the synthesis efficiency of L-serine, providing a new synthetic route and genetically engineered bacterium for L-serine production. Attached Figure Description

[0020] Figure 1: Maps of recombinant plasmids pSTV28 and pSTV28-serA in Example 2. Detailed Implementation

[0021] The present invention will now be described through specific embodiments. Unless otherwise specified, all technical means used in this invention are methods well known to those skilled in the art. Furthermore, the embodiments should be understood as illustrative, not limiting, of the scope of the invention; the essence and scope of the invention are defined only by the claims. For those skilled in the art, various changes or modifications to the material composition and dosage in these embodiments without departing from the essence and scope of the invention also fall within the protection scope of this invention.

[0022] The following definitions are used in this invention:

[0023] 1. Nomenclature of amino acids and DNA nucleic acid sequences

[0024] Amino acid residues are named using the recognized IUPAC nomenclature, either in three-letter abbreviations or single-letter symbols. DNA nucleic acid sequences are named using the recognized IUPAC nomenclature.

[0025] 2. Identification of phosphoglycerate dehydrogenase mutants

[0026] The term "amino acid replaced at the original amino acid position" is used to represent the mutated amino acid in the phosphoglycerate dehydrogenase mutant. For example, Q375G indicates that the 375th amino acid residue in the sequence from the N-terminus to the C-terminus is replaced by glycine (G) with glutamine (Q) from the parental phosphoglycerate dehydrogenase. The numbering method of this invention is based on the sequence shown in SEQ ID NO: 1.

[0027] 3. The amino acid sequence of phosphoglycerate dehydrogenase is shown in SEQ ID NO: 1:

[0028] MAKVSLEKDKIKFLLVEGVHQKALESLRAAGYTNIEFHKGALDDEQLKESIRDAHFIGRSRTHLTEDVINAAEKLVAIGCFCIGTNQVDLDAAAKRGIPVF NAPFSNTRSVAELVIGELLLLLRGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIENKLPLGNATQVQHLSDLLNMSD VVSLHVPENPSTKNMMGAKEISLMKPGSLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPLCEFDNVLLTPHIGGSTQEAQENIGLEVAGKLIKYSDNGSTLSAVNFPEVSLPLHGGRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDIEADEDVAEKALQAMKAIPGTIRARLLY

[0029] The present invention provides a phosphoglycerate dehydrogenase mutant, which, compared with the protein shown in SEQ ID NO: 1, contains a mutation at amino acid position 375.

[0030] Preferably, compared with the protein with the amino acid sequence shown in SEQ ID NO: 1, the glutamine at position 375 of the phosphoglycerate dehydrogenase mutant is mutated to one of the following amino acids: glycine, alanine, valine, leucine, isoleucine, methionine, proline, tryptophan, serine, tyrosine, cysteine, phenylalanine, asparagine, threonine, aspartic acid, glutamic acid, arginine, or histidine.

[0031] The present invention also provides the encoding gene of the above-mentioned phosphoglycerate dehydrogenase mutant.

[0032] The present invention also provides vectors, recombinant vectors or expression vectors containing the above-mentioned coding genes, such as a recombinant vector composed of vector plasmid pSTV28 and the coding gene described in the present invention.

[0033] The present invention also provides a host cell comprising the above-described coding gene or recombinant vector. The host cell can be any host suitable for producing the phosphoglycerate dehydrogenase mutant of the present invention from the gene or vector of the present invention, such as microbial expression systems like *Escherichia coli*, *Bacillus subtilis*, *Corynebacterium glutamicum*, and *Saccharomyces cerevisiae*.

[0034] The present invention also provides the application of the above-mentioned phosphoglycerate dehydrogenase mutant, which uses the mutant protein to catalyze the conversion of 3-phosphoglycerate (3-PG) to 3-phosphohydroxypyruvate (3-PHP).

[0035] The phosphoglycerate dehydrogenase mutant of the present invention has improved enzyme activity or catalytic activity compared with its parent phosphoglycerate dehydrogenase, for example, more than 2 times in some embodiments and more than 4 times in other embodiments.

