Activatable interleukin 18 polypeptides
Patent Information
- Application Number
- EP2024744364
- Authority / Receiving Office
- EP · EP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2023-09-06
- Filing Date
- 2024-01-18
- Publication Date
- 2025-11-26
Smart Images

Figure PCTCN2024073057-FTAPPB-I100001 
Figure PCTCN2024073057-FTAPPB-I100002 
Figure PCTCN2024073057-FTAPPB-I100003
Abstract
Description
ACTIVATABLE INTERLEUKIN 18 POLYPEPTIDES
[0001] CROSS-REFERENCE TO RELATED APPLICATION
[0002] This application claims priority to International Applications PCT / CN2023 / 072869, filed on January 18, 2023, PCT / CN2023 / 072886, filed on January 18, 2023, and PCT / CN2023 / 117197, filed on September 6, 2023, the content of which is incorporated by reference in their entirety for all purposes.
[0003] REFERENCE TO AN ELECTRONIC SEQUENCE LISTING
[0004] The contents of the electronic sequence listing (233002001641SEQLIST. xml; Size: 445, 962 bytes; and Date of Creation: January 17, 2024) is herein incorporated by reference in its entirety.
[0005] FIELD OF THE APPLICATION
[0006] The present application relates to activatable interleukin 18 (IL-18) polypeptides comprising (a) an IL-18 polypeptide (e.g., a wild-type IL18, a variant thereof comprising at least one amino acid substitution relative to a wild-type IL-18 (e.g., a wild-type human IL-18) , or a fusion polypeptide comprising either of the preceding) , and (b) a masking moiety (e.g., a polypeptide, a receptor or subdomain (s) of a receptor) . The present application also relates to methods of making such activatable IL-18 polypeptides, and methods of using such activatable IL-18 polypeptides in therapeutic applications.
[0007] BACKGROUND OF THE APPLICATION
[0008] Interleukin 18 (IL-18, also known as interferon-gamma inducing factor) is a proinflammatory cytokine that has been found to stimulate innate lymphocytes, myeloid cells, antigen-experienced, T cells (see, e.g., Guo et al. (2012) Trends Immunol. 33, 598–606) , and antigen-experienced natural killer (NK cells) . Therapeutically, recombinant IL-18 has been reported to synergize with immune checkpoint inhibitors (ICIs) (Ma et al. (2016) Clin Cancer Res 22: 2969–2980) and chimeric antigen receptor T (CAR-T) cells in pre-clinical models (Hu et al. (2017) Cell Rep 20, 3025–3033. Components of the interleukin-18 (IL-18) pathway have been found to be upregulated on tumor infiltrating lymphocytes (TIL) (see, e.g., Zhou et al. (2020) Nature 583: 609–614) , suggesting that IL-18 therapy could enhance anti-tumor immunity. IL-18 has been administered to patients in clinical trials and found to be safe and well-tolerated (Robertson et al. (2006) Clin Cancer Res 12, 4265–4273) . However, clinical development of IL-18 has been curtailed by its limited efficacy. IL-18BP, a high-affinity inhibitor of IL-18 (KD < 1nM, see, e.g., Dinarello et al. (2013) Front Immunol 4: 289, doi: 10.3389 / fimmu. 2013.00289) , is frequently upregulated in diverse human and murine tumors and is believed to limit the anti-tumor activity of IL-18 in preclinical models (e.g., mice) and in clinical trials. IL-18BP-resistant IL-18 variant polypeptides, which maintain signaling potential, but are impervious to inhibition by IL-18BP, have been engineered (see, e.g., Zhou et al. (2020) Nature 583: 609–614) .
[0009] Further, as IL-18 can modulate both innate and adaptive immunity, its dysregulation can cause autoimmune or inflammatory diseases. For example, IL-18 plays a role in Th1-mediated immune responses by activating NK cells and Th1 cells, which are involved in host defense against intracellular pathogen infection through IFNγ production. IL-18 also induces the production of TNF and FasL, which are involved in growth, survival, and apoptosis. IL-18 is believed to play a role in inducing IL-4 and IL-13 production in T cells, NK cells, mast cells, and basophils, driving a Th2 response. Other mediators induced by IL-18 include inducible nitric oxide; cyclooxygenase (Cox-2) ; proinflammatory cytokines IL-1β, IL-6; chemokines IL-8, MCP-1, and MIP-1α; intracellular adhesion molecule ICAM-1; and growth factor GM-CSF. IL-18 also induces the production of cytokines such as IL-12, IL-2. Given the pleiotropic functions of IL-18, regulation of IL-18 activity is vital to prevent an aberrant immune response.
[0010] There is a need in the art for compositions and methods for activating IL-18 receptor-mediated signaling in an individual, e.g., either by a wild-type IL-18 or by an IL-18BP-resistant IL-18 variant polypeptide, in a regulated manner and / or stimulating antigen-experienced T cells or NK cells in an individual in a regulated manner (e.g., activation at the site of a tumor) for treating cancer and other IL-18-mediated diseases and disorders.
[0011] The disclosures of all publications, patents, patent applications and published patent applications referred to herein are hereby incorporated herein by reference in their entirety.SUMMARY
[0012] In some embodiments, provided is an interleukin 18 (IL-18) variant polypeptide comprising at least one mutation at a residue selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the IL-18 variant polypeptide comprises at least one mutation at a residue selected from the group consisting of: G3, E6, D54, and N91, wherein the amino acid positions is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the IL-18 variant polypeptide further comprises at least one mutation at a residue selected from the group consisting of Q56, P57, M60, Q103, R104, M113, and N155, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. Exemplary IL-18 polypeptides can be found in e.g., WO2020069398A1, WO2021097376A1, WO2023161853A1, WO2022038417A2, which are incorporated herein by reference in their entirety.
[0013] In some embodiments, the IL-18 polypeptide comprises at least one mutation at a residue selected from the group consisting of: G3, Q24, L29, Q56, P57, M60, A61, N91, K96, R104, R107, K140, N155, and I149, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1, optionally wherein the IL-18 polypeptide comprises mutations at G3, E6, D54, and N91, further optionally wherein the variant polypeptide comprises mutations: (i) G3P; (ii) E6R or E6K; (iii) D54W, D54H, D54S, or D54Q; and (iv) N91V, N91A, N91G, or N91S. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S.
[0014] In some embodiments, the IL-18 polypeptide comprises one substitution or a set of substitution combination selected from the group consisting of: 1) G3P, E6K, D54H, Q56D, P57R, N91V, and R104V; 2) G3S, E6K, D54W, Q56P, P57D, N91G, and R104T; 3) G3P, E6K, D54W, Q56H, P57V, N91A, and R104Y; 4) G3P, E6K, D54W, Q56G, P57V, N91V, and R104F; 5) G3E, E6T, D54W, Q56P, P57W, N91V, R104T, and N155K; 6) G3P, E6R, D54W, Q56T, N91V, and R104T; 7) G3P, E6R, D54H, Q56T, P57A, and N91A; 8) G3P, E6R, D54W, Q56P, P57A, N91A, and R104L; 9) G3P, E6R, D54W, Q56R, P57A, N91S, and R104S; 10) G3P, E6R, D54Q, Q56L, P57W, and N91S; 11) G3P, E6R, D54S, Q56R, P57N, N91G, and R104T; 12) G3P, E6K, D54G, Q56G, P57A, and N91T; 13) G3P, E6K, D54Q, Q56I, and P57W; 14) G3N, E6K, D54P, Q56S, P57S, N91R, and R104A; 15) G3P, E6R, D54S, Q56Y, P57T, and N91G; 16) G3P, E6R, D54S, Q56R, P57N, N91G, and R104S; 17) G3P, E6R, D54L, Q56T, P57A, and N91G; 18) G3P, E6R, D54S, Q56R, P57R, N91G, and R104S; 19) G3P, E6K, D54H, Q56E, P57Q, and N91A; 20) G3P, E6R, D54S, Q56R, P57S, N91G, and R104S; 21) G3P, E6R, D54S, Q56S, P57T, N91G, and R104S; 22) G3P, E6R, D54Y, Q56R, P57G, N91K, and R104S; 23) G3P, E6R, D54Y, Q56T, and P57R; 24) G3P, E6R, D54Y, Q56T, and P57S; 25) G3P, E6R, D54L, Q56T, P57T, and N91R; 26) G3P, E6R, D54H, Q56D, P57K, N91V, and R104Y; 27) G3P, E6R, D54H, Q56Y, P57T, N91V, and R104Y; 28) G3P, E6A, D54W, Q56G, P57G, N91V, and R104Y; 29) G3P, E6M, D54F, Q56D, P57R, and N91P; 30) G3P, E6L, D54H, Q56T, P57V, and N91S; 31) G3P, E6R, D54H, Q56I, P57H, N91I, and R104Y; 32) G3P, E6G, D54S, Q56S, and P57R; 33) G3E, E6H, D54R, Q56T, and P57H; 34) G3P, E6R, D54H, Q56R, P57N, N91V, and R104E; 35) G3P, E6R, D54G, Q56G, P57A, and N91G; 36) G3P, E6S, D54A, Q56D, P57Q, and N91G; 37) G3P, E6G, D54Q, Q56V, and P57W; 38) G3P, E6S, D54W, Q56G, P57A, N91V, and R104I; 39) G3P, E6R, D54W, Q56P, P57G, N91V, and R104L; 40) G3D, E6K, D54P, Q56S, P57W, and N91W; 41) G3P; 42) G3P, E6K, D54G, Q56G, and P57A; 43) G3P, E6R, D54L, Q56G, P57S, and N91V; 44) G3P, E6R, V11I, D54G, Q56G, P57A, and N91G; 45) G3P, E6K, D54H, Q56Y, and P57S; 46) E6R, D54W, Q56S, and P57Q; 47) G3P, E6K, D54L, Q56T, P57Q, and N91V; 48) G3A, E6Y, D54R, Q56S, P57L, and N91G; 49) G3P, E6R, D54L, Q56T, P57I, and N91G; 50) E6G, D54L, Q56T, P57E, N91G, and R104S; 51) G3A, E6Y, D54R, Q56S, P57L, and N91A; 52) M60K, and K96D; 53) G3P, E6R, and K96E; 54) M60K; 55) G3P, and E6R; 56) G3P, and E6K; 57) G3D, E6K, and N91S; 58) G3S, and I149M; 59) G3P, E6R, and N91S; 60) E6R; 61) E6R, and N91S; 62) V11I; and 63) G3S, and K140R.
[0015] In some embodiments, the IL-18 variant polypeptide further comprises at least one mutation at a residue selected from the group consisting of: C38, C68, C76, D98, S117, and C127, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the at least one mutation comprises a substitution at C38, a substitution at C68, and an S117C substitution. In some embodiments, the at least one mutation is selected from the group consisting of: C38S, C68S, C76S, and C127S. In some embodiments, the IL-18 variant polypeptide comprises (such as further comprises) C38S, C68S, and C76S mutations. In some embodiments, the IL-18 variant polypeptide further comprises a set of mutations selected from the group consisting of: (a) C38I, C68S, and S117C; (b) C38V, C68I, S117C, and C127A; (c) C38S, C68I, S117C, and C127I; (d) C38I, C68I, C76V, and C127I; and (e) C38I, C68L, and C76Y. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S.
[0016] In some embodiments, provided is an interleukin 18 (IL-18) variant polypeptide comprising at least one mutation at a residue selected from the group consisting of: C38, C68, C76, D98, S117, and C127, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the at least one mutation comprises a substitution at C38, a substitution at C68, and an S117C substitution. In some embodiments, the at least one mutation is selected from the group consisting of: C38S, C68S, C76S, and C127S. In some embodiments, the IL-18 variant comprises C38S, C68S, and C76S mutations. In some embodiments, the IL-18 variant polypeptide comprises a set of mutations selected from the group consisting of: (a) C38I, C68S, and S117C; (b) C38V, C68I, S117C, and C127A; (c) C38S, C68I, S117C, and C127I; (d) C38I, C68I, C76V, and C127I; and (e) C38I, C68L, and C76Y. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S.
[0017] In some embodiments the wild-type IL-18 is human IL-18 comprising the amino acid sequence of SEQ ID NO: 1. In some embodiments, the IL-18 variant polypeptide specifically binds to IL-18 receptor α (IL-18Rα) and exhibits reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18. In some embodiments, the IL-18 variant polypeptide exhibits an increased binding to IL-18Rα relative to the wild-type IL-18. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of less than about 5 x 10-5 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-5 and about 5 x 10-11 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18BP with a KD of more than 5 x 10-9 M. In some embodiments, the IL-18 variant polypeptide exhibits no binding (such as no detectable binding, as measured, e.g., via surface plasmon resonance) to IL-18BP.
[0018] In some embodiments, the variant polypeptide comprises a mutation at residue G3, wherein the mutation is selected from the group consisting of: G3P, G3D, G3E, G3F, G3K, G3T, G3W, G3N, and G3S. In some embodiments, the mutation is G3P. In some embodiments, the variant polypeptide comprises a mutation at residue E6, wherein the mutation is selected from the group consisting of: E6R, E6K, E6G, E6T, E6A, E6S, E6H, E6L, E6M, E6N, E6P, E6Q, E6V, E6W, and E6Y. In some embodiments, the mutation is selected from the group consisting of: E6R, E6K, E6G, E6T, E6A, and E6S. In some embodiments, the mutation is selected from the group consisting of: E6R and E6K.
[0019] In some embodiments, the variant polypeptide comprises a mutation at residue D54, wherein the mutation is selected from the group consisting of: D54W, D54H, D54I, D54S, D54Q, D54L, D54M, D54Y, D54P, D54R, D54A, D54F, D54G, D54V, and D54T. In some embodiments, the mutation is selected from the group consisting of: D54W, D54H, D54S, D54Q, D54L, and D54Y.
[0020] In some embodiments, the variant polypeptide comprises a mutation at residue N91, wherein the mutation is selected from the group consisting of: N91V, N91A, N91D, N91F, N91G, N91S, N91I, N91P, N91R, N91L, N91T, N91C, N91K, N91Y and N91W. In some embodiments, the mutation is selected from the group consisting of: N91V, N91A, N91G, and N91S.
[0021] In some embodiments, the variant polypeptide further comprises a mutation at residue R104, wherein the mutation is selected from the group consisting of: R104S, R104Y, R104T, R104L, R104M, R104V, R104A, R104C, R104E, R104G, R104F, R104H, R104I, and R104N. In some embodiments, the mutation is selected from the group consisting of: R104S, R104Y, and R104T.
[0022] In some embodiments, the variant polypeptide comprises no mutation at residue R104.
[0023] In some embodiments, the variant polypeptide comprises a mutation at residue Q56, wherein the mutation is selected from the group consisting of: Q56A, Q56T, Q56G, Q56R, Q56S, Q56D, Q56P, Q56I, Q56Y, Q56H, Q56I, Q56K, Q56W, Q56L, Q56E, Q56F, Q56N, and Q56V. In some embodiments, the mutation is selected from the group consisting of: Q56T, Q56G, Q56R, Q56S, Q56D, Q56P, Q56I, and Q56Y.
[0024] In some embodiments, the variant polypeptide comprises no mutation at residue Q56.
[0025] In some embodiments, the variant polypeptide comprises a mutation at residue P57, wherein the mutation is selected from the group consisting of: P57A, P57E, P57F, P57G, P57R, P57W, P57S, P57T, P57V, P57Q, P57H, P57I, P57K, P57L, P57N, P57Y, and P57D. In some embodiments, the mutation is selected from the group consisting of: P57A, P57G, P57R, P57W, P57S, P57T, and P57V.
[0026] In some embodiments, the variant polypeptide comprises no mutation at residue P57.
[0027] In some embodiments, the variant polypeptide comprises mutations at G3, E6, D54, and N91. In some embodiments, the variant polypeptide comprises mutations: (i) G3P; (ii) E6R or E6K; (iii) D54W, D54H, D54S, or D54Q; and (iv) N91V, N91A, N91G, or N91S. In some embodiments, the variant polypeptide further comprises mutations at Q56 and P57.
[0028] In some embodiments, the variant polypeptide comprises the amino acid sequence set forth in any one of SEQ ID NOs: 2-299 and 307-318.
[0029] The present application in another aspect provides a method of engineering an IL-18 variant polypeptide from an IL-18 polypeptide, comprising introducing a cysteine at position 117 and / or position 76 of the IL-18 polypeptide, thereby promoting a disulfide bond between C117 and C76, wherein the amino acid position of the IL-18 polypeptide is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S.
[0030] The present application in another aspect provides a method of promoting yield and / or purity of an IL-18 variant polypeptide, comprising engineering an IL-18 polypeptide by introducing a cysteine at position 117 and / or position 76 of the IL-18 polypeptide, thereby promoting a disulfide bond between C117 and C76 of the variant polypeptide, wherein the amino acid position of the IL-18 polypeptide is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S.
[0031] In some embodiments according to any one of the methods described above, the method comprises a) introducing a cysteine at position 117, and b) retaining the cysteine at position 76 when the IL-18 polypeptide comprises a cysteine at position 76, or introducing a cysteine at position 76 when the IL-18 polypeptide comprises a non-cysteine at position 76.
[0032] In some embodiments according to any one of the methods described above, the method comprises a) introducing a cysteine at position 76, and b) retaining the cysteine at position 117 when the IL-18 polypeptide comprises a cysteine at position 117, or introducing a cysteine at position 117 when the IL-18 polypeptide comprises a non-cysteine at position 117.
[0033] In some embodiments according to any one of the methods described above, introducing a cysteine at position 117 or position 76 comprises a substitution of the amino acid at position 117 or position 76 with a cysteine. In some embodiments, a substitution of the amino acid at position 117 comprises a S117C substitution.
[0034] In some embodiments according to any one of the methods described above, the method further comprises removing one or both cysteines at position 38 and / or position 68 when the IL-18 polypeptide comprises cysteine at one or both position 38 and position 68. In some embodiments, removing one or both cysteines at position 38 and / or position 68 comprises a substitution of cysteine at position 38 and / or position 68 with a different amino acid. In some embodiments, the substitution of cysteine at position 38 comprises C38S, C38I, C38L, C38V, or C38M, optionally wherein the substitution of cysteine at position 38 comprises C38S, C38I, and C38V. In some embodiments, the substitution of cysteine at position 68 comprises C68S, C68I, C68V, C68L or C68D, optionally wherein the substitution of cysteine at position 38 comprises C68S, C68I, and C68L.
