Use of CsMLP02 and / or CsMLP19 in modulating citrus huanglongbing resistance
By regulating the expression of CsMLP02 and/or CsMLP19 genes, an interference expression vector was constructed and transformed into citrus plants. This solved the problem of insufficient resistance to Huanglongbing (HLB) in citrus, achieved effective regulation of HLB, and improved the resistance of citrus.
Patent Information
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- SOUTHWEST UNIV
- Filing Date
- 2026-05-09
- Publication Date
- 2026-06-12
Smart Images
Figure CN122189079A_ABST
Abstract
Description
Technical Field
[0001] This invention relates to the field of genetic engineering technology, specifically to CsMLP02 and / or CsMLP19 Application in regulating resistance to Huanglongbing in citrus. Background Technology
[0002] Citrus Huanglongbing (HLB) is caused by a phloem-limiting bacterium called " Candidatus Liberibacter asiaticus C Huanglongbing (HLB), a devastating disease, is the number one killer of the global citrus industry. Since its first report in the early 20th century, it has spread to more than 50 countries and regions in Asia, the Americas, and Africa, causing citrus tree decline, sharp yield reductions, and deterioration of fruit quality, resulting in huge economic losses. Currently, there is no effective cure for HLB. Existing control strategies mainly rely on three basic measures: cultivating disease-free seedlings, timely removal of diseased plants, and joint prevention and control of psyllids. However, in actual production, problems such as "difficulty in cutting down trees" and inadequate implementation of psyllid control make it difficult to fundamentally curb the spread of the disease. Therefore, a deeper analysis of citrus and HLB is needed. C Exploring the molecular mechanisms of Las interactions and uncovering disease-resistance-related genes is a core direction for promoting the transformation of the citrus industry from "disease prevention" to "disease treatment".
[0003] Major latex proteins (MLPs) are a class of plant-specific proteins belonging to the Betv1 superfamily. They possess a typical helix-grip fold structure and a gly-rich loop, enabling them to bind various ligands, including cytokinins, flavonoids, and sterols. In recent years, the functions of the MLP family in plant growth and development, secondary metabolism, and stress responses have been gradually revealed. Regarding disease resistance regulation, MLP family members exhibit functional diversity: cotton GhMLP28 positively regulates disease resistance by interacting with the transcription factor GhERF6 to activate the expression of downstream disease-related genes; tobacco NbMLP28 participates in potato virus Y defense through the jasmonic acid signaling pathway; and apple MdMLP423 negatively regulates fungal defense. These studies demonstrate that the MLP family plays an important and diverse role in plant immune regulation.
[0004] Studying members of the citrus MLP family to clarify their functions in Huanglongbing resistance and to discover related genes for Huanglongbing resistance is of great theoretical and practical significance for promoting the breeding of Huanglongbing-resistant citrus. Summary of the Invention
[0005] To solve the above-mentioned technical problems, the purpose of this invention is to provide... CsMLP02 and / or CsMLP19Its application in regulating resistance to Huanglongbing in citrus aims to address the current lack of genes related to resistance to Huanglongbing in citrus.