[0036] The present invention also provides a method for preparing the above-mentioned phosphoglycerate dehydrogenase mutant, which involves gene recombination and expression using the coding gene of the phosphoglycerate dehydrogenase mutant described in this invention or an expression vector containing the coding gene. Gene recombination methods and expression hosts known to those skilled in the art can be used, and suitable culture media and culture conditions for host expression can be selected. The method may further include a step of recovering the phosphoglycerate dehydrogenase mutant, which may involve isolating or purifying the phosphoglycerate dehydrogenase mutant from the host culture or expression product, and can be performed using any method known to those skilled in the art.

[0037] The present invention also provides a method for producing L-serine, the method comprising the steps of introducing the phosphoglycerate dehydrogenase mutant into a microbial expression system containing SerB and SerC (e.g., an Escherichia coli expression system), and preparing L-serine under suitable conditions with a suitable substrate (e.g., glucose).

[0038] In the above method for producing L-serine, the preferred culture medium composition is as follows:

[0039] The culture medium contains 10-30 g / L glucose, 1-5 g / L peptone, 1-6 g / L yeast extract, 1-3 g / L sodium citrate, 1-3 g / L potassium salt, 1-3 g / L magnesium salt, 15-20 mg / L iron salt, 15-20 mg / L manganese salt, 0.5-2 g / L methionine, 0.5-2 g / L glycine, and 1-3 mg / L each of vitamin B1, vitamin B3, vitamin B5, vitamin B12, and vitamin H, with the remainder being water; the pH of the culture medium is 7.0-7.2.

[0040] The present invention also provides a method for improving the activity of phosphoglycerate dehydrogenase, which is achieved by introducing an amino acid substitution at position Q375 into the parental phosphoglycerate dehydrogenase, the position corresponding to the amino acid sequence of phosphoglycerate dehydrogenase shown in SEQ ID NO: 1.

[0041] In the above method, preferably, the amino acid substitutions of the phosphoglycerate dehydrogenase mutant compared to the protein with the amino acid sequence shown in SEQ ID NO: 1 are selected from one of the following: Q375A, Q375G, Q375E, Q375P, Q375C, Q375L, Q375T, Q375F, Q375D, Q375W, Q375N, Q375H, Q375V, Q375Y, Q375R, Q375K, Q375I, Q375S, or Q375M.

[0042] The present invention will be described in more detail below through specific embodiments. Unless otherwise defined, the technical and scientific terms used in the following embodiments have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains.

[0043] Example 1:

[0044] This embodiment provides a method for constructing a chassis strain, the method comprising the following steps:

[0045] 1. Gene editing operations

[0046] (1) Construction of pGRB plasmid: The purpose of constructing pGRB plasmid is to transcribe the corresponding gRNA, thereby forming a complex with the Cas9 protein, and to achieve double-strand breaks in the target DNA by recognizing the target gene site through base pairing and PAM. The pGRB plasmid is constructed by recombination of a DNA fragment containing the target sequence with a linearized vector fragment, as described in step af below:

[0047] a. Target sequence design: The target sequence (PAM: 5'-NGG-3') was designed using CRISPR RGEN Tools;

[0048] b. Preparation of DNA fragments containing the target sequence: Design primers: 5'-linearized vector terminal sequence (15 bp)-restriction site-target sequence (excluding PAM sequence)-linearized vector terminal sequence (15 bp)-3' and its reverse complementary primers, and prepare DNA fragments containing the target sequence by annealing single-stranded DNA.

[0049] c. Preparation of linear vectors: The vectors were linearized using reverse PCR amplification.

[0050] d. Recombination reaction;

[0051] e. Plasmid transformation: Take 10 μL of reaction solution and add it to 100 mL of DH5α-transformed competent cells. Gently mix and incubate on ice for 20 min. Heat shock at 42℃ for 45-90 s, then immediately incubate on ice for 2-3 min. Add 900 μL of SOC and incubate at 37℃ for 1 h. Centrifuge at 8000 rpm for 2 min, discard part of the supernatant, and resuspend the bacterial cells in about 200 μL. Spread the resuspended cells onto a plate containing 100 mg / L ampicillin. Invert the plate and incubate overnight at 37℃. After single cells grow on the plate, identify them by colony PCR and select positive recombinants.