[0035] In some embodiments according to any one of the methods described above, the method further comprises retaining the cysteine at position 127 when the IL-18 polypeptide comprises a cysteine at position 127, or introducing a cysteine at position 127 when the IL-18 polypeptide comprises a non-cysteine at position 127.
[0036] In some embodiments according to any one of the methods described above, the method further comprises introducing an alanine or an amino acid that does not have a hydrophobic side chain at position 127, optionally the amino acid that does not have a hydrophobic side chain is selected from the group consisting of cysteine, serine, threonine, asparagine, glutamine, glycine, and proline, further optionally the amino acid that does not have a hydrophobic side chain is selected from the group consisting of cysteine, serine, and threonine. In some embodiments, introducing an alanine or an amino acid that does not have a hydrophobic side chain at position 127 comprises substitution of the amino acid at position 127 of the IL-18 polypeptide with an alanine or an amino acid that does not have a hydrophobic side chain.
[0037] In some embodiments according to any one of the methods described above, the IL-18 variant polypeptide comprises: a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S.
[0038] In some embodiments according to any one of the methods described above, the IL-18 variant polypeptide comprises an amino acid sequence set forth in any one of SEQ ID NOs: 311-312, 314-315, and 316-317, or a functional variant thereof having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity as any one of SEQ ID NOs: 311-312, 314-315, and 316-317. Functional variant as described in this application in the context of IL-18 variant polypeptide refers to variants that exhibit comparable IL-18 function as the reference IL-18 polypeptide (e.g., at least 50%, 60%, 70%, 75%, or 80%) of the function as measured by, for example, method described in Example 1.
[0039] The present application in another aspect provides a method of engineering an IL-18 variant polypeptide from an IL-18 polypeptide, comprising a) replace the cysteine by another amino acid at position 38, b) replace the cysteine at position 68, and / or c) replace the cysteine at position 76, wherein the IL-18 variant polypeptide comprises no free cysteine at each of the positions 38, 68, and 76. In some embodiments, the substituted amino acid in a) , b) or c) is an amino acid with hydrophobic side chain. In some embodiments, the amino acid with a hydrophobic side chain in a) , b) or c) is selected from the group consisting of alanine, valine, isoleucine, leucine, methionine, phenylamine, tyrosine, and tryptophan, optionally wherein the method comprises a) introducing any one of valine, isoleucine, leucine, and methionine into position 38, b) introducing any one of valine, isoleucine, and leucine into position 68, and / or c) introducing any one of valine and tyrosine into position 76, further optionally wherein introducing an amino acid with a hydrophobic side chain at position 38, 68, or 76 comprises substitution the amino acid at position 38, 68, or 76 with an amino acid with a hydrophobic side chain. In some embodiments, the method comprises a) introducing an isoleucine into position 38, b) introducing an isoleucine or leucine into position 68, and / or c) introducing any one of valine and tyrosine into position 76. In some embodiments, the IL-18 variant polypeptide comprises 38S, 38I, 38V, 38L, or 38M, optionally wherein IL-18 variant polypeptide comprises 38S, 38I, or 38V, further optionally wherein the IL-18 variant polypeptide comprises 38I. In some embodiments, the IL-18 variant polypeptide comprises 68S, 68I, 68V, 68L or 68D, optionally wherein the IL-18 variant polypeptide comprises 68S, 68I, or 68L, further optionally wherein the IL-18 variant polypeptide comprises 68S, or 68L. In some embodiments, the IL-18 variant polypeptide comprises 76V or 76Y. In some embodiments, the IL-18 variant polypeptide comprises: a) 38I, b) 68I or 68L, and c) 76V or 76Y. In some embodiments, the IL-18 variant polypeptide does not comprise 117C. In some embodiments, the IL-18 variant polypeptide further comprises a cysteine, alanine or an amino acid that does not have a hydrophobic side chain at position 127. In some embodiments, the IL-18 variant polypeptide comprises 38I, 68I, and 76V, optionally wherein the IL-18 variant polypeptide comprises 117S. In some embodiments, the IL-18 variant polypeptide further comprises 127I. In some embodiments, the IL-18 variant polypeptide comprises 38I, 68L, and 76Y, optionally wherein the IL-18 variant polypeptide comprises S117. In some embodiments according to any one of the methods described above, the IL-18 variant polypeptide comprises an amino acid sequence set forth in any one of SEQ ID NOs: 314-315, or a functional variant thereof having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity as any one of SEQ ID NOs: 314-315.
[0040] In some embodiments according to any one of the methods described above, the IL-18 polypeptide comprises an amino acid sequence of any one of SEQ ID NOs: 1-299, or a functional variant thereof having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity as any one of SEQ ID NOs: 1-299, optionally wherein the IL-18 polypeptide comprises an amino acid sequence set forth in any one of SEQ ID NOs: 1, 3, 9, 17, 27, 39, 43, 49, 94, 105, 116-117, 133, and 143-150, or a functional variant thereof having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity as any one of SEQ ID NOs: SEQ ID NOs: 1, 3, 9, 17, 27, 39, 43, 49, 94, 105, 116-117, 133, and 143-150, further optionally wherein the IL-18 polypeptide comprises an amino acid sequence set forth in any one of SEQ ID NOs: 1, 3, 9, 17, 27, 39, 43, 49, 94, 105, 29, and 117, or a functional variant thereof having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity as any one of SEQ ID NOs: 1, 3, 9, 17, 27, 39, 43, 49, 94, 105, 29, and 117, further optionally wherein the IL-18 polypeptide comprises an amino acid sequence set forth in any one of SEQ ID NOs: 1, 39, and 133, or a functional variant thereof having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity as any one of SEQ ID NOs: 1, 39, and 133.
[0041] The present application in another aspect provides an IL-18 variant polypeptide produced by any of the methods described above.
[0042] The present application in another aspect provides an IL-18 variant polypeptide comprising an amino acid sequence set forth in any one of SEQ ID NOs: 311-312, 314-315, and 316-317, or a functional variant thereof having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity as any one of SEQ ID NOs: 311-312, 314-315, and 316-317.
[0043] The present application in another aspect provides an IL-18 variant polypeptide comprising a cysteine at position 117 and a cysteine at position 76, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the IL-18 variant polypeptide does not comprise a cysteine at position 38, or the IL-18 variant polypeptide does not comprise a cysteine at position 68. In some embodiments, the IL-18 variant polypeptide does not comprise a cysteine at position 38, and the IL-18 variant polypeptide does not comprise a cysteine at position 68. In some embodiments, the IL-18 variant polypeptide comprises 38S, 38I, 38V, 38L, or 38M, optionally wherein IL-18 variant polypeptide comprises 38S, 38I, or 38V. In some embodiments, the IL-18 variant polypeptide comprises 68S, 68I, 68V, 68L or 68D, optionally wherein the IL-18 variant polypeptide comprises 68S, 68I, or 68L. In some embodiments, the IL-18 variant polypeptide comprises 127C. In some embodiments, the IL-18 variant polypeptide comprises at position 127 an alanine or an amino acid that does not have a hydrophobic side chain at position 127, optionally wherein the amino acid that does not have a hydrophobic side chain is selected from the group consisting of cysteine, serine, threonine, asparagine, glutamine, glycine, and proline, further optionally wherein the amino acid that does not have a hydrophobic side chain is selected from the group consisting of cysteine, serine, and threonine. In some embodiments, the IL-18 variant polypeptide comprises: a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S.
[0044] The present application in another aspect provides a fusion polypeptide comprising a) any one of the IL-18 variant polypeptides described above and b) a second moiety. In some embodiments, the second moiety comprises a half-life extending moiety, optionally wherein the half-life extending moiety is an albumin binding moiety or a Fc domain. In some embodiments, the half-life extending moiety comprises a Fc domain, optionally wherein the Fc domain is a human IgG Fc domain, further optionally wherein the human IgG Fc domain is a human IgG1 domain. In some embodiments, the Fc domain is a modified Fc domain with reduced effector function, optionally wherein the Fc domain comprises a human IgG1 Fc domain comprising an N297A mutation (EU numbering) . In some embodiments, the second moiety is fused to the N-terminus of the IL-18 variant polypeptide. In some embodiments, the second moiety is fused to the C-terminus of the IL-18 variant polypeptide. In some embodiments, the fusion polypeptide further comprises a linker between the IL-18 variant polypeptide and the second moiety, optionally wherein the linker is a peptide linker (such as a GS linker) . In some embodiments, the fusion polypeptide comprises an amino acid sequence set forth in any one of SEQ ID NOs: 323-324, 326-328, 330-332, 340-341, 343-345 and 347, or a functional variant thereof having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity as any one of SEQ ID NOs: 323-324, 326-328, 330-332, 340-341, 343-345 and 347.
[0045] The present application in another aspect provides a dimer comprising two fusion polypeptides selected from any one or two of the fusion polypeptides described herein. In some embodiments, the dimer is a homodimer. In some embodiments, the dimer is a heterodimer.
[0046] The present application in another aspect provides a nucleic acid encoding any of the IL-18 variant polypeptide or any of the fusion polypeptide described above.
[0047] The present application in another aspect provides a nucleic acid comprising a nucleic acid sequence of any one of SEQ ID NOs: 333-335. In some embodiments, provided is an activatable interleukin 18 (IL-18) polypeptide comprising: (a) an IL-18 polypeptide, and (b) a masking moiety wherein the IL-18 polypeptide is attached to the masking moiety via a cleavable linker. In some embodiments, the masking moiety inhibits the IL-18 polypeptide from activating IL-18 receptor mediated signaling when the masking moiety is attached to the IL-18 polypeptide via the cleavable linker. In some embodiments, the masking moiety comprises an IL-18 pro-peptide, an extracellular domain of IL-18Rα, an extracellular domain of IL-18Rβ, an IL-18 binding protein, a fragment of any one of the preceding, or a variant of any one of the preceding. In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 333, 336 and 353-356.
[0048] In some embodiments, the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by one or more proteases. In some embodiments, the one or more proteases are one or more tumor microenvironment (TME) proteases. In some embodiments, the one or more TME proteases are selected from the group consisting of: urokinase-type Plasminogen Activator, matriptase, legumain, prostate specific antigen, a dipeptidyl peptidase, hepsin, a matrix metalloprotease, a disintegrin and metalloproteinase, human leukocyte elastase, Proteinase 3, prourokinase, plasminogen, staphylokinase, a cathepsin, a tissue kallikrein and a Kallikrein-related peptidase. In some embodiments, the one or more TME proteases are matrix metalloproteases, and wherein the matrix metalloproteases are selected from the group consisting of: matrix metalloprotease 1, matrix metalloprotease 2, matrix metalloprotease 3, matrix metalloprotease 8, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 12, and matrix metalloprotease 14. In some embodiments, the cleavable linker comprises at one or more amino acid sequences that are recognized and cleaved by one or more of matrix metalloprotease 9, matrix metalloprotease 10, and legumain. In some embodiments, cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377.
[0049] In some embodiments, the IL-18 polypeptide comprises a wild-type IL-18. In some embodiments, the wild-type IL-18 comprises a wild-type human IL-18. In some embodiments, the wild-type human IL-18 comprises an amino acid sequence of SEQ ID NO: 1.
[0050] In some embodiments, the IL-18 polypeptide comprises an IL-18 variant polypeptide. In some embodiments, the IL-18 variant polypeptide specifically binds to IL-18 receptor α (IL-18Rα) and exhibits (i) substantially reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18 or (ii) no binding to IL-18BP. In some embodiments, the IL-18 variant polypeptide exhibits an increased binding to IL-18Rα relative to the wild-type IL-18. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150.
[0051] In some embodiments, the IL-18 polypeptide comprises a fusion protein comprising (1) a wild-type IL-18 or an IL-18 variant polypeptide and (2) an antibody Fc domain or variant thereof. In some embodiments, the IL-18 variant polypeptide of the fusion protein specifically binds to IL-18 receptor α (IL-18Rα) and exhibits (i) substantially reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18 or (ii) no binding to IL-18BP. In some embodiments, the IL-18 variant polypeptide of the fusion protein exhibits an increased binding to IL-18Rα relative to the wild-type IL-18. In some embodiments, the IL-18 variant polypeptide of the fusion protein comprises any one of SEQ ID NOs: 2-299 and 307-318. In some embodiments, the human IgG1 Fc domain variant of the fusion protein comprises an N297A mutation (EU numbering) . In some embodiments, the human IgG1 Fc domain variant comprises an amino acid sequence of SEQ ID NOs: 371 or 390. In some embodiments, the C-terminus of the IL-18 variant polypeptide of the fusion protein is fused to the N-terminus of the human IgG Fc domain or variant thereof of the fusion protein. In some embodiments, the C-terminus of the human IgG Fc domain or variant thereof of the fusion protein is fused to the N-terminus of the IL-18 variant polypeptide of the fusion protein. In some embodiments, the fusion polypeptide comprises an amino acid sequence of any one of SEQ ID NOs: 319-332 and 378-389.
[0052] In some embodiments, the activatable IL-18 polypeptide comprises an amino acid sequence of any one of SEQ ID NOs: 340-343, 345-352, 357-362, 364, 366-370, and 391-398.
[0053] In some embodiments, provided is a dimer comprising two activatable IL-18 polypeptides described herein. In some embodiments, the dimer is a homodimer. In some embodiments, the dimer is a heterodimer.
[0054] In some embodiments, provided is a nucleic acid encoding an activatable IL-18 polypeptide described herein. In some embodiments, provided is a vector comprising a nucleic acid described herein. In some embodiments, provided is a host cell comprising a nucleic acid described herein or a vector described herein. In some embodiments, provided is a method of producing an activatable IL-18 polypeptide, comprising: (a) culturing a host cell described herein under conditions where the activatable IL-18 polypeptide is expressed, and (b) recovering the activatable IL-18 polypeptide produced by the host cell. In some embodiments, the host cell is a mammalian host cell (e.g., a CHO cell or an HEK293 cell) . In some embodiments, the method comprises (such as further comprises) purifying the activatable IL-18 polypeptide.
[0055] In some embodiments, provided is a pharmaceutical composition comprising an activatable IL-18 polypeptide described herein, a nucleic acid described herein, or a vector described herein.
[0056] In some embodiments, provided is a method of treating a disease in an individual, comprising administering to the individual an effective amount of a pharmaceutical composition described herein. In some embodiments, the disease is cancer. In some embodiments, provided is a method of activating IL-18 receptor mediated signaling in an individual, comprising administering to the individual an effective amount of a pharmaceutical composition described herein. In some embodiments, provided is a method of stimulating antigen-experienced immune cells in an individual in need thereof, comprising administering to the individual an effective amount of the pharmaceutical composition described herein. In some embodiments, the stimulation comprises increasing activity and / or number of the antigen-experienced immune cells.
[0057] In some embodiments, the individual is human.
[0058] It is to be understood that one, some, or all of the properties of the various embodiments described herein may be combined to form other embodiments of the present invention. These and other aspects of the invention will become apparent to one of skill in the art. These and other embodiments of the invention are further described by the detailed description that follows.
[0059] The disclosures of all publications, patents, patent applications and published patent applications referred to herein are hereby incorporated herein by reference in their entirety.BRIEF DESCRIPTION OF THE DRAWINGS
[0060] FIG 1A shows the results of biolayer interferometry experiments that were performed to assess the binding of WT hIL-18 and proIL-18 to hIL-18Rα.
[0061] FIG 1B illustrates activation of hIL-18 receptor mediated signaling by proIL-18, before and after the treatment of proIL-18 with Caspase-1, and by Caspase-1-treated proIL-18 in the presence of hIL-18 binding protein.
[0062] FIG 2A illustrates activation of hIL-18 receptor mediated signaling by proIL-18-MMP9L, before and after the treatment of proIL-18-MMP9L with MMP9.
[0063] FIG 2B illustrates activation of hIL-18 receptor mediated signaling by proIL-18-MMP10L.
[0064] FIG 2C illustrates activation of hIL-18 receptor mediated signaling by proIL-18-Legu L, before and after the treatment of proIL-18-Legu L with Legumain.
[0065] FIG 3A shows the size-exclusion chromatography curves of ProM12, MMP9 cleaved ProM12 ( “ProM12 Cut” ) , and M12.
[0066] FIG 3B shows the size-exclusion chromatography curves of ProMM5, MMP9 cleaved ProMM5 ( “ProMM5 Cut” ) , and MM5.
[0067] FIG 3C illustrates activation of hIL-18 receptor mediated signaling by ProM12, M12, ProM12 Cut, and ProM12 Cut + hIL-18 binding peptide (BP) .
[0068] FIG 3D illustrates activation of hIL-18 receptor mediated signaling by ProMM5, MM5, ProMM5 Cut, and ProMM5 Cut + hIL-18 binding peptide (BP) .
[0069] FIG 3E illustrates activation of hIL-18 receptor mediated signaling by ProM21, M21, and ProM21 Cut.
[0070] FIG 3F illustrates activation of hIL-18 receptor mediated signaling by ProM13, M13, and ProM13 Cut.
[0071] FIG 3G illustrates activation of hIL-18 receptor mediated signaling by ProM24, M24, and ProM24 Cut.
[0072] FIG 3H illustrates activation of hIL-18 receptor mediated signaling by ProWM4, WM4, and ProWM4 Cut.
[0073] FIG 3I illustrates activation of hIL-18 receptor mediated signaling by ProWM5, WM5, and ProWM5 Cut.
[0074] FIG 3J illustrates activation of hIL-18 receptor mediated signaling by ProWM6, WM6, and ProWM6 Cut.
[0075] FIG 3K illustrates activation of hIL-18 receptor mediated signaling by ProM12, M12, ProM12 digested with MMP9, and ProM12 digested with Caspase-1.
[0076] FIG 4A shows the results of PBMC-based assays that were performed to assess the abilities of M12, ProM12, and ProM12 Cut in inducing hIFNγ release.
[0077] FIG 4B shows the results of PBMC-based assays that were performed to assess the abilities of MM5, ProMM5, and ProMM5 Cut in inducing hIFNγ release.
[0078] FIG 5A illustrates activation of hIL-18 receptor mediated signaling by M12-DB6-Fc_N297A, Ra-M12-DB6-Fc_N297A, and Ra-M12-DB6-Fc_N297A Cut.