[0006] The technical solution of the present invention to solve the above-mentioned technical problems is as follows: A first aspect of the present invention provides CsMLP02 and / or CsMLP19 Application of genes in regulating resistance to Huanglongbing in citrus. CsMLP02 The nucleotide sequence of the gene is shown in SEQ ID NO.1. CsMLP19 The nucleotide sequence of the gene is shown in SEQ ID NO.2; SEQ ID NO.1: ATGGCTTTAGTTGGTAAGATGGAAACTGAAGTGGAGATCAAATCTCCTGCTGATAAGTTCTACAACACATTTAGCAGCAAGGCACATACGGTGCCAAACATGTCTCTCGGTAATTTACATGGAGTTGAAGTTCATGAGGGTGACTGGGAGAGACATGGCTCTGTCAAATCCTGGACTTTTCTGCAGATGGAACAGTTGAGAAAATGAAGGAAAAGGTCGAACTAGACC CAGAAAACAAGACAGTTACCATGGTTGTGATTGAGGGAGATTTAATGAAGCATTTTAAGAGCTACAAGGTGATTATTAAAGTCATTCCAAAGAGTGAAGGTAGCTTGGTCAAATGGATTTGGGAATATGAAAAATTGCAGGAGGATGGTCCAACACCAAGCAAATATGTAGATTTTGTGACAGATCTCACCAAAAATATTGATGCACATCTTCTCAAGGAAGAGCAGAATTGA; SEQ ID NO.2: ATGGGTGTTCTCACGTTGAATGTAGAGGATACAAGCACTCTCCCCCCTGAAAAGTTGTTCAAACTTTTTGTCCTTCATTTCGACACCCTTCTGCCCAAAGTCCTGCCTCAGGTTGTAAAGAACGTTGAATTGATTTCAGGGGATGGAGGCCCTGGAAGCATCAAGAAGTTTAACTTTGTTGAAGGTGCTGATTGGAAGTACTTTAAGCATAGGGTTGATGCATTGGACAAAGAGAACAAGATATACAATTACACGGCAATTGAAGGTGAGGGTGATGCTAACATCCCTACTATTGATCATGTTTCTTATGAGAGTAAGGTTGTGGGCACCCCTGACGGAGGAAGCAAGAGCACCGTTGTTATCAAGTTCTATCCCAAACCAGGTGCCGAGATTAAGGAAGAGCAGGTTAAGGGAGGCTTGGAAAAGGAGAAGGGAATTTTTAAGGCTCTGGAAGCCTATGCCTTGGCAAACCCCAATGCCGTATAA。 Furthermore, CsMLP02 the amino acid sequence of the protein encoded by the gene is shown in SEQ ID NO.3, CsMLP19 the amino acid sequence of the protein encoded by the gene is shown in SEQ ID NO.4; SEQ ID NO.3: MALVGKMETEVEIKSPADKFYNTFSSKAHTVPNMSLGNLHGVEVHEGDWERHGSVKSWTFSADGTVEKMKEKVELDPENKTVTMVVIEGDLMKHFKSYKVIIKVIPKSEGSLVKWIWEYEKLQEDGPTPSKYVDFVTDLTKNIDAHLLKEEQN*; SEQ ID NO.4: MGVLTLNVEDTSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYESKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNAV*。
[0007] Furthermore, by inhibitingCsMLP02 and / or CsMLP19 Gene expression enhances the resistance of citrus to Huanglongbing (HLB); through overexpression... CsMLP02 and / or CsMLP19 Genes that reduce the resistance of citrus fruits to Huanglongbing (HLB).
[0008] A second aspect of the present invention provides a method for improving resistance to Huanglongbing (HLB) in citrus fruits by inhibiting... CsMLP02 and / or CsMLP19 Gene expression provides citrus with resistance to Huanglongbing (HLB). CsMLP02 The nucleotide sequence of the gene is shown in SEQ ID NO.1. CsMLP19 The nucleotide sequence of the gene is shown in SEQ ID NO.2.
[0009] Furthermore, suppress CsMLP02 and / or CsMLP19 Methods for gene expression include: constructing CsMLP02 and / or CsMLP19 Gene interference expression vectors were used to transform citrus fruits into transgenic citrus plants.
[0010] Furthermore, the interference expression vectors include silencing vectors or knockout vectors.
[0011] A third aspect of the present invention provides CsMLP02 and / or CsMLP19 Gene interference expression vectors, including CsMLP02 and / or CsMLP19 amiRNA fragments of genes, CsMLP02 The amiRNA fragment of the gene is shown in any one of SEQ ID NO. 5-7. CsMLP19 The amiRNA fragment of the gene is shown in SEQ ID NO.8. CsMLP02 The nucleotide sequence of the gene is shown in SEQ ID NO.1. CsMLP19 The nucleotide sequence of the gene is shown in SEQ ID NO.2.
[0012] Furthermore, CsMLP02 The CsMLP02-RNAi-1, CsMLP02-RNAi-2, and CsMLP02-RNAi-3 fragments (amiRNA fragments) of the gene are shown in SEQ ID NO.5, SEQ ID NO.6, and SEQ ID NO.7; SEQ ID NO.5: TAGTTTCCATCTTACCACCTA; SEQ ID NO.6: TAGTTTCCATCTTACCAACTC; SEQ ID NO.7: TAATGCTTTCATTAAATCTCCA; CsMLP19 The CsMLP19-RNAi-1 fragment (amiRNA fragment) of the gene is shown in SEQ ID NO.8; SEQ ID NO. 8: TCTCTTTGTCCAAAGCATCAA.