[0052] f. Cloning identification: PCR-positive colonies were inoculated into LB medium containing 100 mg / L ampicillin and cultured overnight. Plasmids were then extracted and identified by enzyme digestion.

[0053] (2) Preparation of recombinant DNA fragments: Using primer design software Primer5, with the upstream and downstream sequences of yjgX and serB genes as templates, upstream and downstream homologous arm primers were designed and the upstream and downstream homologous arms and the target gene fragment were amplified by PCR, and then the recombinant fragments were prepared by overlapping PCR.

[0054] (3) Transformation of plasmids and recombinant DNA fragments

[0055] a. Transformation of pREDCas9: The pREDCas9 plasmid was electroporated into the electrocompetent cells of the starting strain. After cell resuscitation and culture, the cells were plated on LB agar plates containing zizomycin and incubated overnight at 32°C. Single colonies growing on the resistant plates were subjected to colony PCR using identification primers to screen for positive recombinants.

[0056] b. Preparation of electroconversion competent cells of the target strain containing pREDCas9: cultured at 32℃ until OD 600 When the concentration reaches 0.1–0.2, add 0.1 M IPTG (to bring the final concentration to 0.1 mM) and continue culturing until OD reaches 0.2. 600 Competent cells were prepared when the pH was 0.6–0.7. The purpose of adding IPTG was to induce the expression of the recombinase on the pREDCas9 plasmid. The culture medium and preparation process for competent cells followed standard operating procedures.

[0057] c. Transformation of pGRB and recombinant DNA fragment: pGRB and donor DNA fragment were simultaneously electroporated into electrocompetent cells containing pREDCas9. The revived cells after electroporation were plated on LB agar plates containing ampicillin and zithromycin and incubated overnight at 32°C. Colony PCR was performed using specially designed identification primers to verify the colonies, screen for positive recombinants, and maintain the cells.

[0058] (4) Plasmid elimination

[0059] a. Elimination of pGRB: Positive recombinants were incubated overnight in LB medium containing 0.2% arabinose. After appropriate dilution, they were spread onto LB plates containing zirconia-resistant bacteria and incubated overnight at 32°C. Single colonies that did not grow on ampicillin-resistant plates but grew on zirconia-resistant plates were selected and preserved.

[0060] b. Elimination of pREDCas9 plasmid: The positive recombinant was transferred to antibiotic-free LB liquid medium and incubated overnight at 42°C. After appropriate dilution, it was plated onto antibiotic-free LB plates and incubated overnight at 37°C. Single colonies that did not grow on bilirubin-resistant plates and grew on antibiotic-free plates were selected for preservation.

[0061] 2. Construction of chassis strain E. coliSER01: Integration of the yjgX site of the serB gene

[0062] yjgX::P trc -serB Recombinant Fragment: First, primers serB-F and serB-R were designed based on the serB gene (Gene ID: 948913) to obtain the serB gene fragment. Then, based on the nucleotide sequence of the yjgX gene in the E. coli MG1655 genome, primers yjgX-UP-F and yjgX-UP-R were designed for amplification of the upstream homologous arm, and primers yjgX-DN-F and yjgX-DN-R were designed for amplification of the downstream homologous arm. The upstream and downstream homologous arms are connected by P... trc The promoter sequence was used as the overlapping region, and the above primers were used to obtain the yjgX-serB recombinant fragment via overlapping PCR.

[0063] pGRB-serB: Based on the serB sequence in the E. coli MG1655 genome, primers serB-F and serB-R, required for constructing the plasmid pGRB-serB, were designed using the online tool CRISPR RGENTools. The pGRB-serB plasmid was constructed and obtained by circular PCR.

[0064] The recombined fragment yjgX::P trc -serB and plasmid pGRB-serB were co-electrotransformed into E. coli MG1655 strain competent cells containing pREDCas9 plasmid. The colony PCR primers yjgX-UP-F and yjgX-DN-R were used as primers for colony PCR identification to obtain strain E. coli SER01.