[0079] FIG 5B illustrates activation of hIL-18 receptor mediated signaling by M12-DB6-Fc_N297A, D12-M12-DB6-Fc_N297A, and D12-M12-DB6-Fc_N297A Cut.
[0080] FIG 5C illustrates activation of hIL-18 receptor mediated signaling by M12-DB6-Fc_N297A, BPm-M12-DB6-Fc_N297A, and BPm-M12-DB6-Fc_N297A Cut.
[0081] FIG 6A illustrates activation of hIL-18 receptor mediated signaling by MM5-DB6-Fc_N297A, Ra-MM5-DB6-Fc_N297A, and Ra-MM5-DB6-Fc_N297A Cut.
[0082] FIG 6B illustrates activation of hIL-18 receptor mediated signaling by MM5-DB6-Fc_N297A, D12-MM5-DB6-Fc_N297A, and D12-MM5-DB6-Fc_N297A Cut.
[0083] FIG 6C illustrates activation of hIL-18 receptor mediated signaling by Fc_N297A-MM5-DB6, Fc_N297A-Ra-MM5-DB6, and Fc_N297A-Ra-MM5-DB6 Cut.
[0084] FIG 6D illustrates activation of hIL-18 receptor mediated signaling by Fc_N297A-MM5-DB6, Fc_N297A-MM5-DB6-Ra, and Fc_N297A-MM5-DB6-Ra Cut.
[0085] FIG 7 illustrates activation of hIL-18 receptor mediated signaling by Fc_N297A-M12-DB6, Fc_N297A-M12-DB6-Ra with linker of variable length, and Fc_N297A-M12-DB6-Ra Cut by MMP9.
[0086] FIG 8A, B illustrates activation of hIL-18 receptor mediated signaling by Fc_N297A-M12-DB6, Fc_N297A-M12-DB6-Ra with multi-protease recognized linkers, and Fc_N297A-M12-DB6-Ra Cut by MMP9.
[0087] FIG 9A illustrates activation of hIL-18 receptor mediated signaling by Fc_N297A-M12-DB6, Fc_N297A-M12-DB6-Ra with multi-protease recognition linker UM-2, and Fc_N297A-M12-DB6-Ra-UM2 cut by MMP9, MMP14 or uPA, respectively.
[0088] FIG 9B illustrates activation of hIL-18 receptor mediated signaling by Fc_N297A-MM5-DB6, Fc_N297A-MM5-DB6-Ra with multi-protease recognition linker UM-2, and Fc_N297A-MM5-DB6-Ra-UM2 cut by MMP9, MMP14 or uPA, respectively.
[0089] DETAILED DESCRIPTION OF THE APPLICATION
[0090] Overview
[0091] The present application is based in part on Applicant’s identification of activatable IL-18 polypeptides that comprise (a) a wild-type IL18 (such as a wild-type human IL-18) , a variant thereof comprising at least one amino acid substitution relative to a wild-type IL-18 (such as. a wild-type human IL-18) , or a fusion polypeptide comprising either of the preceding, and (b) a masking moiety. The masking moiety is linked to the wild-type IL-18, the IL-18 variant polypeptide, or the fusion polypeptide via a cleavable linker that comprises a site that is recognized and cleaved, e.g., by a tumor microenvironment (TME) protease. The activatable IL-18 polypeptides are not capable of stimulating IL-18 receptor mediated signaling, or are not able to fully active the IL-18 receptor mediated signaling, until the masking moiety is separated from the wild-type IL-18, the IL-18 variant polypeptide, or the fusion polypeptide, e.g., following cleavage by a protease, such as a TME protease.
[0092] Definitions
[0093] As used herein, the terms “specifically binds, ” “specifically recognizing, ” and “is specific for” refer to measurable and reproducible interactions, such as binding between a cytokine and a receptor thereof, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules. For example, a cytokine that specifically recognizes a receptor is the cytokine that binds this receptor with greater affinity, avidity, more readily, and / or with greater duration than its bindings to other targets. In some embodiments, the extent of binding of cytokine to an unrelated target is less than about 10%of the binding of the cytokine to the receptor thereof as measured, e.g., by a radioimmunoassay (RIA) . In some embodiments, a cytokine that specifically binds the receptor thereof has a dissociation constant (KD) of ≤10-5 M, ≤10-6 M, ≤10-7 M, ≤10-8 M, ≤10-9 M, ≤10-10 M, ≤10-11 M, or ≤10-12 M. In some embodiments, said specific binding can include, but does not require exclusive binding. Binding specificity of the cytokine can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to, e.g., Western blots, ELISA-, RIA-, ECL-, IRMA-, EIA-, BIACORETM -tests and peptide scans.
[0094] An “isolated” nucleic acid molecule encoding a polypeptide or a cytokine as described herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment. In some embodiments, the isolated nucleic acid molecule encoding the polypeptide or the cytokine described herein is in a form other than in the form or setting in which it is found in nature.
[0095] The term “vector, ” as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as “expression vectors. ”
[0096] The term “transfected” or “transformed” or “transduced” as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
[0097] The terms “host cell, ” “host cell line, ” and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include “transformants” and “transformed cells, ” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, and may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
[0098] As used herein, “treatment” or “treating” is an approach for obtaining beneficial or desired results, including clinical results. For purposes of this application, beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease) , preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delaying or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and / or prolonging survival. Also encompassed by “treatment” is a reduction of pathological consequence of cancer (such as, for example, tumor volume) . The methods of the application contemplate any one or more of these aspects of treatment.
[0099] In the context of cancer, the term “treating” includes any or all of: inhibiting growth of cancer cells, inhibiting replication of cancer cells, lessening of overall tumor burden and ameliorating one or more symptoms associated with the disease.
[0100] The terms “inhibition” or “inhibit” refer to a decrease or cessation of any phenotypic characteristic or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. To “reduce” or “inhibit” is to decrease, reduce or arrest an activity, function, and / or amount as compared to that of a reference. In certain embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 20%or greater. In another embodiment, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 50%or greater. In yet another embodiment, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater.
[0101] The terms “subject, ” “individual, ” and “patient” are used interchangeably herein to refer to a mammal, including, but not limited to, human, bovine, horse, feline, canine, rodent, or primate. In some embodiments, the individual is a human.
[0102] It is understood that embodiments of the application described herein include “consisting” and / or “consisting essentially of” embodiments.
[0103] Reference to “about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X” .
[0104] As used herein, reference to “not” a value or parameter generally means and describes “other than” a value or parameter. For example, the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.
[0105] The term “about X-Y” used herein has the same meaning as “about X to about Y. ”
[0106] As used herein and in the appended claims, the singular forms “a, ” “or, ” and “the” include plural referents unless the context clearly dictates otherwise.
[0107] Activatable Interleukin 18 (IL-18) Polypeptides
[0108] In some embodiments, provided is an activatable interleukin 18 (IL-18) polypeptide comprising: (a) an IL-18 polypeptide and (b) a masking moiety, wherein the IL-18 polypeptide is attached to the masking moiety via a cleavable linker. As used herein, “IL-18 polypeptide” refers to a wild-type IL-18, an IL-18 variant polypeptide, or a fusion protein comprising the wild-type IL-18 or the IL-18 variant polypeptide. In some embodiments, the masking moiety prevents (such as inhibits or decreases) the IL-18 polypeptide from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) when the masking moiety is attached to the IL-18 polypeptide via the cleavable linker.
[0109] In some embodiments, the masking moiety comprises or is derived from (i) an IL-18 pro-peptide (e.g., a human IL-18 propeptide) , an extracellular domain of IL-18Rα (e.g., an extracellular domain of human IL-18Rα) , an extracellular domain of IL-18Rβ (e.g., an extracellular domain of human IL-18Rβ) , an IL-18 binding protein (e.g., a human IL-18 binding protein) , a fragment of any one of the preceding, or a variant of any one of the preceding. In some embodiments the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 333, 336 and 353-356. In some embodiments, the masking moiety comprises two or more set of amino acid sequences set forth in SEQ ID NOs: 333, 336 and 353-356. In some embodiments, the cleavable linker comprises at least one amino acid sequence that is recognized and cleaved by a protease. In some embodiments, the cleavable linker comprises two or more sequences that are recognized and cleaved by proteases. In some embodiments, the two or more sequences are recognized and cleaved by different proteases. In some embodiments, the two or more sequences are recognized and cleaved by the same protease. In some embodiments, the protease is a tumor microenvironment (TME) protease. In some embodiments, the TME protease is urokinase-type Plasminogen Activator (uPA) , matriptase (MTSP-1) , legumain, prostate specific antigen (PSA) , a dipeptidyl peptidase (e.g., DPP4) , hepsin, a matrix metalloprotease (including, but not limited to, e.g., matrix metalloprotease 1 (MMP1) , matrix metalloprotease 2 (MMP2) , matrix metalloprotease 3 (MMP3) , matrix metalloprotease 8 (MMP8) , matrix metalloprotease 9 (MMP9) , matrix metalloprotease 10 (MMP10) , matrix metalloprotease 12 (MMP12) , or matrix metalloprotease 14 (MMP14) ) , a disintegrin and metalloproteinase (ADAM 10, 17, etc. ) , human leukocyte elastase (HLE) , Proteinase 3 (PR3) , prourokinase, plasminogen, staphylokinase, a serine protease, a plasmin, a cathepsin (B, L, S) , a tissue kallikrein and / or a Kallikrein-related peptidase (KLK 1, 2, 3, 6, 7) . In some embodiments, the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: VLK, SEQ ID NOs: 337, SEQ ID NO: 338, SEQ ID NO: 339, SEQ ID NOs: 372-377, a sequence described in Kridel et al. (2002) J Biol Chem. 277 (26) : 23788-93, and a sequence described in Chen et al. (2002) J Biol Chem. 277 (6) : 4485–4491.
[0110] In some embodiments, IL-18 polypeptide is or comprises a wild-type IL-18. In some embodiments, the wild-type IL-18 is a wild-type human IL-18 (hIL-18) . In some embodiments, the wild-type hIL18 comprises the amino acid sequence of SEQ ID NO: 1. In some embodiments, IL-18 polypeptide is or comprises an IL-18 variant polypeptide. In some embodiments, the IL-18 variant polypeptide specifically binds to IL-18 receptor α (IL-18Rα) and exhibits (i) substantially reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18 or (ii) no binding to IL-18BP. In some embodiments, the IL-18 variant polypeptide exhibits an increased binding to IL-18Rα relative to the wild-type IL-18. Exemplary IL-18 variant polypeptides that can be included in an activatable IL-18 polypeptide are described in further detail elsewhere herein. In some embodiments, the IL-18 variant polypeptide comprises the amino acid sequence of any one of SEQ ID NOs: 2-299 and 307-318. In some embodiments, the IL-18 variant polypeptide comprises the amino acid sequence of any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, IL-18 polypeptide is or comprises a fusion polypeptide. In some embodiments, the fusion polypeptide comprises (1) a wild-type IL-18 or an IL-18 variant polypeptide (e.g., an IL-18 variant described herein) and (2) an antibody Fc domain. In some embodiments, the antibody Fc domain is a human Fc domain. In some embodiments, the human Fc domain is a human IgG Fc domain, such as an IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the Fc domain is an Fc variant, e.g., a variant of a human Fc domain that comprises one or more amino acid insertions, deletions, or substitutions relative to a wild-type human Fc domain. In some embodiments, the Fc domain variant is a variant of a human IgG1 Fc domain. In some embodiments, the variant of the human IgG1 Fc domain comprises an N297A substitution, wherein the amino acid numbering is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991. In some embodiments, the variant of the human IgG1 Fc domain comprises an N297A substitution comprises the amino acid sequence set forth in SEQ ID NO: 371 or SEQ ID NO: 390. Exemplary fusion polypeptides that can be included are described in further detail elsewhere herein. In some embodiments, variant of the human IgG1 Fc domain that comprises an N297A substitution comprises the amino acid sequence of SEQ ID NO: 371 (see the Sequence Summary Table) .
[0111] In some embodiments, the activatable IL-18 polypeptide further comprises a spacer sequence (e.g., a non-cleavable linker sequence) . In some embodiments, the spacer sequence comprises 3-200 amino acids. Suitable spacer sequences are known in the art, and include, but are not limited to, peptide linkers containing flexible amino acid residues, such as glycine and serine. In some embodiments, the spacer sequence is or comprises the amino acid sequence of GGGGSGGGGSGGGGS (SEQ ID NO: 363) or GGGGSGGGGSGSGGG (SEQ ID NO: 365) .
[0112] In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a masking moiety, (ii) a cleavable linker, and (iii) a wild-type IL-18 or an IL-18 variant polypeptide. In some embodiments, the masking moiety comprises an IL-18 pro-peptide (i.e., pro-IL-18 pro-peptide) , an extracellular domain of IL-18Rα, an extracellular domain of IL-18Rβ, an IL-18 binding protein, a fragment of any one of the preceding, or a variant of any one of the preceding. In some embodiments, the masking moiety comprises an IL-18 pro-peptide (i.e., pro-IL-18 pro-peptide) , optionally wherein the IL-18 pro-peptide comprises a pro-peptide of human IL-18 (hIL-18) , optionally wherein the pro-peptide of hIL-18 comprises the amino acid sequence of SEQ ID NO: 333. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the cleavable linker can be recognized and cleaved by two or more proteases (such as ULM, LM9, see examples) . In some embodiments, the cleavable linker has spacer sequences (GS linker) flanking the amino acid sequence recognized by a protease. In some embodiments, the cleavable linker has a length of about 10-40, 15-40, 20-40, 20-30, or 25-30 amino acids. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S. In some embodiments, the variant IL-18 polypeptide further comprises C76 and C117, and the amino acid at position 38 and position 68 are not cysteine. In some embodiments, the variant polypeptide comprises a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence of SEQ ID NO: 311, 312 or 316.
[0113] In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprising the amino acid sequence of SEQ ID NO: 333, (ii) a cleavable linker, and (iii) a wild-type IL-18 or an IL-18 variant polypeptide. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the cleavable linker can be recognized and cleaved by two or more proteases (such as ULM, LM9, see examples) . In some embodiments, the cleavable linker has spacer sequences (GS linker) flanking the amino acid sequence recognized by a protease. In some embodiments, the cleavable linker has a length of about 10-40, 15-40, 20-40, 20-30, or 25-30 amino acids. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S. In some embodiments, the variant IL-18 polypeptide further comprises C76 and C117, and the amino acid at position 38 and position 68 are not cysteine. In some embodiments, the variant polypeptide comprises a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence of SEQ ID NO: 311, 312 or 316.
[0114] In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a masking moiety comprising an extracellular domain of IL-18Rα (e.g., Domains 1-3, e.g., Domains 1-2) , (ii) a cleavable linker, and (iii) a wild-type IL-18 or an IL-18 variant polypeptide. In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the cleavable linker can be recognized and cleaved by two or more proteases (such as ULM, LM9, see examples) . In some embodiments, the cleavable linker has spacer sequences (GS linker) flanking the amino acid sequence recognized by a protease. In some embodiments, the cleavable linker has a length of about 10-40, 15-40, 20-40, 20-30, or 25-30 amino acids. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S. In some embodiments, the variant IL-18 polypeptide further comprises C76 and C117, and the amino acid at position 38 and position 68 are not cysteine. In some embodiments, the variant polypeptide comprises a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence of SEQ ID NO: 311, 312 or 316.
[0115] In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a wild-type IL-18 or an IL-18 variant polypeptide, (ii) a cleavable linker, and (iii) a masking moiety. In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα (e.g., Domains 1-3, e.g., Domains 1-2) . In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the cleavable linker can be recognized and cleaved by two or more proteases (such as ULM, LM9, see examples) . In some embodiments, the cleavable linker has spacer sequences (GS linker) flanking the amino acid sequence recognized by a protease. In some embodiments, the cleavable linker has a length of about 10-40, 15-40, 20-40, 20-30, or 25-30 amino acids. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S. In some embodiments, the variant IL-18 polypeptide further comprises C76 and C117, and the amino acid at position 38 and position 68 are not cysteine. In some embodiments, the variant polypeptide comprises a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence of SEQ ID NO: 311, 312 or 316.
[0116] In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a Fc domain (e.g., a human IgG1 Fc domain) , (ii) a masking moiety, (iii) a cleavable linker, and (iv) a wild-type IL-18 or an IL-18 variant polypeptide. In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα (e.g., Domains 1-3, e.g., Domains 1-2) . In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the cleavable linker can be recognized and cleaved by two or more proteases (such as ULM, LM9, see examples) . In some embodiments, the cleavable linker has spacer sequences (GS linker) flanking the amino acid sequence recognized by a protease. In some embodiments, the cleavable linker has a length of about 10-40, 15-40, 20-40, 20-30, or 25-30 amino acids. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S. In some embodiments, the variant IL-18 polypeptide further comprises C76 and C117, and the amino acid at position 38 and position 68 are not cysteine. In some embodiments, the variant polypeptide comprises a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence of SEQ ID NO: 311, 312 or 316. In some embodiments, the activatable IL-18 polypeptide further comprises a spacer (e.g., a GS linker) between the Fc domain and its adjacent domain. In some embodiments, the spacer is a peptide linker having about 5, 10, 15 , 20, 25, 30, or more amino acids.
[0117] In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a masking moiety, (ii) a cleavable linker, (iii) a wild-type IL-18 or an IL-18 variant polypeptide, and (iv) a Fc domain (e.g., a human IgG1 Fc domain) . In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα (e.g., Domains 1-3, e.g., Domains 1-2) . In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the cleavable linker can be recognized and cleaved by two or more proteases (such as ULM, LM9, see examples) . In some embodiments, the cleavable linker has spacer sequences (GS linker) flanking the amino acid sequence recognized by a protease. In some embodiments, the cleavable linker has a length of about 10-40, 15-40, 20-40, 20-30, or 25-30 amino acids. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S. In some embodiments, the variant IL-18 polypeptide further comprises C76 and C117, and the amino acid at position 38 and position 68 are not cysteine. In some embodiments, the variant polypeptide comprises a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence of SEQ ID NO: 311, 312 or 316. In some embodiments, the activatable IL-18 polypeptide further comprises a spacer (e.g., a GS linker) between the Fc domain and its adjacent domain. In some embodiments, the spacer is a peptide linker having about 5, 10, 15 , 20, 25, 30, or more amino acids.