[0013] In a fourth aspect, the present invention provides the application of the above-mentioned interference expression vector in improving resistance to Huanglongbing (HLB) in citrus.
[0014] A fifth aspect of the present invention provides the above-described... CsMLP02 and / or CsMLP19 Application of gene or interference expression vectors in breeding citrus varieties resistant to Huanglongbing (HLB).
[0015] The present invention has the following beneficial effects: 1. This invention discloses for the first time the method of regulating CsMLP02 and / or CsMLP19 Gene expression can regulate the expression of genes in citrus hairy roots. C The number of Las, by suppressing CsMLP02 and / or CsMLP19 Gene expression can effectively inhibit the growth of hairy roots in citrus. C The proliferation of Las enhances the resistance of citrus to Huanglongbing (HLB).
[0016] 2. The invention provided CsMLP02 and CsMLP19 The gene can serve as a candidate gene for studying resistance to Huanglongbing in citrus and can be used for breeding citrus Huanglongbing resistance, which has significant application value. Attached Figure Description
[0017] Figure 1 The graph shows the expression analysis of CsMLP family genes in sweet oranges and Ziyang fragrant oranges infected with Huanglongbing (HLB). In the graph, A represents sweet oranges and B represents Ziyang fragrant oranges. Figure 2 for CsMLP02 / 19 The diagrams show the overexpression and interference vectors. A shows the construction diagram of the pNmG-CsMLP02 and pNmG-CsMLP19 overexpression vectors; B shows the construction diagram of the pNmG-CsMLP02-RNAi and pNmG-CsMLP19-RNAi interference vectors; and C shows... CsMLP02 / 19 The sequence and location of the amiRNA fragment, D is... CsMLP02 The interference effect of the amiRNA fragment, E is CsMLP19 The interference effect of amiRNA fragments; Figure 3 for CsMLP02 / 19Transgenic hairy roots with overexpression vectors and interference vectors C The Las content detection graph shows that, in which A is a photograph of transgenic hairy roots under visible and ultraviolet light, containing empty vector pNmG, overexpression vectors pNmG-CsMLP02 and pNmG-CsMLP19, and interference vectors pNmG-CsMLP02-RNAi and pNmG-CsMLP19-RNAi; and B is a graph showing the content of Huanglongbing pathogen in the hairy roots of transgenic and non-transgenic Ziyang sweet oranges. * indicates P <0.05, ** indicates P <0.01. Detailed Implementation
[0018] The principles and features of the present invention are described below with reference to the accompanying drawings. The examples given are for illustrative purposes only and are not intended to limit the scope of the invention. Unless otherwise specified in the examples, conventional conditions or conditions recommended by the manufacturer should be followed. Reagents or instruments whose manufacturers are not specified are all commercially available products.
[0019] Example 1: CsMLP02 and CsMLP19 Gene screening This embodiment performed an AtMLP homolog search and hidden Markov model identification from the citrus genome, ultimately identifying 24 MLP family members. Based on their chromosomal positions, these MLP families were named sequentially. CsMLP01 - CsMLP24 , CsMLP01 - CsMLP07 Located on chromosome 2, CsMLP13 - CsMLP24 It is located on chromosome 9.
[0020] In order to screen citrus fruits involved in the response to Huanglongbing (HLB) CsMLP ,right C After Las infection, Jincheng oranges and Ziyang sweet oranges CsMLP The expression patterns of family members were analyzed.
[0021] qPCR quantification results are as follows Figure 1 As shown, under the stress of Huanglongbing, CsMLP02 The expression level was significantly downregulated in Jincheng oranges and Ziyang fragrant oranges, while CsMLP19 Both of these citrus varieties showed a significant upward adjustment. CsMLP18 CsMLP20 was upregulated only in infected oranges, while CsMLP1 , CsMLP13 and CsMLP17 The expression was upregulated only in infected Ziyang sweet oranges. Therefore, this invention selected... CsMLP02 and CsMLP19 Further research will be conducted.