[0065] 3. Construction of chassis strain E. coliSER02: Integration of the yghE site of the serC gene

[0066] yghE::P trc -serC Recombinant Fragment: First, based on the serC gene sequence (Gene ID: 945527), upstream and downstream primers serC-F and serC-R were designed to obtain the serC gene fragment. Then, based on the nucleotide sequence of the yghE gene in the E. coli MG1655 genome, primers yghE-UP-F and yghE-UP-R were designed for amplification of the upstream homologous arm, and primers yghE-DN-F and yghE-DN-R were designed for amplification of the downstream homologous arm. The upstream and downstream homologous arms are connected by P... trc The promoter sequence was used as the overlapping region, and the above primers were used to obtain the yghE-serC recombinant fragment via overlapping PCR.

[0067] pGRB-serC: Based on the serC sequence in the E. coli MG1655 genome, primers serC-F and serC-R, required for constructing the plasmid pGRB-serC, were designed using the online tool CRISPR RGEN Tools. The pGRB-serC plasmid was constructed and obtained by circular PCR.

[0068] The recombined fragment yghE::P trc -serC and plasmid pGRB-serC were co-electroporated into E. coliSER01 strain competent cells containing pREDCas9 plasmid. The colony PCR primers yghE-UP-F and yghE-DN-R were used as primers for colony PCR identification to obtain strain E. coliSER02.

[0069] Example 2:

[0070] This embodiment provides a method for constructing the serA-Q375 saturated mutant and its mutant strain, the construction method including the following steps:

[0071] 1. Construction of the recombinant expression vector pSTV28-serA

[0072] The recombinant expression vector uses the pSTV28 plasmid as a backbone (Figure 1) and inserts a potentially highly active serA mutant protein. First, using the pSTV28 plasmid as a template, the linearized vector obtained by reverse PCR using primers pSTV28-F and pSTV28-R, and the serA gene fragment (Gene ID: 945258) obtained using primers serA-F and serA-R, were transmitted via ClonExpress. ® II OneStep Cloning Kit series homologous recombinases are used for ligation.

[0073] The PCR reaction system consisted of: a total volume of 50 μL, 19 μL of sterile water, 2 μL of upstream primer, 2 μL of downstream primer, 2 μL of template, and 25 μL of Primestar DNA Polymerase. The PCR program was: 98℃ for 30 s, 98℃ for 10 s, 57℃ for 30 s, 72℃ for 5 s / kb, 72℃ for 10 min, 16℃ ± ∞, with 30 cycles. The homologous recombination reaction conditions were: 37℃ for 10 min. The reaction system consisted of: a total volume of 10 μL, 2 μL of 5×CE II Buffer, 1 μL each of the fragment and the linearized cloning vector, and Exnase. ® II1 μL, ddH2O 5 μL.

[0074] The recombinant vector pSTV28-serA ligation system was transformed into E. coli E. coli DH5α by CaCl2 chemical transformation. The transformed bacteria were then plated on LB agar plates containing 100 mg / L chloramphenicol and incubated upside down at 37°C overnight. After single colonies grew on the plates, colony PCR was performed using primers JD-pSTV28-F and JD-pSTV28-R to identify the recombinant strain E. coli DH5α-pSTV28-serA.

[0075] Construction of 2serA-Q375 saturated mutant strain

[0076] Based on the codon bias of E. coli, the recombinant expression vector was used as the backbone to verify the potential highly active SerA mutant protein. Two complementary primers were designed to mutate glutamine at position 375 to the remaining 19 amino acids (taking Q375A as an example, and the same applies to the others: Q375A-F: 5'-ACTTCCGCCGCAATGGGTTATGTGGTTATTGATATTGAAGC-3'; Q375A-R: 5'-ACCCATTGCGGCGGAAGTTTGCAGATATTGC-3') to construct a single-point mutant.