[0118] In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a Fc domain (e.g., a human IgG1 Fc domain) , (ii) a wild-type IL-18 or an IL-18 variant polypeptide, (iii) a cleavable linker, and (iv) a masking moiety. In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα (e.g., Domains 1-3, e.g., Domains 1-2) . In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the cleavable linker can be recognized and cleaved by two or more proteases (such as ULM, LM9, see examples) . In some embodiments, the cleavable linker has spacer sequences (GS linker) flanking the amino acid sequence recognized by a protease. In some embodiments, the cleavable linker has a length of about 10-40, 15-40, 20-40, 20-30, or 25-30 amino acids. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S. In some embodiments, the variant IL-18 polypeptide further comprises C76 and C117, and the amino acid at position 38 and position 68 are not cysteine. In some embodiments, the variant polypeptide comprises a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence of SEQ ID NO: 311, 312 or 316. In some embodiments, the activatable IL-18 polypeptide further comprises a spacer (e.g., a GS linker) between the Fc domain and its adjacent domain. In some embodiments, the spacer is a peptide linker having about 5, 10, 15 , 20, 25, 30, or more amino acids.
[0119] In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a wild-type IL-18 or an IL-18 variant polypeptide, (ii) a cleavable linker, (iii) a masking moiety, and (iv) a Fc domain (e.g., a human IgG1 Fc domain) . In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα (e.g., Domains 1-3, e.g., Domains 1-2) . In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the cleavable linker can be recognized and cleaved by two or more proteases (such as ULM, LM9, see examples) . In some embodiments, the cleavable linker has spacer sequences (GS linker) flanking the amino acid sequence recognized by a protease. In some embodiments, the cleavable linker has a length of about 10-40, 15-40, 20-40, 20-30, or 25-30 amino acids. In some embodiments, the variant IL-18 polypeptide comprises 3P, 6K, 54G, 56G, 57A, and 91T. In some embodiments, the variant IL-18 polypeptide comprises 6G, 54L, 56T, 57E, 91G, and 104S. In some embodiments, the variant IL-18 polypeptide further comprises C76 and C117, and the amino acid at position 38 and position 68 are not cysteine. In some embodiments, the variant polypeptide comprises a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127. In some embodiments, the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence of SEQ ID NO: 311, 312 or 316. In some embodiments, the activatable IL-18 polypeptide further comprises a spacer (e.g., a GS linker) between the Fc domain and its adjacent domain. In some embodiments, the spacer is a peptide linker having about 5, 10, 15 , 20, 25, 30, or more amino acids.
[0120] In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a masking moiety, (ii) a cleavable linker, (iii) a wild-type IL-18 or an IL-18 variant polypeptide, and (iv) a human IgG1 Fc domain or a variant thereof. In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a wild-type IL-18 or an IL-18 variant polypeptide, (ii) a cleavable linker, (iii) a masking moiety, and (iv) a human IgG1 Fc domain or a variant thereof. In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a human IgG1 Fc domain or a variant thereof, (ii) a spacer sequence, (iii) a masking moiety, (iv) cleavable linker, and (v) a wild-type IL-18 or an IL-18 variant polypeptide. In some embodiments, the activatable IL-18 polypeptide comprises, from N-terminus to C-terminus, (i) a human IgG1 Fc domain or variant thereof, (ii) a spacer sequence, (iii) a wild-type IL-18 or an IL-18 variant polypeptide, (iv) a cleavable linker, and (v) a masking moiety. In some embodiments, the activatable IL-18 polypeptide comprises the amino acid sequence of any one of SEQ ID NOs: 319-332 and 378-389. In some embodiments, the activatable IL-18 polypeptide comprises the amino acid sequence of any one of SEQ ID NOs: 341-343, 345-352, 357-362, 364, 366-370, and 391-398.
[0121] In some embodiments, provided is a dimer comprising two activatable IL-18 polypeptides described herein. In some embodiments, the dimer is a homodimer. In some embodiments, the dimer is a heterodimer.
[0122] Interleukin 18 (IL-18) Variant Polypeptides
[0123] In some embodiments, the activatable IL-18 polypeptide comprises an IL-18 variant polypeptide. In some embodiments, the IL-18 variant polypeptides comprises mutation (s) at one or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, wherein amino acid positions are relative to a wild type (WT) human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the wild-type IL-18 is human IL-18 comprising the amino acid sequence of SEQ ID NO: 1.
[0124] In some embodiments, the IL-18 variant polypeptide comprises mutations at two or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, wherein amino acid positions are relative to a wild type (WT) human IL-18 set forth in SEQ ID NO: 1, e.g., in any combination. In some embodiments, the two or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at three or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the three or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at four or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the four or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at five or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the five or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at six or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the six or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at seven or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the seven or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at eight or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the eight or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at nine or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the nine or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at ten or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the ten or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at eleven or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the eleven or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at twelve or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the twelve or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at thirteen or more of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, e.g., in any combination. In some embodiments, the thirteen or more mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises mutations at F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide does not comprise mutations at positions other than F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant comprises (or further comprises) mutations at positions other than at F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the IL-18 variant polypeptide comprises one or more mutations (such as any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mutations) , wherein at least one, at least 2, at least 3, or at least 4 mutations are selected from the group consisting of: F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149. In some embodiments, the wild-type IL-18 is human IL-18 comprising the amino acid sequence of SEQ ID NO: 1.
[0125] In some embodiments, the one or more mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the IL-18 variant polypeptide comprises mutations at two or more of G3, E6, D54, and N91, e.g., in any combination. In some embodiments, the two or more mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the IL-18 variant polypeptide comprises mutations at three or more of G3, E6, D54, and N91, e.g., in any combination. In some embodiments, the three or more mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the IL-18 variant polypeptide comprises mutations at G3, E6, D54, and N91. In some embodiments, the IL-18 variant polypeptide does not comprise mutations at positions other than G3, E6, D54, and / or N91. In some embodiments, the IL-18 variant comprises (or further comprises) mutations at positions other than at G3, E6, D54, and / or N91. In some embodiments, the IL-18 variant polypeptide comprises one or more mutations (such as any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mutations) , wherein at least one, at least 2, at least 3, or at least 4 mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the wild-type IL-18 is human IL-18 comprising the amino acid sequence of SEQ ID NO: 1.
[0126] In some embodiments, the IL-18 variant polypeptide comprises (e.g., further comprises) at least one mutation at a residue selected from the group consisting of Q56, P57, M60, Q103, R104, M113, and N155, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1.
[0127] In some embodiments, the IL-18 variant polypeptide comprises (or further comprises) at least one, at least two, at least three, at least four, at least five, or six mutation at residues selected from the group consisting of C38, C68, C76, D98, S117, and C127, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the IL-18 variant polypeptide comprises (or further comprises) a substitution at C38 (i.e., wherein the wild-type cysteine at position 38 is substituted with any amino acid) , a substitution at C68 (i.e., wherein the wild-type cysteine at position 68 is substituted with any amino acid) , and an S117C substitution. In some embodiments, the IL-18 variant polypeptide comprises (or further comprises) a C38I, C38V, C38L, C38M or C38S mutation. Additionally or alternatively, in some embodiments, the IL-18 variant polypeptide comprises (or further comprises) a C68S, C68I, C68D, C68V or C68L mutation. Additionally or alternatively, in some embodiments, the IL-18 variant polypeptide comprises (or further comprises) a C76S, C76V, or C76Y mutation. Additionally or alternatively, in some embodiments, the IL-18 variant polypeptide comprises (or further comprises) an S117C mutation. Additionally or alternatively, in some embodiments, the IL-18 variant polypeptide comprises (or further comprises) a C127A, C127Y, C127F, C127L or C127I mutation. In some embodiments, the IL-18 variant polypeptide comprises (or further comprises) at least one, at least two, at least three, or four mutations selected from the group consisting of C38S, C68S, C76S, and C127S, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the IL-18 variant polypeptide comprises (or further comprises) C38S, C68S, and C76S mutations. In some embodiments, the IL-18 variant polypeptide comprises (or further comprises or consists of) C38I, C68S, and S117C mutations. In some embodiments, the IL-18 variant polypeptide comprises (or further comprises or consists of) C38V, C68I, S117C, and C127A mutations. In some embodiments, the IL-18 variant polypeptide comprises (or further comprises or consists of) C38S, C68I, S117C, and C127I mutations. In some embodiments, the IL-18 variant polypeptide comprises (or further comprises or consists of) C38I, C68I, C76V, and C127I mutations. In some embodiments, the IL-18 variant polypeptide comprises (or further comprises or consists of) C38I, C68L, and C76Y mutations.
[0128] In some embodiments, the IL-18 variant polypeptide further comprises mutation (s) at one or more of Q56, P57, and R104. In some embodiments, the IL-18 variant polypeptide further comprises mutations at two or more of Q56, P57, and R104. In some embodiments, the IL-18 variant polypeptide further comprises mutations at Q56, P57, and R104. In some embodiments, the IL-18 variant polypeptide does not comprise mutations at positions other than G3, E6, D54, Q56, P57, N91, and / or R104. In some embodiments, the IL-18 variant comprises (or further comprises) mutations at positions other than G3, E6, D54, Q56, P57, N91, and / or R104. In some embodiments, the IL-18 variant polypeptide comprises one or more mutations (such as any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mutations) , wherein at least one, at least 2, at least 3, at least 4, at least 5, at least 6, or at least 7 mutations are selected from the group consisting of: G3, E6, D54, Q56, P57, N91, and R104. In some embodiments, the IL-18 variant polypeptide does not comprise substitutions at Q56 and P57, wherein the amino acid positions are relative to SEQ ID NO: 1. In some embodiments, the wild-type IL-18 is human IL-18 comprising the amino acid sequence of SEQ ID NO: 1.
[0129] In some embodiments, the IL-18 variant polypeptide specifically binds to IL-18 receptor α (“IL-18Rα” ) , e.g., human IL-18Rα or “hIL-18α, ” and exhibits substantially reduced binding to IL-18 binding protein ( “IL-18BP” ) , e.g., human IL-18 or “hIL-18BP. ” In some embodiments, the IL-18 variant polypeptide exhibits substantially reduced binding to IL-18BP, relative to the WT human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the affinity of the IL-18 variant polypeptide for IL-18Rα (e.g., hIL-18Rα) is comparable to the affinity of WT human IL-18 set forth in SEQ ID NO: 1 for IL-18Rα (e.g., hIL-18Rα) . In some embodiments, the affinity of the IL-18 variant polypeptide for IL-18Rα (e.g., hIL-18Rα) is increased as compared to the affinity of WT human IL-18 set forth in SEQ ID NO: 1 for IL-18Rα (e.g., hIL-18Rα) .
[0130] In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of less than about 5 x 10-5 M, less than about 5 x 10-6 M, less than about 5 x 10-7 M, less than about 5 x 10-8 M, less than about 5 x 10-9 M, less than about 5 x 10-10 M, or less than about 5 x 10-11 M, including any range in between these values. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-5 and about 5 x 10-11 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-7 and about 5 x 10-11 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-7 and about 5 x 10-10 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rαwith a KD of between about 5 x 10-7 and about 5 x 10-9 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-8 and about 5 x 10-11 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-9 and about 5 x 10-11 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-8 and about 5 x 10-10 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-7 and about 5 x 10-10 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-9 and about 5 x 10-10 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-7 and about 5 x 10-9 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18Rα with a KD of between about 5 x 10-8 and about 5 x 10-9 M. In some embodiments, the IL-18 variant binds IL-18Rα (e.g., hIL-18Rα) with a KD between about 5 x 10-5 and 5 x 10-11 M, e.g., about any one of 5 x 10-5, 6 x 10-5, 7 x 10-5, 8 x 10-5, 9 x 10-5, 1 x 10-6, 2 x 10-6, 3 x 10-6, 4 x 10-6, 5 x 10-6, 6 x 10-6, 7 x 10-6, 8 x 10-6, 9 x 10-6, 1 x 10-7, 2 x 10-7, 3 x 10-7, 4 x 10-7, 5 x 10-7, 6 x 10-7, 7 x 10-7, 8 x 10-7, 9 x 10-7, 1 x 10-8, 2 x 10-8, 3 x 10-8, 4 x 10-8, 5 x 10-8, 6 x 10-8, 7 x 10-8, 8 x 10-8, 9 x 10-8, 1 x 10-9, 2 x 10-9, 3 x 10-9, 4 x 10-9, 5 x 10-9, 6 x 10-9, 7 x 10-9, 8 x 10-9, 9 x 10-9, 1 x 10-10, 2 x 10-10, 3 x 10-10, 4 x 10-10, 5 x 10-10, 6 x 10-10, 7 x 10-10, 8 x 10-10, 9 x 10-10, 1 x 10-11, 2 x 10-11, 3 x 10-11, 4 x 10-11, or 5 x 10-11 M, including any range in between these values. In some embodiments, the affinity of the IL-18 variant polypeptide for IL-18Rα (e.g., hIL-18Rα) is higher than the affinity of the wild-type human IL-18 set forth in SEQ ID NO: 1 for IL-18Rα (e.g., hIL-18Rα) . In some embodiments, the affinity of the IL-18 variant polypeptide for IL-18Rα (e.g., hIL-18Rα) is comparable to (e.g., about the same as) the affinity of the wild-type human IL-18 set forth in SEQ ID NO: 1 for IL-18Rα (e.g., hIL-18Rα) .
[0131] In some embodiments, the IL-18 variant polypeptide exhibits substantially reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18. In some embodiments, the IL-18 variant polypeptide binds to IL-18BP with a KD of more than 5 x 10-9 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18BP with a KD of more than 5 x 10-8 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18BP with a KD of more than 5 x 10-7 M.In some embodiments, the IL-18 variant polypeptide binds to IL-18BP with a KD of more than 5 x 10-6 M. In some embodiments, the IL-18 variant polypeptide binds to IL-18BP with a KD of more than 5 x 10-5 M. In some embodiments, the IL-18 variant polypeptide exhibits no binding (such as no detectable binding) to IL-18BP (e.g., hIL-18BP) . In some embodiments, an IL-18 variant polypeptide that exhibits no binding (e.g., no detectable binding) to IL-18BP (e.g., hIL-18BP) binds to IL-18BP (e.g., hIL-18BP) with a KD greater than 10-3 M.
[0132] The affinities of the IL-18 described herein for IL-18Rα and / or IL-18BP can be determined experimentally by methods known in the art. Such methods include, but are not limited to, e.g., Western blots, enzyme-linked immunosorbent assay (ELISA) , radioimmunoassay (RIA) , electrochemiluminescence (ECL) assay, immunoradiometric (IRMA) assay, enzyme immunoassay (EIA) , surface plasmon resonance (SPR) , peptide scans, and fluorescence activated cell sorting (FACS) -based kinetic competition screening.
[0133] In some embodiments, the IL-18 variant polypeptide comprises a mutation at residue G3, wherein the mutation is selected from the group consisting of G3P, G3D, G3E, G3N, and G3S. As used herein, “G3X” means that G, i.e., the wild type amino acid at position 3 of SEQ ID NO: 1, has been replaced with amino acid X. In some embodiments, the mutation is G3P, i.e., the wild type G at position 3 of SEQ ID NO: 1 has been replaced with amino acid P.
[0134] In some embodiments, the variant polypeptide comprises (such as further comprises) a mutation at residue E6, wherein the mutation is selected from the group consisting of E6R, E6K, E6G, E6T, E6A, E6S, E6E, E6L, E6M, and E6N. In some embodiments, the mutation is selected from the group consisting of E6R, E6K, E6G, E6T, E6A, and E6S. In some embodiments, the mutation is selected from the group consisting of E6R and E6K.
[0135] In some embodiments, the variant polypeptide comprises (such as further comprises) a mutation at residue D54, wherein the mutation is selected from the group consisting of D54W, D54H, D54S, D54Q, D54L, D54Y, D54P, D54A, D54F, D54G, and D54T. In some embodiments, the mutation is selected from the group consisting of D54W, D54H, D54S, D54Q, D54L, and D54Y.
[0136] In some embodiments, the variant polypeptide comprises (such as further comprises) a mutation at residue N91, wherein the mutation is selected from the group consisting of N91V, N91A, N91G, N91S, N91I, N91P, N91R, N91T, N91C, N91K, and N91W. In some embodiments, the mutation is selected from the group consisting of N91V, N91A, N91G, and N91S.
[0137] In some embodiments, the variant polypeptide further comprises a mutation at residue R104, wherein the mutation is selected from the group consisting of R104S, R104Y, R104T, R104L, R104V, R104A, R104F, R104H, R104I, and R104N. In some embodiments, the mutation is selected from the group consisting of R104S, R104Y, and R104T. In some embodiments, the IL-18 variant polypeptide comprises no mutation at residue R104.
[0138] In some embodiments, wherein the IL-18 variant polypeptide comprises (such as further comprises) a mutation at residue Q56, the mutation is selected from the group consisting of Q56T, Q56G, Q56R, Q56S, Q56D, Q56P, Q56I, Q56Y, Q56H, Q56L, Q56E, Q56F, Q56N, and Q56V. In some embodiments, the mutation is selected from the group consisting of Q56T, Q56G, Q56R, Q56S, Q56D, Q56P, Q56I, and Q56Y.
[0139] In some embodiments, wherein the IL-18 variant polypeptide comprises (such as further comprises) a mutation at residue P57, the mutation is selected from the group consisting of P57A, P57G, P57R, P57W, P57S, P57T, P57V, P57Q, P57H, P57K, P57N, P57Y, and P57D. In some embodiments, the mutation is selected from the group consisting of P57A, P57G, P57R, P57W, P57S, P57T, and P57V.