[0022] Example 2: OverexpressionCsMLP02 and CsMLP19 Construction of vectors and transformation of hairy roots C Las content determination (1) RNA extraction and cDNA synthesis Total RNA was extracted from leaves of *Citrus aurantiacus* using a plant total RNA extraction kit following the instructions. RNA quality was verified by agarose gel electrophoresis. RNA concentration and purity were determined using a micro-precision nucleic acid and protein detector. cDNA was then synthesized using a PrimeScript RT Master Mix reverse transcription kit following the instructions. The obtained cDNA was stored at -20°C for later use.
[0023] (2) Construction of overexpression vector Primers were designed using single-fragment cloning techniques from the Novizan official website (https: / / www.takarabio.com). CsMLP02 / 19 The CDS sequence of the terminator TAG was used as the insert sequence, pNmG was used as the vector, and double digestion was performed by... Bam HⅠ (5' end) and Sal I. Linearization of homologous arms at the 3' end. PCR amplification was performed using T-CsMLP02 / 19 plasmid as a template (PCR system and reaction conditions are shown in Tables 1 and 2). The amplification products were then recovered from the gel and used... Bam HⅠ (5' end) and Sal I. Homologous recombination was performed on the (3' end) linearized pNmG vector. The system and reaction procedure are shown in Table 3.
[0024] Table 1 PCR reaction system
[0025] Table 2 PCR reaction conditions
[0026] Table 3 Homologous recombination reaction system
[0027] in, CsMLP02 The primer sequences for constructing the overexpression vector are shown in SEQ ID NO. 9-10; CsMLP19 The primer sequences for constructing the overexpression vector are shown in SEQ ID NO.11-12: SEQ ID NO.9: GGGTACCCGGGGATCCATGGCTTTAGTTGGTAAGATGGA (pNmG-MLP02-f); SEQ ID NO.10: ATTCCTGCAGGTCGACTCAATTCTGCTCTTCCTTGAGA (pNmG-MLP02-r); SEQ ID NO.11: GGGTACCCGGGGATCCATGGGTGTTCTCACGTTGAATG (pNmG-MLP19-f); SEQ ID NO. 12: ATTCCTGCAGGTCGACTTATACGGCATTGGGGTTTGC (pNmG-MLP19-r).
[0028] The homologous recombination product was promptly transformed into competent E. coli cells, plated, and incubated overnight. Single colonies were then picked and cultured on a shaker. Positive clones were selected by PCR verification to obtain the correctly constructed pNmG. The CsMLP02 / 19 vector was constructed correctly. The pNmG-CsMLP02 / 19 vector was transformed into competent cells according to the instructions for Agrobacterium rhizogenes K599 competent cells. Single clones were picked and cultured, and plasmids were extracted and verified by enzyme digestion. If the electrophoresis results of the enzyme digestion products showed a band consistent with the target gene, the vector transformation was successful. The bacterial culture was then preserved by flash freezing in liquid nitrogen and storage at -80°C to obtain the overexpression vector pNmG-CsMLP02 / 19 (e.g., pNmG-CsMLP02 / 19). Figure 2 (As shown in Figure A).
[0029] (3) Hairy root transformation Using Agrobacterium rhizogenes K599-mediated genetic transformation, the overexpression vector pNmG-CsMLP02 / 19 was transformed into diseased Ziyang sweet orange stem segments, respectively. Transgenic hairy roots overexpressing CsMLP02 and CsMLP19 (e.g., ...) were obtained through screening. Figure 3 (As shown in Figure A).
[0030] To evaluate overexpression CsMLP02 and CsMLP19 The effect on Huanglongbing resistance was investigated using the TaqMan qPCR probe method to detect the influence of transgenic hairy roots. C The content of Las was determined by the amount of non-fluorescent negative roots (GFP) in the same stem segment. - ( ) as a comparison.
[0031] The results show that ( Figure 3 (Figure B) In CsMLP02 and CsMLP19, the positive roots and negative roots of the control group empty vector were compared. C There was no significant difference in Las content, ruling out the influence of the vector itself on the pathogen content. However, in the transgenic roots containing the target gene and the corresponding negative-negative roots, compared with the control negative-negative roots, the Las content in the transgenic roots of CsMLP02 and CsMLP19 was significantly higher.C The Las content was significantly higher in the CsMLP02-overexpressing hairy roots (CsMLP02-OE) than in the non-transgenic negative roots. The pathogen content in the CsMLP19-overexpressing hairy roots (CsMLP02-OE) was 3.93 times that of the non-transgenic negative roots, and the pathogen content in the CsMLP19-overexpressing hairy roots (CsMLP02-OE) was twice that of the non-transgenic negative roots. These results indicate that... CsMLP02 and CsMLP19 Overexpression significantly promoted C The proliferation of Las in hairy roots and the two play a negative regulatory role in the resistance of citrus to Huanglongbing.