[0077] The plasmid pSTV28-serA was extracted from the recombinant strain E. coli DH5α-pSTV28-serA using the OMEGA DNA extraction kit. Using pSTV28-serA as a template, a saturation mutation of glutamine at position 375 of the amino acid sequence of phosphoglycerate dehydrogenase was performed via whole-plasmid PCR to obtain a recombinant expression vector containing the phosphoglycerate dehydrogenase mutant. The PCR product was verified by agarose gel electrophoresis and then digested with restriction endonuclease Q.CutDpn I at 37°C for 1 h. The digestion system consisted of 50 μL total volume, 43 μL PCR product, 5 μL Cutsmart Buffer, and 2 μL restriction endonuclease Q.CutDpn I. After purification and recovery, the digested product was chemically transformed into the serine-synthesizing strain E. coli SER02. After single-cell colony growth on plates, colony PCR was performed to identify the recombinant strain containing the nucleotide sequence encoding the phosphoglycerate dehydrogenase mutant. The primers used in the strain construction are listed in Table 1.

[0078] Table 1 Primers used in strain construction

[0079]

[0080] Example 3:

[0081] This embodiment provides a method for producing L-serine by fermentation using a phosphoglycerate dehydrogenase mutant strain, the method comprising at least one of the following steps:

[0082] The plate culture method is as follows: the recombinant strain stored at -80℃ is streaked and inoculated onto activation plates, and cultured at 37℃ for 12 h to obtain slant seed culture; wherein, the preferred solid culture medium composition is: 5 g / L peptone, 5 g / L yeast extract, 2.5 g / L NaCl, 10 g / L agar, and the remainder is water, with a pH of 7.0-7.2.

[0083] The in vitro culture method is as follows: use an inoculation loop to scrape a loop of slanted seeds and inoculate them into a test tube containing 5 mL of seed culture medium. Culture at 37℃ and 200 rpm for 12 h to obtain primary seed solution.

[0084] 24-well plate seed culture: The primary seed culture was inoculated into 24-well plates (250 mL shake flasks) containing a final volume of 5 mL (50 mL) at an inoculation rate of 2% (v / v) of the seed culture medium. The plates were then shaken and cultured at 37℃ and 200 rpm for 12 h to obtain the secondary seed culture. The preferred seed culture medium composition was as follows: glucose 30 g / L, peptone 5 g / L, yeast extract 6 g / L, potassium salt 3 g / L, magnesium salt 3 g / L, iron salt 20 mg / L, manganese salt 20 mg / L, methionine 1 g / L, glycine 1 g / L, vitamin B1, vitamin B3, vitamin B5, vitamin B12, and vitamin H 3 mg / L each, with the remainder being water, and the pH being 7.0-7.2.

[0085] Fermentation culture: The secondary seed culture was inoculated into a 24-well plate (250 mL shake flask) containing a final volume of 5 mL (50 mL) at an inoculation rate of 2% (v / v) of the seed culture liquid. The culture was shaken and cultured for 12 h at 37℃ and 200 rpm to obtain the fermentation broth. The preferred fermentation medium composition was as follows: glucose 20 g / L, peptone 3 g / L, yeast extract 3 g / L, sodium citrate 3 g / L, potassium salt 3 g / L, magnesium salt 3 g / L, iron salt 20 mg / L, manganese salt 20 mg / L, methionine 2 g / L, glycine 2 g / L, vitamin B1, vitamin B3, vitamin B5, vitamin B12, and vitamin H 3 mg / L each, with the remainder being water. The pH of the medium was 7.0-7.2.

[0086] The detection method for serine in fermentation broth is as follows: Take the fermentation broth, mix thoroughly, dilute with deionized water by a certain factor, centrifuge at 13000 r / min, and collect the supernatant for later use. Sample derivatization procedure: Take 200-300 μL of 50 mM NaHCO3 solution, 200-400 μL of 1% 2,4-dinitrofluorophenylacetonitrile solution, and add 10-20 μL of the diluted fermentation sample. Mix well and place in a 65℃ water bath in the dark for 45-60 min. After cooling to room temperature, add 600-700 μL of 50 mM KH2PO4 solution, filter through a 0.22 μm microporous membrane, and then analyze using a microfiltration instrument. An Agilent ZORBAX Eclipse AAA (4.6 mm × 250 mm, 5-Micron) liquid chromatography column was used with binary high-pressure gradient elution and UV detection. The mobile phase consisted of 50% acetonitrile solution and 50 mM sodium acetate aqueous solution (containing 10 mL N,N-dimethylformamide per liter). The flow rate was 1 mL / min, the column temperature was 33 °C, the UV detection wavelength was 360 nm, and the retention time was 30 min.