[0140] In some embodiments, the IL-18 variant polypeptide comprises mutations at one or more of G3, E6, D54, and N91. In some embodiments, the IL-18 variant polypeptide comprises mutations at two or more of G3, E6, D54, and N91. In some embodiments, the IL-18 variant polypeptide comprises mutations at three or more of G3, E6, D54, and N91. In some embodiments, the IL-18 variant polypeptide comprises mutations at G3, E6, D54, and N91. In some embodiments, wherein the IL-18 variant polypeptide comprises a G3P mutation. Additionally or alternatively, in some embodiments, the IL-18 variant polypeptide comprises a E6R or E6K mutation. Additionally or alternatively, in some embodiments, the IL-18 variant polypeptide comprises a D54W, D54H, D54S, or D54Q mutation. Additionally or alternatively, in some embodiments, the IL-18 variant polypeptide comprises a N91V, N91A, N91G, or N91S mutation. In some embodiments, the IL-18 variant polypeptide does not comprise mutations at positions other than G3, E6, D54, and / or N91. In some embodiments, the IL-18 variant further comprises mutations at positions other than at G3, E6, D54, and / or N91. In some embodiments, the IL-18 variant polypeptide comprises one or more mutations (such as any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mutations) , wherein at least one, at least 2, at least 3, or at least 4 mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the IL-18 variant polypeptide further comprises mutations at Q56 and / or P57. In some embodiments, the IL-18 variant polypeptide does not comprise mutations at positions other than G3, E6, D54, N91, Q56 and / or P57. In some embodiments, the IL-18 variant polypeptide further comprises mutations at positions other than at G3, E6, D54, N91, Q56 and / or P57. In some embodiments, the IL-18 variant polypeptide comprises one or more mutations (such as any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mutations) , wherein at least one, at least 2, at least 3, at least 4 mutations, at least 5 mutations, or at least 6 mutations are selected from the group consisting of: G3, E6, D54, N91, Q56, and P57.
[0141] In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%identity with the amino acid sequence of any one of SEQ ID NOs: 2-299 and 307-318. In some embodiments, the IL-18 variant polypeptide comprises an amino acid sequence set forth in any one of SEQ ID NOs: 2-299 and 307-318. The amino acid sequences of SEQ ID NOs: 2-299 and 307-318 are provided in the Sequence Summary Table below the Examples.
[0142] Fusion Polypeptides
[0143] In some embodiments, an activatable IL-18 polypeptide of the present disclosure comprises a fusion polypeptide comprising wild-type IL-18 or an IL-18 variant polypeptide described herein. In some embodiments, the fusion polypeptide comprises (1) a wild-type IL-18 or an IL-18 variant polypeptide and (2) a dimerization domain. In some embodiments, the fusion polypeptide comprises (1) two or more wild-type IL-18s, two or more IL-18 variant polypeptides, or two or more of a wild-type IL-18 and an IL-18 variant polypeptide in any combination, and (2) a dimerization domain. In some embodiments, the fusion polypeptide comprises a mask that prevents (such as inhibits) the wild-type IL-18 and / or the IL-18 variant polypeptide from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) . In some embodiments, one or more of the wild-type IL-18s and / or the IL-18 variant polypeptides in the fusion polypeptide is masked to prevent (such as inhibits) the wild-type IL-18s and / or the IL-18 variant polypeptides from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) . In some embodiments, each of the wild-type IL-18s and / or the IL-18 variant polypeptides in the fusion polypeptide is masked to prevent (such as inhibit) the wild-type IL-18s and / or the IL-18 variant polypeptides from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling. In some embodiments, the dimerization domain is or comprises a leucine zipper (LZ) element. Leucine zippers have been identified, generally, as stretches of about 35 amino acids containing 4-5 leucine residues separated from each other by six amino acids (Maniatis and Abel
[0144] Nature 341 : 24-25) . Exemplary leucine zippers occur in a variety of eukaryotic DNA binding proteins, such as GCN4, C / EBP, c-Fos, c-Jun, c-Myc and c-Max. In some embodiments, the dimerization domain is or comprises a helix-loop-helix domain (Murre, C. et al. (1989) Cell 58: 537-544) . Dimerization domains may also be selected from other proteins, such as the retinoic acid receptor, the thyroid hormone receptor or other nuclear hormone receptors (Kurokawa et al. (1993) Genes Dev. 7: 1423-1435) or from the yeast transcription factors GAL4 and HAP1 (Marmonstein et al. (1992) Nature 356: 408-414; Zhang et al. (1993) Proc. Natl. Acad. Sci. USA 90: 2851 -2855) . Dimerization domains are further described in U.S. Patent No. 5,624,818 by Eisenman. In some embodiments, the dimerization domain is an antibody Fc domain.
[0145] In some embodiments, the fusion polypeptide comprises a wild-type IL-18 (e.g., the wild-type IL-18 who amino acid sequence is set forth in SEQ ID NO: 1) and an antibody Fc domain. In some embodiments, the fusion polypeptide comprises an IL-18 variant polypeptide (e.g., an IL-18 variant polypeptide described herein) and an antibody Fc domain. In some embodiments the C-terminus of the wild-type IL-18 or the C-terminus of the IL-18 variant polypeptide is fused to the N-terminus of the antibody Fc domain. In some embodiments the C-terminus of the antibody Fc domain is fused to the N-terminus of the wild-type IL-18 or the N-terminus of the IL-18 variant polypeptide. In some embodiments, the Fc domain is a human Fc domain or a variant thereof comprising one or more amino acid substitutions. In some embodiments, the Fc domain is a human IgG Fc domain or variant thereof, e.g., a human IgG1, IgG2, or IgG4 Fc domain or a variant of any of the preceding. In some embodiments, the fusion polypeptide comprises, N-terminus-to-C- terminus, an IL-18 variant polypeptide described herein and a human IgG1 Fc variant that comprises an N297A mutation, wherein the amino acid numbering is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991. In some embodiments, the fusion polypeptide comprises, N-terminus-to-C-terminus, a wild-type IL-18 and a human IgG1 Fc variant that comprises an N297A mutation. In some embodiments, the fusion polypeptide comprises the amino acid sequence of any one of SEQ ID NOs: 319-332 and 378-389.
[0146] Nucleic Acids, Vectors, Host Cell, and Methods of Producing Activatable IL-18 Polypeptides
[0147] Nucleic acid molecules encoding the activatable IL-18 polypeptides described herein are also contemplated. In some embodiments, provided is a nucleic acid encoding an activatable IL-18 polypeptide described herein. Also provided are vectors in which a nucleic acid described herein is inserted.
[0148] In brief summary, the expression of an activatable IL-18 polypeptides described herein by a natural or synthetic nucleic acid encoding the activatable IL-18 polypeptide can be achieved by inserting the nucleic acid into an appropriate expression vector, such that the nucleic acid is operably linked to 5’a nd 3’ regulatory elements, including for example a promoter (e.g., a constitutive, regulatable, tissue-specific promoter) and a 3’ untranslated region (UTR) . The vectors can be suitable for replication and integration in eukaryotic host cells. Typical cloning and expression vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
[0149] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
[0150] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York) , and in other virology and molecular biology manuals. Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (see, e.g., WO 01 / 96584; WO 01 / 29058; and U.S. Pat. No. 6,326,193) .
[0151] A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In some embodiments, lentivirus vectors are used. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells. Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
[0152] Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 base pairs (bp) upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
[0153] One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. Another example of a suitable promoter is Elongation Growth Factor-1α (EF-1α) . However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV) , human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
[0154] In some embodiments, the expression of the nucleic acid (s) encoding the activatable IL-18 polypeptides is inducible. In some embodiments, the nucleic acid (s) encoding the activatable IL-18 polypeptide is operably linked to an inducible promoter, including any inducible promoter known in the art. In some embodiments, the nucleic acid (s) encoding an activatable IL-18 polypeptide described herein has been engineered to encode an epitope tag, e.g., to facilitate purification or detection of the polypeptide. Exemplary epitope tags include, but are not limited to, e.g., 6x His (also known as His-tag or hexahistidine tag) , FLAG, HA, Myc, V5, GFP (green fluorescent protein, e.g., enhanced green fluorescent protein or EGFP) , SUMO (Small ubiquitin-like modifier) , GST (glutathione-S-transferase) , β-GAL (β-galactosidase) , Luciferase, MBP (Maltose Binding Protein) , RFP (Red Fluorescence Protein) , and VSV-G (Vesicular Stomatitis Virus Glycoprotein) .
[0155] An activatable IL-18 polypeptide of the present disclosure may be produced by any means known in the art. Exemplary techniques for polypeptide production are described below; however, these exemplary techniques are provided for illustrative purposes only and are not intended to be limiting.
[0156] An activatable IL-18 polypeptide described herein can be produced using recombinant methods. For recombinant production of an activatable IL-18 polypeptide, a nucleic acid encoding the activatable IL-18 polypeptide is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression. DNA encoding the activatable IL-18 polypeptide may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the activatable IL-18 polypeptide) . Many vectors are available. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
[0157] Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells, e.g., to allow the vector to replicate independently of the host chromosomal DNA. This sequence can include origins of replication or autonomously replicating sequences. Such sequences are well known for a variety of bacteria, yeast, and viruses. Generally, the origin of replication component is not needed for mammalian expression vectors (the SV40 origin may be used because it contains the early promoter) .
[0158] Expression and cloning vectors can contain a selection gene or selectable marker. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media. Examples of dominant selection use the drugs neomycin, mycophenolic acid and hygromycin. Another example of suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up an activatable IL-18 polypeptide-encoding nucleic acid, such as DHFR, glutamine synthetase (GS) , thymidine kinase, metallothionein-I and -II, preferably primate metallothionein genes, adenosine deaminase, ornithine decarboxylase, and the like. For example, a Chinese hamster ovary (CHO) cell line deficient in endogenous DHFR activity transformed with the DHFR gene is identified by culturing the transformants in a culture medium containing methotrexate (Mtx) , a competitive antagonist of DHFR.
[0159] Alternatively, host cells (particularly wild-type hosts that contain endogenous DHFR) transformed or co-transformed with DNA sequences encoding an activatable IL-18 polypeptide of interest, wild-type DHFR gene, and another selectable marker such as aminoglycoside 3'-phosphotransferase (APH) can be selected by cell growth in medium containing a selection agent for the selectable marker such as an aminoglycosidic antibiotic, e.g., kanamycin, neomycin, or G418.
[0160] Expression and cloning vectors generally contain a promoter that is recognized by the host organism and is operably linked to nucleic acid encoding an activatable IL-18 polypeptide. Promoters suitable for use with prokaryotic hosts include the phoA promoter, β-lactamase and lactose promoter systems, alkaline phosphatase promoter, a tryptophan (trp) promoter system, and hybrid promoters such as the tac promoter. However, other known bacterial promoters are suitable. Promoter sequences are known for eukaryotes. Yeast promoters are well known in the art and can include inducible promoters / enhancers regulated by growth conditions. Virtually all eukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Examples include without limitation the promoters for 3-phosphoglycerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase. The transcription of an activatable IL-18 polypeptide from vectors in mammalian host cells can be controlled, for example, by promoters obtained from the genomes of viruses. The early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication. The immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII restriction fragment. Alternatively, the Rous Sarcoma Virus long terminal repeat can be used as the promoter.
[0161] Transcription of a DNA encoding an activatable IL-18 polypeptide described herein by higher eukaryotes is often increased by inserting an enhancer sequence into the vector. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, α-fetoprotein, and insulin) . Typically, however, one will use an enhancer from a eukaryotic cell virus.
[0162] Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal, human, or nucleated cells from other multicellular organisms) will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA.
[0163] Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells described above. Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, etc. In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for IL-18 variant polypeptide-or fusion polypeptide-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms. Certain fungi and yeast strains may be selected in which glycosylation pathways have been “humanized, ” resulting in the production of an activatable IL-18 polypeptide with a partially or fully human glycosylation pattern. See, e.g., Li et al., Nat. Biotech. 24: 210-215 (2006) .
[0164] Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, duckweed (Leninaceae) , alfalfa (M. truncatula) , and tobacco can also be utilized as hosts.
[0165] Suitable host cells for the expression of a glycosylated activatable IL-18 polypeptide are also derived from multicellular organisms (invertebrates and vertebrates) . Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar) , Aedes aegypti (mosquito) , Aedes albopictus (mosquito) , Drosophila melanogaster (fruitfly) , and Bombyx mori have been identified.
[0166] Vertebrate cells may be used as hosts, and propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651) ; human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36: 59 (1977) ) ; baby hamster kidney cells (BHK, ATCC CCL 10) ; mouse sertoli cells (TM4, Mather, Biol. Reprod. 23: 243-251 (1980) ) ; monkey kidney cells (CV1 ATCC CCL 70) ; African green monkey kidney cells (VERO-76, ATCC CRL-1587) ; human cervical carcinoma cells (HELA, ATCC CCL 2) ; canine kidney cells (MDCK, ATCC CCL 34) ; buffalo rat liver cells (BRL 3A, ATCC CRL 1442) ; human lung cells (W138, ATCC CCL 75) ; human liver cells (Hep G2, HB 8065) ; mouse mammary tumor (MMT 060562, ATCC CCL51) ; TRI cells (Mather et al., Annals N. Y. Acad. Sci. 383: 44-68 (1982) ) ; MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2) . Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR-CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216 (1980) ) ; and myeloma cell lines such as NS0 and Sp2 / 0. For a review of certain mammalian host cell lines suitable for production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J., 2003) , pp. 255-268.
[0167] The host cells of the present disclosure may be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma) , Minimal Essential Medium ( (MEM) , (Sigma) , RPMI-1640 (Sigma) , and Dulbecco's Modified Eagle's Medium ( (DMEM) , Sigma) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz. 58: 44 (1979) , Barnes et al., Anal. Biochem. 102: 255 (1980) , U.S. Pat. Nos. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO 90 / 03430; WO 87 / 00195; or U.S. Pat. Re. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and / or other growth factors (such as insulin, transferrin, or epidermal growth factor) , salts (such as sodium chloride, calcium, magnesium, and phosphate) , buffers (such as HEPES) , nucleotides (such as adenosine and thymidine) , antibiotics (such as GENTAMYCINTM drug) , trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range) , and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to one of skill in the art.
[0168] When using recombinant techniques, the activatable IL-18 polypeptide can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the polypeptide is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio / Technology 10: 163-167 (1992) describe a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli.
[0169] The polypeptide composition prepared from the cells can be purified using, for example, hydroxyapatite chromatography, hydrophobic interaction chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being among one of the typically preferred purification steps. In some embodiments, an activatable IL-18 polypeptide described herein comprises an epitope tag (e.g., a tag attached to the activatable IL-18 polypeptide via a cleavable linker) to facilitate purification. Exemplary epitope tags include, but are not limited to, e.g., 6x His (also known as His-tag or hexahistidine tag) , FLAG, HA, Myc, V5, GFP (green fluorescent protein, e.g., enhanced green fluorescent protein or EGFP) , SUMO (Small ubiquitin-like modifier) , GST (glutathione-S-transferase) , β-GAL (β-galactosidase) , Luciferase, MBP (Maltose Binding Protein) , RFP (Red Fluorescence Protein) , and VSV-G (Vesicular Stomatitis Virus Glycoprotein.
[0170] Methods of Treating Disease, Activating hIL-18 receptor-mediated signaling, and Stimulating Antigen-Experienced T-cells or NK cells
[0171] Also provided here are methods of treating a disease or condition in an individual. The methods comprise administering an activatable IL-18 polypeptide described herein, a nucleic acid described herein, a vector described herein, and / or a pharmaceutical composition described herein to an individual having the disease or condition. In some embodiments, the disease or condition is a proliferative disorder. In some embodiments the proliferative disorder is cancer.
[0172] In some embodiments, provided are methods of activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) in an individual (e.g., a human individual) , which methods comprise administering an activatable IL-18 polypeptide described herein, a nucleic acid described herein, a vector described herein, and / or a pharmaceutical composition described herein to the individual. In some embodiments, provided herein are methods of stimulating antigen-experienced T cells or NK cells in an individual, which methods comprise administering an activatable IL-18 polypeptide described herein, a nucleic acid described herein, a vector described herein, and / or a pharmaceutical composition described herein to the individual. In some embodiments of any of the methods herein, the individual is a mammal (e.g., human, non-human primate, rat, mouse, cow, horse, pig, sheep, goat, dog, cat, etc. ) . In some embodiments, the individual is a human. In some embodiments, the individual is a clinical patient, a clinical trial volunteer, an experimental animal, etc.
[0173] Compositions, Kits and Articles of Manufacture
[0174] Also provided herein are compositions (such as formulations) comprising an activatable IL-18 polypeptide, a nucleic acid, a vector, or a host cell described herein.
[0175] Suitable composition be obtained by mixing the activatable IL-18 polypeptide, the nucleic acid, the vector, or the host cell having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington’s Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980) ) .
[0176] Also provided are kits comprising an activatable IL-18 polypeptide, a nucleic acid, a vector, or a host cell comprising a nucleic acid or vector described herein. The kits may be useful for any of the methods of treatment described herein.
[0177] The kits of the present application are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags) , and the like. Kits may optionally provide additional components such as buffers and interpretative information.
[0178] The present application thus also provides articles of manufacture. The article of manufacture can comprise a container and a label or package insert on or associated with the container. Suitable containers include vials (such as sealed vials) , bottles, jars, flexible packaging, and the like. Generally, the container holds a composition, and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle) .
[0179] Those skilled in the art will recognize that several embodiments are possible within the scope and spirit of this invention. The invention will now be described in greater detail by reference to the following non-limiting examples. The following examples further illustrate the invention but, of course, should not be construed as in any way limiting its scope.
[0180] EXEMPLARY EMBODIMENTS
[0181] 1. An activatable interleukin 18 (IL-18) polypeptide comprising: (a) an IL-18 polypeptide, and (b) a masking moiety, wherein the IL-18 polypeptide is attached to the masking moiety via a cleavable linker, optionally 1) b) is fused to the N-terminus of a) , or 2) b) is fused to the C-terminus of a) .
[0182] 2. The activatable IL-18 polypeptide of embodiment 1, wherein the masking moiety inhibits the IL-18 polypeptide from activating IL-18 receptor mediated signaling when the masking moiety is attached to the IL-18 polypeptide via the cleavable linker.
[0183] 3. The activatable IL-18 polypeptide of embodiment 1 or 2, wherein the masking moiety comprises an IL-18 pro-peptide (i.e., pro-IL-18 pro-peptide) , an extracellular domain of IL-18Rα, an extracellular domain of IL-18Rβ, an IL-18 binding protein, a fragment of any one of the preceding, or a variant of any one of the preceding.