[0032] Example 3: Construction of an inhibition expression vector and its transformation into hairy roots C Las content determination (1) Construction of interference carrier First, the amiRNA sequences were manually designed and screened using the website http: / / wmd3.weigelworld.org / cgi-bin / webapp.cgi, resulting in three... CsMLP02 and CsMLP19 The amiRNA fragments were named CsMLP02-RNAi-1, CsMLP02-RNAi-2, CsMLP02-RNAi-3 and CsMLP19-RNAi-1, CsMLP19-RNAi-2, CsMLP19-RNAi-3, respectively (e.g., Figure 2 (See Figure B in the middle) Bam HⅠ (5' end) and Sal The 3' end was used as the restriction enzyme site for gene synthesis at Qingke Biotechnology Co., Ltd. Primers were designed using single-fragment cloning from the Novizan official website. The sequences of CsMLP02-RNAi-1, CsMLP02-RNAi-2, CsMLP02-RNAi-3 and CsMLP19-RNAi-1, CsMLP19-RNAi-2, CsMLP19-RNAi-3 were used as insert sequences. pNmG was used as the vector, and double digestion was performed using… Bam HⅠ (5' end) and Sal I. (3' end) Linearization design of homologous arms. Using pUC-CsMLP02-RNAi-1, pUC-CsMLP02-RNAi-2, pUC-CsMLP02-RNAi-3 and pUC-CsMLP19-RNAi-1, pUC-CsMLP19-RNAi-2, pUC-CsMLP19-RNAi-3 plasmids (synthesized by the company) as templates, PCR amplification was performed (conditions as in Example 2), and homologous arms were added. Vector construction was then performed (specific steps as in Example 2) to obtain the interference vector (e.g., (As shown in Figure B).
[0033] Figure 2 The CsMLP02-RNAi-1-3 fragment of the gene is shown in SEQ ID NO.5-7; SEQ ID NO.5: TAGTTTCCATCTTACCACCTA; SEQ ID NO.6: TAGTTTCCATCTTACCAACTC; SEQ ID NO.7: TAATGCTTTCATTAAATCTCCA; CsMLP02 The CsMLP19-RNAi-1 fragment of the gene is shown in SEQ ID NO.8; SEQ ID NO. 8: TCTCTTTGTCCAAAGCATCAA.
[0034] To verify the effectiveness of the interference vector, functional assays were performed using a transient transformation system of citrus leaves. The RT-qPCR results for CsMLP02 are as follows: CsMLP19 As shown in Figure D, compared with the control group, the CsMLP02-RNAi interference vector constructed from the pNmG vector showed a significant decrease in the levels of CsMLP02-RNAi-1, CsMLP02-RNAi-2, and CsMLP02-RNAi-3, which were 60.04%, 58.91%, and 59.02% of the control group, respectively. Among them, CsMLP02-RNAi-2 showed the most stable and significant effect. Therefore, in this embodiment, the interference vector constructed from CsMLP02-RNAi-2 was finally used for hairy root transformation. The RT-qPCR results of CsMLP19 are shown below. Figure 2 As shown in Figure E, compared with the control group, the CsMLP19-RNAi interference vector constructed by the pNmG vector showed a significant decrease in CsMLP19-RNAi-1, which was 56.95% of the control group. Therefore, in this embodiment, the interference vector constructed by CsMLP19-RNAi-1 was finally transformed into hairy roots.
[0035] (2) Hairy root transformation Using Agrobacterium rhizogenes K599-mediated genetic transformation, the interference vectors pNmG-CsMLP02-RNAi-2 and pNmG-CsMLP19-RNAi-1 were transformed into diseased Ziyang sweet orange stem segments to obtain interference vectors. Figure 2 and CsMLP02 Transgenic hairy roots expressing [genetic expression]. TaqMan probe-based qPCR was used to detect [genetic expression] in transgenic and non-transgenic hairy roots. C Las content.