[0087] Example 4:

[0088] This example illustrates the difference in L-serine production performance between the phosphoglycerate dehydrogenase mutant strain and the control strain E. coliSER02-pSTV28-serA.

[0089] The mutant strain E. coli SER02-pSTV28-serA constructed in Example 2 and the control strain E. coli SER02-pSTV28-serA were cultured in 24-well plates using the culture method described in Example 3. The concentration of L-serine in the fermentation supernatant was measured, and the results are shown in Table 2.

[0090] Table 2 Results of plate fermentation of Q375 saturated mutant strain

[0091]

[0092] Table 2 shows that the L-serine concentration in the mutant strains was significantly increased compared with that in the control strain. The highest concentration was observed in E. coli SER02-pSTV28-serA-Q375A, which increased from 0.06 g / L to 0.34 g / L, 5.7 times that of the control strain E. coli SER02-pSTV28-serA. This indicates that the phosphoglycerate dehydrogenase mutant containing the mutation at amino acid position 375 can significantly improve the catalytic activity of the enzyme and the L-serine production performance of the strain.

[0093] Although the present invention has been disclosed above with reference to preferred embodiments, it is not intended to limit the present invention. Any person skilled in the art can make various changes, modifications, substitutions and variations in form and detail to these embodiments without departing from the spirit and principles of the present invention. The scope of the present invention is defined by the claims and their equivalents.

Claims

1. A phosphoglycerate dehydrogenase mutant, characterized in that, Compared with the protein with the amino acid sequence shown in SEQ ID NO: 1, the glutamine at position 375 of the phosphoglycerate dehydrogenase mutant is mutated to one of the following amino acids: glycine, alanine, valine, leucine, isoleucine, methionine, proline, tryptophan, serine, tyrosine, cysteine, phenylalanine, asparagine, threonine, aspartic acid, glutamic acid, arginine, lysine, or histidine.

2. The encoding gene of the phosphoglycerate dehydrogenase mutant of claim 1.

3. A recombinant vector, characterized in that, It includes the encoding gene as described in claim 2.

4. A host cell, characterized in that, It contains the coding gene of claim 2 or the recombinant vector of claim 3.

5. The application of the phosphoglycerate dehydrogenase mutant according to claim 1, characterized in that, The mutant protein is used to catalyze the conversion of 3-phosphoglycerate (3-PG) to 3-phosphohydroxypyruvate (3-PHP).

6. A method for preparing the phosphoglycerate dehydrogenase mutant of claim 1, wherein the method involves gene recombination and expression using the coding gene of the phosphoglycerate dehydrogenase mutant or an expression vector containing the coding gene.

7. A method for producing L-serine, the method comprising the steps of introducing the phosphoglycerate dehydrogenase mutant of claim 1 into a microbial expression system containing SerB and SerC, and preparing L-serine with a suitable substrate under suitable conditions.

8. The method as described in claim 7, characterized in that, The microbial expression system is Escherichia coli.

9. A method for increasing the activity of phosphoglycerate dehydrogenase, the method comprising introducing one of the following substitutions into the parental phosphoglycerate dehydrogenase: Q375A, Q375G, Q375E, Q375P, Q375C, Q375L, Q375T, Q375F, Q375D, Q375W, Q375N, Q375H, Q375V, Q375Y, Q375R, Q375K, Q375I, Q375S or Q375M; each position corresponding to the amino acid sequence of the parental phosphoglycerate dehydrogenase shown in SEQ ID NO: 1.

Citation Information

Patent Citations

  • An L-amino acid-producing bacterium and a method for producing an L-amino acid

    CN101864465A

  • 3-phosphoglycerate dehydrogenase mutant with improved enzymatic activity and thermal stability

    CN116376857A

  • D-3-phosphoglycerate dehydrogenase mutant, coding gene thereof and application of D-3-phosphoglycerate dehydrogenase mutant and coding gene

    CN120025994A

  • 3-phosphoglycerate dehydrogenase variants whose inhibition by l-serine is reduced, and genes encoding them

    CN1609208A