[0184] 4. The activatable IL-18 polypeptide of any one of embodiments 1-3, wherein the masking moiety comprises an IL-18 pro-peptide (i.e., pro-IL-18 pro-peptide) , optionally wherein the IL-18 pro-peptide comprises a pro-peptide of human IL-18 (hIL-18) , optionally wherein the pro-peptide of hIL-18 comprises the amino acid sequence of SEQ ID NO: 333.
[0185] 5. The activatable IL-18 polypeptide of embodiment 4, wherein the masking moiety comprises a truncated pro-peptide of pro-IL-18.
[0186] 6. The activatable IL-18 polypeptide of embodiment 5, wherein the truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336.
[0187] 7. The activatable IL-18 polypeptide of any one of embodiments 1-3, wherein the masking moiety comprises an extracellular domain of IL-18Rα or a fragment thereof, optionally wherein the fragment of the extracellular domain of IL-18Ra comprises a) the first and the second domains of the extracellular domain, or b) the third domain of the extracellular domain.
[0188] 8. The activatable IL-18 polypeptide of embodiment 3 or embodiment 7, wherein the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356.
[0189] 9. The activatable IL-18 polypeptide of any one of embodiments 1-8, wherein the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by one or more proteases, optionally wherein the one or more proteases are one or more tumor microenvironment (TME) proteases.
[0190] 10. The activatable IL-18 polypeptide of embodiment 9, wherein the one or more proteases are one or more tumor microenvironment (TME) proteases, and wherein the one or more TME proteases are selected from the group consisting of: urokinase-type Plasminogen Activator (uPA) , matriptase, legumain, prostate specific antigen, a dipeptidyl peptidase, hepsin, a matrix metalloprotease (MMP) , a disintegrin and metalloproteinase, human leukocyte elastase, Proteinase 3, prourokinase, plasminogen, staphylokinase, a cathepsin, a tissue kallikrein and a Kallikrein-related peptidase.
[0191] 11. The activatable IL-18 polypeptide of embodiment 10, wherein the one or more TME proteases are matrix metalloproteases, and wherein the matrix metalloproteases are selected from the group consisting of: matrix metalloprotease 1, matrix metalloprotease 2, matrix metalloprotease 3, matrix metalloprotease 8, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 12, and matrix metalloprotease 14.
[0192] 12. The activatable IL-18 polypeptide of any one of embodiments 1-11, wherein the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by one or more of matrix metalloprotease 2, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 14, urokinase-type Plasminogen Activator, matriptase and legumain.
[0193] 13. The activatable IL-18 polypeptide of any one of embodiments 1-12, wherein the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by at least two, three, or four proteases, optionally wherein the one or more amino acid sequences are recognized and cleaved by a) both legumain and MMP9 / MMP2 / MMP14, b) both uPA and MMP9 / MMP2 / MMP14, c) all of uPA, legumain, MMP2, MMP14, and MMP9.
[0194] 14. The activatable IL-18 polypeptide of any one of embodiments 1-13, wherein the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377.
[0195] 15. The activatable IL-18 polypeptide of any one of embodiments 1-14, wherein the cleavage linker further comprises a spacer sequence, optionally wherein the cleavage linker comprises two spacer sequences flanking both N-and C-terminus of the amino acid sequence that is recognized and cleaved by one or more proteases.
[0196] 16. The activatable IL-18 polypeptide of any one of embodiments 1-15, wherein the cleavage linker comprises two or more set of amino acid sequences that are recognized and cleaved by one or more proteases.
[0197] 17. The activatable IL-18 polypeptide of embodiment 16, wherein at least one of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is franked by two spacer sequences in the cleavage linker, wherein each of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker.
[0198] 18. The activatable IL-18 polypeptide of any one of embodiments 1-17, wherein the spacer sequence comprises a GS linker, optionally the GS linker has a length of no more than about 10, 9, 8, 7, 6, or 5 amino acids.
[0199] 19. The activatable IL-18 polypeptide of any one of embodiments 1-18, wherein the cleavage linker consists of no more than about 50, 40, 35, or 30 amino acids.
[0200] 20. The activatable IL-18 polypeptide of any one of embodiments 1-19, wherein the cleavage linker consists of no less than about 10, 15, 20, or 25 amino acids.
[0201] 21. The activatable IL-18 polypeptide of, wherein the cleavage linker consists of about 25 to about 30 amino acids, and wherein the masking moiety comprises an extracellular domain of IL-18Rα, further optionally wherein the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356.
[0202] 22. The activatable IL-18 polypeptide of any one of embodiments 1-21, wherein the cleavage linker comprises any one of amino acid sequences of SEQ ID NOs: 399-407.
[0203] 23. The activatable IL-18 polypeptide of any one of embodiments 1-22, wherein the IL-18 polypeptide comprises a wild-type IL-18, optionally wherein the wild-type IL-18 comprises a wild-type human IL-18, optionally wherein the wild-type human IL-18 comprises an amino acid sequence of SEQ ID NO: 1.
[0204] 24. The activatable IL-18 polypeptide of any one of embodiments 1-23, wherein the IL-18 polypeptide comprises an IL-18 variant polypeptide.
[0205] 25. The activatable IL-18 polypeptide of embodiment 24, wherein the IL-18 variant polypeptide specifically binds to IL-18 receptor α (IL-18Rα) and exhibits (i) substantially reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18 or (ii) no binding to IL-18BP.
[0206] 26. The activatable IL-18 polypeptide of embodiment 24 or 25, wherein the IL-18 variant polypeptide exhibits an increased binding to IL-18Rα relative to the wild-type IL-18.
[0207] 27. The activatable IL-18 polypeptide of any one of embodiments 24-26, wherein the IL-18 variant polypeptide comprises at least three, four, five, or six mutations at G3, E6, D54, Q56, P57, N91 and R104 of an IL-18 polypeptide, wherein amino acid positions are relative to a wild type (WT) human IL-18 set forth in SEQ ID NO: 1.
[0208] 28. The activatable IL-18 polypeptide of any one of embodiments 24-27, wherein the IL-18 variant polypeptide comprises a cysteine at position 117 and a cysteine at position 76, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1, optionally wherein the IL-18 variant polypeptide does not comprise a cysteine at position 38, and / or the IL-18 variant polypeptide does not comprise a cysteine at position 68.
[0209] 29. The activatable IL-18 polypeptide of any one of embodiments 24-28, wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150.
[0210] 30. The activatable IL-18 polypeptide of any one of embodiments 1-29, wherein the IL-18 polypeptide comprises from N-to C-terminus, a) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336, b) a cleavage linker, and c) an IL-18 variant polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.
[0211] 31. The activatable IL-18 polypeptide of any one of embodiments 1-29, wherein the IL-18 polypeptide comprises from N-to C-terminus, a) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, b) a cleavage linker, and c) an IL-18 variant polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.
[0212] 32. The activatable IL-18 polypeptide of any one of embodiments 1-29, wherein the IL-18 polypeptide comprises from N-to C-terminus, a) an IL-18 variant polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, b) a cleavage linker, and c) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.
[0213] 33. The activatable IL-18 polypeptide of any one of embodiments 1-32, wherein the IL-18 polypeptide comprises an amino acid sequence of any one of SEQ ID NOs: 340-343, and 345-352, or b) an amino acid sequence functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 340-343, and 345-352.
[0214] 34. The activatable IL-18 polypeptide of any one of embodiments 1-33, wherein the IL-18 polypeptide comprises a fusion protein comprising (1) a wild-type IL-18 or an IL-18 variant polypeptide and (2) a half-life extending domain, optionally wherein the half-life extending domain comprises a albumin binding moiety or an antibody Fc domain or variant thereof, optionally wherein the half-life extending domain is a human IgG Fc domain (such as hIgG1 Fc) .
[0215] 35. The activatable IL-18 polypeptide of embodiment 34, wherein the IL-18 variant polypeptide of the fusion protein specifically binds to IL-18 receptor α (IL-18Rα) and exhibits (i) substantially reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18 or (ii) no binding to IL-18BP.
[0216] 36. The activatable IL-18 polypeptide of embodiment 34 or 35, wherein the IL-18 variant polypeptide of the fusion protein exhibits an increased binding to IL-18Rα relative to the wild-type IL-18.
[0217] 37. The activatable IL-18 polypeptide of any one of embodiments 34-36, wherein the human IgG1 Fc domain variant of the fusion protein comprises an N297A mutation (EU numbering) , optionally wherein the human IgG1 Fc domain variant comprises an amino acid sequence of SEQ ID NOs: 371 or 390.
[0218] 38. The activatable IL-18 polypeptide of any one of embodiments 34-37, wherein the C-terminus of the IL-18 variant polypeptide of the fusion protein is fused to the N-terminus of the human IgG Fc domain or variant thereof of the fusion protein.
[0219] 39. The activatable IL-18 polypeptide of any one of embodiments 34-37, wherein the C-terminus of the human IgG Fc domain or variant thereof of the fusion protein is fused to the N-terminus of the IL-18 variant polypeptide of the fusion protein.
[0220] 40. The activatable IL-18 polypeptide of any one of embodiments 34-39, wherein the fusion polypeptide comprises an amino acid sequence of any one of SEQ ID NOs: 319-332, 378-389 and 408-418, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 319-332, 378-389 and 408-418.
[0221] 41. The activatable IL-18 polypeptide of any one of embodiments 1-40, comprising an amino acid sequence of any one of SEQ ID NOs: 340-343, 345-352, 357-362, 364, 366-370, 391-398 and 408-418, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 319-332, 378-389 and 408-418.
[0222] 42. A dimer comprising two activatable IL-18 polypeptides of any one of clams 1-41.
[0223] 43. The dimer of embodiment 42, wherein the dimer is a homodimer.
[0224] 44. The dimer of embodiment 42, wherein the dimer is a heterodimer.
[0225] 45. A nucleic acid encoding the activatable IL-18 polypeptide of any one of embodiments 1-41.
[0226] 46. A vector comprising the nucleic acid of embodiment 45.
[0227] 47. A host cell comprising the nucleic acid of embodiment 45 or the vector of embodiment 46.
[0228] 48. A method of producing an activatable IL-18 polypeptide, comprising: (a) culturing the host cell of embodiment 47 under conditions where the activatable IL-18 polypeptide is expressed, and; (b) recovering the activatable IL-18 polypeptide produced by the host cell.
[0229] 49. The method of embodiment 48, further comprising purifying the activatable IL-18 polypeptide.
[0230] 50. A pharmaceutical composition comprising activatable IL-18 polypeptide of any one of embodiments 1-41, the nucleic acid of embodiment 45, or the vector of embodiment 46.
[0231] 51. A method of treating a disease in an individual, comprising administering to the individual an effective amount of the pharmaceutical composition of embodiment 50.
[0232] 52. The method of embodiment 51, wherein the disease is cancer.
[0233] 53. A method of activating IL-18 receptor mediated signaling in an individual, comprising administering to the individual an effective amount of the pharmaceutical composition of embodiment 50.
[0234] 54. A method of stimulating antigen-experienced immune cells in an individual in need thereof, comprising administering to the individual an effective amount of the pharmaceutical composition of embodiment 50.
[0235] 55. The method of embodiment 54, wherein the stimulation comprises increasing activity and / or number of the antigen-experienced immune cells.
[0236] 56. The method of any one of embodiments 36-40, wherein the individual is human.EXAMPLES
[0237] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention, and are not intended to limit the scope of what the inventors regard as their invention nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g. amounts, temperature, etc. ) but some experimental errors and deviations should be accounted for. The examples below are intended to be purely exemplary of the application and should therefore not be considered to limit the application in any way. The following examples and detailed description are offered by way of illustration and not by way of limitation.
[0238] Example 1: Materials and Methods for Examples 2-4
[0239] Expression and Purification of Recombinant WT hIL-18 and IL-18 Variant Polypeptides
[0240] Wild-type ( “WT” ) hIL-18, IL18 variant polypeptides M12, MM5, M21, M13, M24, WM4, WM5, and WM6, activatable IL-18, activatable IL-18 variant polypeptides (described in the Examples below) , and fusion polypeptides comprising the preceding were expressed in an E. coli system. Briefly, PET30a plasmids comprising codon optimized sequences encoding WT hIL-18, the IL18 variant polypeptides, and the activatable hIL-18 polypeptides were each transfected in E. coli BL21 (DE3) cells. The transfected E. coli cells were expanded in culture medium, and the expressed polypeptide were harvested and purified. IL18 variant polypeptides M12, MM5, M21, M13, M24, WM4, WM5, and WM6 were previously described in PCT / CN2022 / 117332, filed September 6, 2022.
[0241] Recombinant hIL-18 expression in CHO cells and purification
[0242] Fusion polypeptides comprising wild-type ( “WT” ) hIL-18, IL18 variant polypeptides, or activatable IL-18 polypeptides (described in the Examples below) , were expressed in a mammalian cell (293F or CHO) system. Briefly, plasmids comprising signal peptide with codon optimized sequences encoding fusion polypeptides described in these Examples were transfected into CHO cells. The transfected CHO cells were expanded in culture medium and cultured for 4 days. Next, the cell culture medium containing the secreted fusion polypeptides were harvested and purified via Protein A chromatography. Certain eluates were subjected to a further gel filtration or ion exchange step.
[0243] IL-18 activity evaluated by reporter assay
[0244] An NFκB-luc / hIL18RαRβ HEK293 cell line stably expressing hIL-18Rα, hIL-18Rβ and an NFκB luciferase reporter gene was used as the reporter cell to determine the abilities of wild-type IL-18, IL-18 variant polypeptides, activatable IL-18 polypeptides (prior to treatment with a tumor microenvironment protease) , and activatable IL-18 polypeptides (following treatment with a tumor microenvironment protease) in activating hIL-18 receptor mediated signaling.
[0245] Briefly, the reporter cells were first seeded in the wells of a white 96-well white-bottom plate at a density of 3.0 ×104 cells per well. IL-18 was serially diluted in medium in (a) the presence and (b) the absence of 1 μg / mL hIL-18 BP-hFc. Luminescence intensity was measured after 16 hours of incubation at 37℃.
[0246] Human PBMC-based hIFNγ release assays
[0247] PBMC-based assays were performed to test abilities of wild-type IL-18, activatable IL-18 polypeptides (prior to treatment with a tumor microenvironment protease) , and activatable IL-18 polypeptides (following treatment with a tumor microenvironment protease) in activating T / NK cells and inducing hIFNγ release. Briefly, human PBMC cells were seeded in the wells of 96-well plate at a density of 5.0 ×105 cells per well and cultured for 5 hours before treatment. hIL-18 was serially diluted with 1 ng / mL human IL-12 in (a) the presence or (b) the absence of 1 μg / mL hIL-18 BP-hFc, and then supplemented to the wells. Culture medium was collected from each well after 16 hours incubation at 37℃, and hIFNγ concentration was measured via FRET using a kit (62HIFNGPEG, Cisbio) according to manufacturer’s instructions.
[0248] Mouse splenocyte-based mIFNγ release assay
[0249] Mouse splenocyte-based murine IFNγ ( “mIFNγ” ) release assays are performed as follows. Briefly, fresh isolated mouse splenocytes are seeded in the wells of a 96-well plate at a density of 6.5 × 105 cells per well. WT hIL-18 or IL-18 variant polypeptides were serially diluted with 1 ng / mL mouse IL-12 in (a) the presence or (b) the absence of 1 μg / mL mouse IL-18BP-Fc, and then supplemented to the wells. Culture medium is collected from each well after 16 hours incubation at 37℃, and then mIFNγ concentration in the medium is measured via FRET using a kit (62MIFNGPEG, Cisbio) according to manufacturer’s instructions.
[0250] Digestion of Activatable IL-18 Polypeptides
[0251] Activatable IL-18 polypeptides described in the Examples 2 and 3 were subject to cleavage by either Caspase-1 or tumor microenvironment ( “TME” ) proteases (i.e., matrix metalloproteases MMP2, MMP9, MMP10, MMP14) to assess cleavage efficiency and the activity of the resulting “cleaved” forms of the activatable IL-18 polypeptides. For Caspase-1 cleavage reactions, activatable IL-18 polypeptides were incubated with pre-activated Caspase-1 (Abcam Catalog #ab39901) at a ratio of 100-500 μg protein: 1 Unit Caspase for 1-16 hours at RT. For MMP2, MMP9, MMP10, and MMP14 cleavage reactions, activatable IL-18 polypeptides were incubated with pre-activated MMP2, MMP9, MMP10, or MMP14 at weight ratios between 100: 1 to 500: 1 (μg polypeptide: μg protease) for 1-16 hours at RT or at 37℃. The MMP2, MMP9, MMP10, and MMP14 cleavage reactions were stopped by putting the samples on ice or by storing the samples at -80 ℃.
[0252] Example 2: Activatable IL-18 Polypeptides Comprising a Masking Moiety Derived from the Native Pro-Peptide of proIL-18
[0253] IL-18 precursor (or “proIL18” ) remains inactive in the cytosol until a signal, e.g., inflammasome activation, induces maturation. The inflammasome is a multi-protein assembly composed of three proteins, a nucleotide-binding oligomerization domain (NOD) -like receptor, apoptosis-associated speck-like protein containing a CARD (ASC) and caspase-1, and is formed upon detection of pathogens or other harmful substances, such as reactive oxygen species and urate crystals, in the cytosol. The inflammasome then autocatalyzes activation of the cysteine protease caspase-1, which removes propeptide from the IL-18 precursor to produce mature IL-18. The native pro-peptide of human proIL-18 (i.e., MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESD (SEQ ID NO: 333) ) was used as a starting point for developing masking moieties that block the binding of WT hIL-18 (i.e., mature IL-18) , IL-18 variant polypeptides, or fusion polypeptides comprising the preceding to IL-18Rα and prevent the activation of hIL-18 receptor mediated signaling. The native Caspase-1 recognition sequence of SEQ ID NO: 333, (i.e., AEDDENLESD (SEQ ID NO: 334) , which corresponds to amino acids 27-36 of SEQ ID NO: 333) was replaced with the protease recognition sequence of MMP-2, MMP-9, MMP-10, MMP-14, legumain, or another tumor microenvironment ( “TME” ) specific protease, or with a combination of one or more of the preceding the recognition sequences.