[0036] The results are as follows CsMLP19As shown in Figure B, there was no significant difference in pathogen content between the positive and negative roots of the control group without the vector, thus ruling out the influence of the vector itself. However, in the roots transformed with the target gene and the corresponding negative roots, compared with the control negative roots, the pathogen content in the hairy roots of CsMLP02-RNAi-2 transgenic roots was significantly higher. C The Las content was significantly lower than that of the control group's negative roots, and the pathogen content was 28% of that of the control group, a decrease of 72%. These results indicate that interference... Figure 3 The expression of [something] was significantly suppressed. C The proliferation of Las in hairy roots further confirms that CsMLP02 It plays a negative regulatory role in the resistance of citrus to Huanglongbing (HLB).
[0037] The results are as follows CsMLP02 As shown in Figure B, there was no significant difference in pathogen content between the positive and negative roots of the control group without the vector, thus ruling out the influence of the vector itself. However, in the roots transformed with the target gene and their corresponding negative roots, compared with the control negative roots, the pathogen content in the transgenic roots of CsMLP19-RNAi-1 was significantly higher. C The Las content was significantly lower than that of the control group's negative roots, and the pathogen content was 20% of that of the control group, representing an 80% reduction. These results indicate that interference... Figure 3 The expression of [something] was significantly suppressed. C The proliferation of Las in hairy roots further confirms that CsMLP19 CsMLP19 It plays a negative regulatory role in the resistance of citrus to Huanglongbing (HLB).
[0038] The above description is only a preferred embodiment of the present invention and is not intended to limit the present invention. Any modifications, equivalent substitutions, improvements, etc., made within the spirit and principles of the present invention should be included within the protection scope of the present invention.
Claims
1. CsMLP02 and / or CsMLP19 The application of genes in regulating resistance to citrus Huanglongbing (HLB) is characterized by, The CsMLP02 The nucleotide sequence of the gene is shown in SEQ ID NO.
1. CsMLP19 The nucleotide sequence of the gene is shown in SEQ ID NO.
2.
2. The application according to claim 1, characterized in that, The CsMLP02 The amino acid sequence of the gene-encoded protein is shown in SEQ ID NO.
3. CsMLP19 The amino acid sequence of the gene-encoded protein is shown in SEQ ID NO.
4.
3. The application according to claim 1, characterized in that, By inhibiting CsMLP02 and / or CsMLP19 Gene expression enhances the resistance of citrus to Huanglongbing (HLB); through overexpression... CsMLP02 and / or CsMLP19 Genes that reduce the resistance of citrus fruits to Huanglongbing (HLB).
4. A method for improving resistance to Huanglongbing (HLB) in citrus, characterized in that, By inhibiting CsMLP02 and / or CsMLP19 The expression of the gene provides citrus with resistance to Huanglongbing (HLB). CsMLP02 The nucleotide sequence of the gene is shown in SEQ ID NO.
1. CsMLP19 The nucleotide sequence of the gene is shown in SEQ ID NO.
2.
5. The method for improving resistance to Huanglongbing in citrus according to claim 4, characterized in that, The inhibition CsMLP02 and / or CsMLP19 Methods for gene expression include: constructing CsMLP02 and / or CsMLP19 Gene interference expression vectors were used to transform citrus fruits into transgenic citrus materials.
6. The method for improving resistance to Huanglongbing in citrus according to claim 5, characterized in that, The interference expression vectors include silencing vectors or knockout vectors.
7. A kind CsMLP02 and / or CsMLP19 Gene interference expression vector, characterized in that, include CsMLP02 and / or CsMLP19 The amiRNA fragment of the gene, as described CsMLP02 The amiRNA fragment of the gene is shown in any one of SEQ ID NO. 5-7, wherein... CsMLP19 The amiRNA fragment of the gene is shown in SEQ ID NO.
8. CsMLP02 The nucleotide sequence of the gene is shown in SEQ ID NO.
1. CsMLP19 The nucleotide sequence of the gene is shown in SEQ ID NO.
2.
8. The application of the interference expression vector according to claim 7 in improving the resistance of citrus Huanglongbing (HLB).
9. The claim 1-3 CsMLP02 and / or CsMLP19 Application of the gene or the interference expression vector as described in claim 7 in the breeding of citrus resistant to Huanglongbing.