[0254] 2.1 Proof-of-Concept: Native pro-peptide of human proIL-18 blocks mature WT human IL-18 from binding IL-18Ra and activating IL-18 receptor-mediated signaling
[0255] Full length human proIL-18 (SEQ ID NO: 335) was produced in E coli as discussed above for recombinant WT IL-18 (i.e., “mature” WT IL-18) . The ability of proIL-18 to bind hIL-18Rα was assessed via biolayer interferometry (BLI) , and the ability of proIL-18 to activate IL-18 receptor mediated signaling was assessed using the reporter assay in Example 1. Signaling assay experiments were performed with Caspase-1-treated proIL-18. (Caspase-1-treated proIL-18 is also referred to herein as “cleaved proIL-18. ” Cleaved proIL-18 has the same amino acid sequence as mature WT IL-18 (i.e., SEQ ID NO: 1) ) . As shown in FIG 1A, proIL-18 did not exhibit detectable binding to hIL-18Rα under experimental conditions, i.e., where proIL-18 is present at a concentration of 32 nM. Nor did proIL-18 activate hIL-18 receptor mediated signaling. See FIG 1B. By contrast cleaved proIL-18 activates hIL-18 receptor mediated signaling to the same degree as recombinant WT IL-18. See FIG 1B. The signaling activity of cleaved proIL-18 is inhibited in the presence of 1 μg / ml human IL-18 binding protein ( “BP” ) . See FIG 1B.
[0256] 2.2 Design, Production, and Characterization of Exemplary Cleavable Linkers
[0257] Activatable IL-18 polypeptides that each comprise, from N-terminus to C-terminus, amino acids 1-26 of the native pro-peptide of proIL-18 (i.e., MAAEPVEDNCINFVAMKFIDNTLYFI, SEQ ID NO: 336) , an amino acid linker sequence comprising the protease recognition site of Caspase-1 or a TME protease, and WT hIL-18 were designed. See Table 1.
[0258] Table 1. Masked WT hIL-18 polypeptides
[0259] ProIL18, ProIL18-MMP9L, ProIL18-MMP10L, ProIL18-MMP2L, and ProIL18-Legu L were expressed and purified. ProIL18-MMP2 / MMP14L could not be purified well. ProIL18, ProIL18-MMP9L, ProIL18-MMP10L, ProIL18-Legu L expressed well in E. coli and were purified via SEC to >95%purity, as determined via SDS PAGE and SEC (data not shown) .
[0260] The potencies of ProIL18-MMP9L, ProIL18-MMP10L, and ProIL18-Legu L for activating hIL-18 receptor mediated signaling were assessed using the hIL-18 reporter cell assay described in Example 1. As shown in FIGs 2A-2C, the potencies of ProIL18-MMP9L, ProIL18-MMP10L, and ProIL18-Legu L were found to be approximately ~1000-fold lower than WT hIL-18 (i.e., SEQ ID NO: 1) , with decreased Cmax even up to 100 nM.
[0261] The potencies of ProIL18-MMP9L and ProIL18-Legu L for activating hIL-18 receptor mediated signaling were partially restored following treatment with MMP9 and legumain, respectively. See FIGs 2A and 2C. The potency of “cleaved” ProIL18-MMP9L (i.e., following MMP9 treatment) was approximately 16-fold lower (EC50: 2.46 nM) than that of recombinant WT hIL-18 (EC50: 0.16 nM) . See FIG 2A.
[0262] Example 3: Design and Characterization of Exemplary IL-18 Variant Polypeptides Comprising a Masking Moiety Derived from the proIL-18 Pro-Peptide and an MMP9-Cleavable Linker
[0263] A construct comprising the masking moiety of SEQ ID NO: 344, which comprises amino acids 1-26 of the native pro-peptide of proIL-18 (i.e., MAAEPVEDNCINFVAMKFIDNTLYFI, SEQ ID NO: 336) and the MMP9-cleavable linker sequence of SGGPGPAGMKGLPG (SEQ ID NO: 337) , was fused to N-termini of IL-18 variant polypeptides M12 and MM5 to generate ProM12 (SEQ ID NO: 345) and ProMM5 (SEQ ID NO: 346) .
[0264] ProM12
[0265] ProMM5
[0266] FTVQNED
[0267] ProM12 and ProMM5 were then expressed in E coli, harvested, and purified to >95%purity as determined by SDS PAGE and SEC. Next, ProM12 and ProMM5 were subject to MMP9 treatment (as described in Example 1) . The efficiency of cleavage of ProM12 and ProMM5 by MMP9 was assessed via HPLC-SEC. Briefly, as shown in FIG 3A, the ProM12 had a shorter retention time than M12, which does not comprise a masking moiety. ProM12 that had been treated with MMP9 (i.e., “ProM12 Cut” ) had a retention time that fell between those of ProM12 and M12. Similar results were observed with ProMM5, MM5, and ProMM5 that had been treated with MMP9 (i.e., “ProMM5 Cut” ) . See FIG 3B. The results in FIGs 3A and 3B indicate complete cleavage of ProM12 and ProMM5 by MMP9 (i.e., removal of the masking moiety) . Without being bound by theory, the differences in the molecular weights between, e.g., M12 and “ProM12 Cut, ” and, e.g., MM 5 and “ProMM5 Cut, ” may due to the amino acid residues in the MMP9 linker that remain attached to the N-terminus of M12 or MM5 following MMP9 treatment.
[0268] The potency of activatable IL-18 variant polypeptides for activating hIL-18 receptor mediated signaling were assessed using the hIL-18 reporter cell assay described in Example 1. The following sets polypeptides were tested: (1) ProM12 (SEQ ID NO: 345) , M12, and ProM12 Cut (i.e., MMP9-treated ProM12) ; (2) ProMM5 (SEQ ID NO: 346) , MM5, and ProMM5 Cut (i.e., MMP9-treated ProMM5) ; (3) ProM21 (SEQ ID NO: 347) , M21, and ProM21 Cut (i.e., MMP9-treated ProM21) ; (4) ProM13 (SEQ ID NO: 348) , M13, and ProM13 Cut (i.e., MMP9-treated ProM13) ; (5) ProM24 (SEQ ID NO: 349) , M24, and ProM24 Cut (i.e., MMP9-treated ProM24) ; (6) ProWM4 (SEQ ID NO: 350) , WM4, and ProWM4 Cut (i.e., MMP9-treated WM4) ; (7) ProWM5 (SEQ ID NO: 351) , WM5, and ProWM5 Cut (i.e., MMP9-treated WM5) ; and (8) ProWM6 (SEQ ID NO: 352) , WM6, and ProWM6 Cut (i.e., MMP9-treated WM6) . As shown in FIGs 3C-3J, all activatable IL-18 polypeptides tested had greatly decreased potency compared to the corresponding “unmasked” IL-18 variant polypeptides, with decreased Cmax up to 100 nM. Among the activatable IL-18 polypeptides shown in FIGs 3C-3J, only minimal hIL-18 receptor mediated signaling was observed for ProWM4, ProWM5 and ProWM6 at 100 nM. See FIGs 3H-3J. ProM12 Cut, ProMM5 Cut, ProM21 Cut, ProM13 Cut, ProM24 Cut, ProWM4 Cut, ProWM5 Cut, and ProWM6 Cut exhibited restored hIL-18 receptor mediated signaling. ProM12 Cut, ProM21 Cut, and ProM13 Cut showed nearly fully recovered signaling. See FIGs 3C, 3E, and 3F and Table 2. ProMM5 Cut, ProM24 Cut, ProWM4 Cut, ProWM5 Cut and ProWM6 Cut demonstrated only partially restored hIL-18 receptor mediated signaling. See FIGs 3D, 3G, 3H, 3I, and 3J and Table 2.
[0269] Table 2. Masking Efficiency of MMP9 Masking Moiety for ProM12, ProMM5, ProM21, ProM13, ProM24, ProWM4, ProWM5, and ProWM6 Before and After MMP9 Treatment
[0270] The effect of BP on hIL-18 receptor mediated signaling by ProM12 Cut and ProMM5 Cut was also assessed. As shown in FIGs 3C and 3D, ProM12 Cut and ProMM5 Cut retained BP-resistance, exhibiting similar signaling activity in the presence and absence of 1μg / mL human IL-18 binding protein ( “BP” ) .
[0271] To confirm that the MMP9 recognition linker-fused masking moiety MAAEPVEDNCINFVAMKFIDNTLYFISGGPGPAGMKGLPG (SEQ ID NO: 344) is specifically cleaved by MMP9, but not by Caspase-1, ProM12 was subject to treatment with either MMP9 or Caspase-1 in vitro, and the MMP9-treated or Caspase-1 treated ProM12 was evaluated in the hIL-18 reporter cell assay described in Example 1. As shown in FIG 3K, ProM12 Cut following MMP9 treatment showed restored signaling activity, whereas ProM12 Cut following Caspase-1 treatment exhibited signaling activity comparable to that of untreated ProM12. Such results indicated that the MMP9 recognition linker fused masking moiety (SEQ ID NO: 344) is not susceptible to Caspase-1 cleavage anymore.
[0272] Next, PBMC-based assays were performed to test abilities of ProM12 and ProMM5 (i.e., before and after treatment with MMP9) in inducing hIFNγ release. FIGs 4A and 4B show that WT hIL-18 was able to induce human IFNγ release in presence of IL-12 with EC50 of ~0.1 nM, whereas neither ProM12 nor ProMM5 were able to induce human IFNγ release, even up to 10 nM. Following treatment with MMP9, both ProM12 Cut and ProMM5 Cut exhibited hIFNγ release activity. See FIGs 4A and 4B. ProM12 Cut showed similar activity to WT hIL-18 or M12 and unmasked ProMM5 (ProMM5 Cut) exhibited ~ 7-fold lower activity compared to WT hIL-18. See Table 3 below.
[0273] Table 3. EC50s of Masked and Unmasked IL-18 Variant Polypeptides in PBMC Assay
[0274] Example 4: Activatable IL-18 Polypeptides Comprising Masking Moieties Derived from IL-18Rα, IL-18Rα subdomains, IL-18Rβ, IL-18BP, and IL-18 BP variants
[0275] 4.1 Design and Characterization of Activatable IL-18 Polypeptides Comprising Masking Moieties Derived from IL-18Rα, IL-18Rα subdomains, IL-18Rβ, IL-18BP, and IL-18 BP variants
[0276] Additional masking moieties derived from IL-18Rα, IL-18Rα subdomains, IL-18Rβ, IL-18BP, and IL-18 BP variants were designed. See below:
[0277] IL-18Ra (also referred to herein as “18Ra” ) –extracellular domain of IL-18Ra (AA 20-318)
[0278] IL-18Ra D12 (also referred to herein as “D12” ) –first two domains of IL-18Ra (AA 20-208)
[0279] IL-18Ra D3 (also referred to herein as “D3” ) –third domain of IL-18Ra (AA 210-318)
[0280] IL-18BPm (also referred to herein as “BPm” ) –a modified form of IL-18 BP that exhibits the ability to bind and inhibit the activity of IL-18 BP-resistant IL18 variant polypeptides
[0281] The masking moieties shown above were each linked to M12-DB6-Fc_N297A (SEQ ID NO: 323) via a linker sequence comprising an MMP9 recognition site (i.e., SGGPGPAGMKGLPGS, SEQ ID NO: 337) to produce activatable M12-DB6-Fc_N297A polypeptides whose sequences are shown below:
[0282] Ra-M12-DB6-Fc_N297A
[0283] The IL-18Ra sequence is underlined, cleavable linker is in italic text, the M12-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text.
[0284] D12-M12-DB6-Fc_N297A
[0285] The IL-18Ra D12 sequence is underlined, cleavable linker is in italic text, the M12-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text.
[0286] D3-M12-DB6-Fc_N297A
[0287] The IL-18Ra D3 sequence is underlined, cleavable linker is in italic text, the M12-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text.
[0288] BPm-M12-DB6-Fc_N297A
[0289] The IL-18BPm sequence is underlined, cleavable linker is in italic text, the M12-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text.
[0290] M12-DB6-D3-Fc_N297A
[0291] The IL-18Ra D3 sequence is underlined, cleavable linker is in italic text, the M12-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text.
[0292] Fc_N29A-D3-M12-DB6
[0293] The IL-18Ra D3 sequence is underlined, cleavable linker is in italic text, the M12-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text. An additional spacer sequence (GGGGSGGGGSGGGGS, SEQ ID NO: 363) is indicated in
[0294] Fc_N297A-M12-DB6-D3
[0295] The IL-18Ra D3 sequence is underlined, cleavable linker is in italic text, the M12-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text. An additional linker sequence (GGGGSGGGGSGSGGG, SEQ ID NO: 365) is indicated in
[0296] Ra-M12-DB6-Fc_N297A, D12-M12-DB6-Fc_N297A, D3-M12-DB6-Fc_N297A, and BPm-M12-DB6-Fc_N297A were expressed in CHO cells and purified via Protein A chromatography. These activatable IL-18 polypeptides showed 74%-96%purity after one step Protein A purification, as determined via SEC-HPLC, and between ~80-95%purity, as determined via SDS-PAGE (data not shown) .
[0297] The potencies of Ra-M12-DB6-Fc_N297A, D12-M12-DB6-Fc_N297A, and BPm-M12-DB6-Fc_N297A for activating hIL-18 receptor mediated signaling, before and after MMP9 treatment, were assessed using the hIL-18 reporter cell assay described in Example 1. The potencies of WT IL-18 (SEQ ID NO: 1) , M12-DB6-Fc_N297A (SEQ ID NO: 323) and Fc_N297A-M12-DB6 (SEQ ID NO: 331) were assessed in parallel.
[0298] As shown in FIGs 5A-5C and in Table 4 below, each of the IL-18Ra, IL-18RaD12 and IL-BPm masking moieties significantly inhibited the signaling activity of Ra-M12-DB6-Fc_N297A, D12-M12-DB6-Fc_N297A, and BPm-M12-DB6-Fc_N297A (i.e., 100-to 1790-fold reduction in signaling as compared to M12-DB6-Fc_N297A) . The IL-18Ra masking moiety showed the highest masking ability (see FIG 5A and Table 4) . Following MMP9 treatment, Ra-M12-DB6-Fc_N297A Cut, D12-M12-DB6-Fc_N297A Cut, and BPm-M12-DB6-Fc_N297A Cut exhibited signaling activity comparable to that of to M12-DB6-Fc_N297A (see FIGs 5A-5C and Table 4) , with changes in EC50 values within 3 folds (see Table 4) .
[0299] Table 4. Efficacy of IL-18Rα, IL-18Rα D12 and IL-18BP Masking Moieties in inhibiting hIL-18 receptor mediated signaling by M12-DB6-Fc_N297A
[0300] Next, masking moieties Ra, D12, D3, and BPm (described above) were each linked to MM5-DB6-Fc_N297A (SEQ ID NO: 330) via a cleavable linker comprising an MMP9 recognition site (i.e., SGGPGPAGMKGLPGS, SEQ ID NO: 337) to produce activatable MM5-DB6-Fc_N297A polypeptides whose sequences are shown below:
[0301] Ra-MM5-DB6-Fc_N297A
[0302] The IL-18Ra sequence is underlined, cleavable linker is in italic text, the MM5-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text.
[0303] D12-MM5-DB6-Fc_N297A
[0304] The IL-18Ra D12 sequence is underlined, cleavable linker is in italic text, the MM5-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text.
[0305] MM5-DB6-Ra-Fc_N297A
[0306] The IL-18Ra sequence is underlined, cleavable linker is in italic text, the MM5-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text.
[0307] Fc_N297A-Ra-MM5-DB6
[0308] The IL-18Ra sequence is underlined, cleavable linker is in italic text, the MM5-DB6 sequence is in bold, and the Fc-N297A sequence is in plain An additional linker sequence GGGGSGGGGSGGGGS (SEQ ID NO: 363) is indicted in
[0309] Fc_N297A-MM5-DB6-Ra
[0310] The IL-18Ra sequence is underlined, cleavable linker is in italic text, the MM5-DB6 sequence is in bold, and the Fc-N297A sequence is in plain text. An additional linker sequence, (GGGGSGGGGSGSGGG, SEQ ID NO: 365) is indicated in
[0311] The potencies of Ra-MM5-DB6-Fc_N297A, D12-MM5-DB6-Fc_N297A, Fc_N297A-Ra-MM5-DB6, and Fc_N297A-MM5-DB6-Ra for activating hIL-18 receptor mediated signaling, before and after MMP9 treatment, were assessed using the hIL-18 reporter cell assay described in Example 1. The potencies of WT IL-18 (SEQ ID NO: 1) , MM5-DB6-Fc_N297A (SEQ ID NO: 330) and Fc_N297A-MM5-DB6 (SEQ ID NO: 332) were assessed in parallel.
[0312] As shown in FIGs 6A-6D and in Table 5 below, both the IL-18Ra and IL-18RaD12 masking moieties significantly inhibited the signaling activity of Ra-MM5-DB6-Fc_N297A, D12-MM5-DB6-Fc_N297A, Fc_N297A-Ra-MM5-DB6, and Fc_N297A-MM5-DB6-Ra (i.e., > 1000-fold reduction in signaling as compared to MM5-DB6-Fc_N297A) . IL-18Ra was able to mask MM5-DB6 and inhibit hIL-18 receptor mediated signaling regardless of whether the masking moiety was fused to the N-terminus or C-terminus of MM5-DB6. Following MMP9 treatment, Ra-MM5-DB6-Fc_N297A Cut, D12-MM5-DB6-Fc_N297A Cut, Fc_N297A-Ra-MM5-DB6 Cut, and Fc_N297A-MM5-DB6-Ra Cut exhibited signaling activity a little bit lower than that of to MM5-DB6-Fc_N297A or Fc_N297A-MM5-DB6 (see FIGs 6A-6D and Table 5) , with changes in EC50 values within 15 folds (see Table 5) .
[0313] Table 5. Efficacy of IL-18Rα and IL-18Rα D12 in inhibiting hIL-18 receptor mediated signaling by MM5-DB6-Fc_N297A and Fc_N297A-MM5-DB6
[0314] Example 5A: Activatable IL-18 Polypeptides Comprising Masking Moieties Derived from IL-18Rα, with variable linker length
[0315] For masked IL-18, the distance between C-terminal of IL-18 with N-terminal of IL-18Ra in the format of Fc-IL18 -Ra was predicted to be 34 nm based on a simulated structure. A linker with 15 AA may resulted in stretched conformation in the IL-18 and Ra interface. Longer linkers of 25 AA -30 AA were tested.
[0316] Specifically, IL-18Ra masked Fc-M12-DB6 with variable length (M9=15AA, M91=30AA, M92=25AA) in the cleavable site was produced in CHO cell as described earlier. As shown in Figure 7, the C-terminal fused IL-18Ra decreased Fc-M12-DB6’s activity when linked by all the three different length linkers, while Fc-M12-DB6-Ra-M9 with 15 AA linker shows most decreased activity than that of 30 AA or 25 AA.
[0317] Followed by in vitro cleavage with the protease MMP9, all the three Ra masked Fc-M12-DB6 show greatly recovered activity, while cutted Fc-M12-DB6-Ra-M91 and Fc-M12-DB6-Ra-M92 exhibit comparable activity to the unmasked Fc-M12-DB6, and MMP9 cleaved Fc-M12-DB6-Ra-M9 shows partially recovered activity. These data confirmed that a cleavable linker with a length of 25-30 amino acids results in more desired restored activity after protease treatment.
[0318] Example 5B: Activatable IL-18 Polypeptides Comprising Masking Moieties Derived from IL-18Rα, with different combination of cleavage linkers
[0319] Ra masked Fc-M12-DB6 with different combination of cleavable linkers for enhanced cleavage probability in TME was further designed and investigated. MMP protease recognition substrate was fused with either uPA substrate sequence or Legumain cleavable linker, or both to produce the UM (uPA+MMP) , ULM (uPA+Legumain+MMP) and LM (Legumain+MMP) linkers. As shown in Figure 8A and 8B, for Fc-M12-DB6-Ra with all the 6 set of combination linkers tried shows comparable decreased activity to Fc-M12-DB6-Ra-M92. Furthermore, after in vitro MMP9 treatment, the 6 masked Fc-M12-DB6 showed greatly recovered activity. See Figure 8A and 8B. The data suggests that the cleavable linker between IL-18 and masking moiety could be designed to be multiple protease sensitive, without affecting the masking efficacy or activity recovery.
[0320] Another multiple-protease recognition linker named UM-2 was further designed to link IL-18 with masking moiety. Both Fc-M12-DB6-Ra-UM2 and Fc-MM5-DB6-Ra-UM2 were prepared from CHO cells. The UM-2 linker fused masked Fc-M12-DB6-Ra and Fc-MM5-DB6-Ra show greatly decreased activity when compared to the corresponded unmask molecule. Except for MMP cleavage, MMP-14 and uPA treatment were also performed to remove the masking moiety Ra. The result show that all the three proteases we tested could efficiently remove the masking moiety and enable IL-18 variant’s activity recovery (Figure 9A, B) .
[0321] In summary, for the masked IL-18 or masked IL-18 variant, cleavable linker with length of 15-30 AA length, cleavable linker with multiple-protease recognition sequences well kept the masking efficacy of masking moiety. In addition, the suitable length of linkers enabled protease recognition sequence well exposure resulted in effective enzyme cleavage and well restored activity of IL-18 or IL-18 variant.
[0322] Example 6A.
[0323] IL-18 variant polypeptides for hIL-18Ra have been constructed. The binding affinities of WT hIL-18 and IL-18 variant polypeptides for hIL-18Rα ECD-Fc were as shown in Table 6A.
[0324] Table 6A. Affinities of IL-18 variant polypeptides for hIL-18Rα (as determined by BLI)
[0325] The mutations of theses IL-18 variant polypeptides (i.e., M1-M41, LM1-LM5, MM1-MM2, MM4-MM6, WM1-WM6, WM8, WM10-WM14, corresponding to SEQ ID NOs: 1-4, 8-9, 11-12, 17, 21-22, 26-28, 35, 38-39, 41, 43-44, 49-50, 54-56, 58-59, 65-66, 72-74, 81, 91, 94, 99, 104-105, 114, 116-117, 121-125, 131-134, 139-145, 147, 149-153) were shown in Table 6B.
[0326] Table 6B.
[0327] Example 6B: Functional Characterization of IL-18 Variant Polypeptides
[0328] 6.1 Activation of hIL-18 Receptor-Mediated Signaling by IL-18 Variant Polypeptides
[0329] An NFκB-luc / hIL-18RαRβ HEK293 cell line stably expressing hIL-18Rα, hIL-18Rβ and an NFκB luciferase reporter gene was used as the reporter cell to determine the abilities of IL-18 variant polypeptides in activating hIL-18 receptor mediated signaling.
[0330] Briefly, the reporter cells were first seeded in the wells of a white 96-well plate at a density of 3.0 × 104 cells per well. WT hIL-18 or IL-18 variant polypeptides were serially diluted in medium in (a) the presence and (b) the absence of 1 μg / mL hIL-18 BP-hFc. Luminescence intensity was measured after 16 hours of incubation at 37℃.
[0331] As shown in Table 7, all the IL-18 variant polypeptides tested showed potency of activating IL-18 receptor-mediated signaling in a dose dependent manner. Unlike WT hIL-18, the activity of which was greatly decreased (by about 80-fold) in the presence of 1 μg / mL hIL-18BP-hFc, the IL-18 variant polypeptides (i.e., M1-M7, M9-M41, LM1-LM5, MM1-MM2, MM4-MM6, WM1-WM6, WM8, WM10-11, corresponding to SEQ ID NOs: 2-4, 8-9, 11-12, 17, 21, 22, 26-28, 35, 38, 39, 41, 43, 44, 49, 50, 54-56, 58-59, 65-66, 72-74, 81, 91, 94, 99, 104-105, 114, 116-117, 121-125, 131-134, 139-145, 147, 149-150) demonstrated Hil-18 BP-resistant activity with changes of EC50 by no more than 3 folds, indicating that the IL-18 variant polypeptides were significantly less affected by Hil-18BP in view of Hil-18 receptor-mediated signaling activation. One exception is WM6, EC50 of which shows ~12-fold potency loss in the presence of 1 μg / Ml Hil-18BP-hFc, which is still a lot better than the WT hIL-18.
[0332] Table 7. EC50s of IL-18 Variant Polypeptides in hIL-18 Reporter Assay, in the Presence or Absence of 1 μg / mL hIL-18BP-hFc
[0333] 6.2 Human PBMC-Based hIFNγ Release Assays
[0334] PBMC-based assays were performed to test abilities of IL-18 variant polypeptides in activating T / NK cells and inducing hIFNγ release. Briefly, human PBMC cells were seeded in the wells of 96-well plate at a density of 5.0×105 cells per well and cultured for 5 hours before treatment. WT hIL-18 or IL-18 variant polypeptides were serially diluted with 1 ng / mL human IL-12 in (a) the presence or (b) the absence of 1 μg / mL hIL-18 BP-hFc, and then supplemented to the wells. Culture medium was collected from each well after 16 hour incubation at 37℃, and hIFNγ concentration was measured via FRET using a kit (62HIFNGPEG, Cisbio) according to manufacturer’s instructions.
[0335] The tested IL-18 variant polypeptides showed potency of inducing hIFNγ release from PBMC in a dose dependent manner. In addition, as shown in Table 8, the activity of WT hIL-18 was greatly attenuated in the presence of 1 μg / mL hIL-18BP-hFc, with a decrease of EC50 by about 35 folds. In contrast, the IL-18 variant polypeptides (i.e., M11-M13, M15, M17, M21, M24, M29, M32-M33, M35-M36, MM5, WM4-WM6, WM8, WM10-11, corresponding to SEQ ID NOs: 3, 9, 17, 27, 39, 43, 49, 94, 105, 116-117, 133, 143-150) demonstrated hIL-18 BP-resistant activity with changes of EC50 by no more than 2 folds, indicating that the IL-18 variant polypeptides were significantly less affected by hIL-18BP in view of hIFNγ induction.
[0336] Table 8. EC50s of IL-18 Variant Polypeptides in PBMC Assay, in the Presence or Absence of 1 μg / mL hIL-18BP
[0337] 6.3 Mouse Splenocyte-Based mIFNγ Release Assay
[0338] To assess in vivo efficacy of the IL-18 variant polypeptides of the present application, mouse splenocyte-based murine IFNγ ( “mIFNγ” ) release assays are performed as follows.
[0339] Briefly, fresh isolated mouse splenocytes are seeded in the wells of a 96-well plate at a density of 6.5 ×105 cells per well. WT hIL-18 or IL-18 variant polypeptides were serially diluted with 1 ng / mL mouse IL-12 in (a) the presence or (b) the absence of 1 μg / mL mouse IL-18BP-Fc, and then supplemented to the wells. Culture medium is collected from each well after 16 hour incubation at 37℃, and then mIFNγ concentration in the medium is measured via FRET using a kit (62MIFNGPEG, Cisbio) according to manufacturer’s instructions.
[0340] Example 7: Generation and Characterization of IL-18 Variant Polypeptides comprising Serine→Cysteine and / or Cysteine→ Serine Substitutions
[0341] 7.1 Wild-type IL-18 or IL-18 Polypeptide Variants Comprising Cysteine→ Serine Substitutions
[0342] Although the potent immune stimulation activity of IL-18 has been reported, the recombinant IL-18 is mainly expressed in E. coli. system, which is poorly suited to good manufacturing pactice (GMP) -compatible manufacturing standards that mostly using mammalian host cell. Human IL-18 has four unpaired cysteines and does not contain disulfide bond. Among the four cysteines, C38, C68 and C76 are highly solvent-exposed while C127 is partially exposed. When expressed, IL-18 is prone to form undesirable aggregates due to the exposed free cysteines, resulting in decreased yield and / or purity. To improve the proper folding and stability of IL-18, i.e. aiming for higher yield with qualified purity, we engineered IL-18 variant by using cysteine mutation strategy and disulfide bond introduction strategies. The following experiments were performed to assess the effects of Cys to Ser ( “C→S” ) mutations on the druggability of IL-18 variants and on the expression of IL-18 variants in mammalian cells, such as CHO cells and 293F cells. Wild-type IL-18 and IL-18 variant polypeptides M12 and MM5 were modified (or further modified) to comprise C38S, C68S, and C76S substitutions to generate new variants comprising the amino acid sequences below:
[0343] IL-18 VARIANT COMPRISING C38S, C68S, and C76S substitutions in WT hIL-18 background ( “IL-18-SSS” ) :
[0344] IL-18 VARIANT COMPRISING C38S, C68S, and C76S substitutions in M12 background ( “M12-SSS” ) :
[0345] IL-18 VARIANT COMPRISING C38S, C68S, and C76S substitutions in MM5 background ( “MM5-SSS” ) :
[0346] Fc fused cytokines can improve the pharmacokinetics and be suitable for broadly applicated manufacturing processes. Next, the C-termini of each of IL-18-SSS, M12-SSS, and M5-SSS were fused to the N-terminus of a human IgG1 Fc comprising an N297A substitution (EU numbering) to generate IL-18-SSS-Fc_N297A (SEQ ID NO: 319) , M12-SSS_N297A (SEQ ID NO: 320) , and MM5-SSS_N-297A (SEQ ID NO: 321) . The fusion polypeptides were expressed in CHO cells, harvested, and purified via Protein A chromatography. The yield of IL-18-SSS-Fc_N297A obtained following one step Protein A purification was 14.7 mg / L, with 65%purity. By contrast, the yield of WT IL-18-Fc_N297A obtained following one step Protein A purification was ~ 16 mg / L, with 11%purity. The yield of M12-SSS-Fc_N297A obtained following one step Protein A purification was 5.6 mg / ml, with 72%purity. By contrast, M12-Fc_N297A was not expressed at a detectable level in 100 mL CHO host cells. The yield of MM5-SSS-Fc_N297A obtained following one step Protein A chromatography was 24.5 mg / L, with 46%purity. Following a further purification step by gel filtration, the yield of MM5-SSS-Fc_N297 was 3.4 mg / L, with 99%purity. By contrast, MM5-Fc_N297A was not expressed at a detectable level in 100 mL CHO host cells.
[0347] M12-SSS was further modified to comprise a C127S substitution to generate M12-SSSS:
[0348] The C-terminus of M12-SSSS was fused to the N-terminus of a human IgG1 Fc variant comprising an N297A substitution (EU numbering) to generate M12-SSSS-Fc_N297A (SEQ ID NO: 322) . M12-SSSS-Fc_N297A was expressed in CHO cells, harvested, and purified via Protein A chromatography. Introduction of the extra C127S substitution (i.e., a fourth C→S substitution) led to better expression yield and purity than M12-Fc_N297A, however, it has decreased yield and purity of M12-SSSS-Fc_N297A as compared to the yield and purity of M12-SSS-Fc_N297A (data not shown) , suggesting that the C127 mutation may compromised conformation benefits of the first three cycteine mutations.
[0349] Next, the potencies of IL-18-SSS-Fc_N297A and M12-SSS-Fc_N297A in activating IL-18 receptor-mediated signaling were characterized using the in vitro assay described in Section 6.1 of Example 6B. The potency of IL-18-SSS-Fc_N297A showed was comparable to that of wild-type IL-18, whereas M12-SSS-Fc_N297A showed a ~7-fold potency loss as compared to M12. The signaling activity of IL-18-SSS-Fc_N297A decreased in the presence of 1 μg / ml hIL-18 BP-hFc ( “BP” ) , whereas M12-SSS-Fc_N297A demonstrated hIL-18 BP-resistant activity in the presence of 1 μg / ml hIL-18BP-hFc. MM5-SSS-Fc_N297A showed a ~220-fold potency loss as compared to MM5, but demonstrated hIL-18 BP-resistant activity in the presence of 1 μg / ml hIL-18BP-hFc. Such results indicate that that the 3 cysteine → serine substitutions do not affect IL-18 BP resistance property. These data suggests that mutations at C38, C68, and C76 which prevent undesirable intra-and inter molecular disulfide bond formation of the three exposed cysteines are critical for improving the yield and purity of IL-18 and of IL-18 polypeptide-Fc fusion protein. In addition to this, the Fc fused IL-18 and IL-18 variant is expected to exhibit a higher half-life.
[0350] 7.2 IL-18 Polypeptide or IL-18 Polypeptide Variants Comprising Amino Acid Substitutions that Remove and / or Introduce Cysteine Residues
[0351] The following experiments were performed to assess the effects of substitutions that delete inherent cysteines (i.e., naturally occurring cysteines in a polypeptide sequence) and / or introduce a disulfide bond on the druggability, expression, and purification of IL-18 variant polypeptides. M12 is used as a representative variant for engineering strategies selection. First, in silico screening was performed based on molecular dynamic simulation, and following AI-based stability assessment, mutation hot spots on each of the four cysteines (C38, C68, C76, and C127) of M12 seperately were identified as listed. See Table 5. In addition, structure-guided design was used to identify amino acids in spatial positions which, when substituted to Cys residue (s) , would permit the formation of new, non-native disulfide bond (s) . The mutation strategies shown in Table 5 (i.e., DB6, DB7, DB8, DB9, and DB10) were proposed. It was hypothesized that introducing a S117C mutation while retaining C76 would promote a disulfide bond between C117 and C76.
[0352] Table 9. M12-Derived IL-18 Polypeptide Variants
[0353] The mutation strategies in Table 9 were introduced into IL-18 polypeptide variant M12 to generate new variants M12-DB6, M12-DB7, M12-DB8, M12-DB9, and M12-DB10. The mutation hot spot on single site is from the in silico screening. In silico screening was performed based on molecular dynamic simulation, and following AI-based stability assessment, mutation hot spots on each of the four cysteines (C38, C68, C76, and C127) of M12 were identified as listed.
[0354] M12-DB6
[0355] M12-DB7
[0356] M12-DB8
[0357] M12-DB9
[0358] M12-DB10
[0359] The C-termini of each of M12-DB6, M12-DB7, M12-DB8, M12-DB9, and M12-DB10 variant was fused to a human IgG1 Fc variant comprising an N297A substitution (EU numbering) . The resulting fusion polypeptides, i.e., M12-DB6-Fc_N297A (SEQ ID NO: 323) , M12-DB7-Fc_N297A (SEQ ID NO: 324) , M12-DB8-Fc_N297A (SEQ ID NO: 325) , M12-DB9-Fc_N297A (SEQ ID NO: 326) , and M12-DB10-Fc_N297A (SEQ ID NO: 327) , were expressed in CHO cells, harvested, and purified via one-step Protein A chromatography. The purified preparations were analyzed via SEC and SDS PAGE (data not shown) . See Table 10 below.
[0360] Table 10. Expression and Purification of M12-DB6, M12-DB7, M12-DB8, M12-DB9, and M12-DB10 Fc_N297A fusion proteins
[0361] “ / ” means there is no detectable protein purified.
[0362] M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, M12-DB9-Fc_N297A, and M12-DB10-Fc_N297A showed greatly improved expression yields and / or purity (see Table 6) than either M12- Fc_N297A or M12-SSS-Fc_N297A. Among M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, M12-DB9-Fc_N297A, and M12-DB10-Fc_N297A, M12-DB6-Fc_N297A exhibited the highest expression yield (313 mg / L) with 89.8%purity (as determined by SEC-HPLC) after one-step Protein A purification. M12-DB8-Fc_N297A was not expressed at detectable levels. The expression yield of M12-DB7-Fc_N297A was about 50%of the yield of M12-DB6-Fc_N297A. M12-DB7-Fc_N297A showed similar purity with M12-DB6-Fc_N297A following Protein A chromatography.
[0363] The high yield and purity, especially the high yield, of DB6 and DB7 are striking. The M12-DB6 format is about 60-fold of the SSS format. The data suggests that the strategy of removing cysteine at position 38 and 68 while introducing C117 to promote a disulfide bond between C117 and C76 is highly advantageous.
[0364] The lower yield of DB7 and undetectableness of DB8 suggests that a C127X substitution may not further improve polypeptide production in mammalian cells. Mutation on the partially exposed site C127 needs delicate design. Based on C38X+C68X+C76+S117C strategy, the 127 site prefers C over A, while the hydrophobic 127I impacts dramatically to the proper folding of IL-18 polypeptide. We further tested corresponding variant IL-18-DB6 polypeptide with C127N, C127T and C127S, and all three can be expressed at comparable levels as DB6. Given the partial exposure nature of the 127 site and the results, one should avoid introducing an amino acid with a hydrophobic side chain at the 127 site under this strategy.
[0365] Next, the potencies of M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, M12-DB9-Fc_N297A, and M12-DB10-Fc_N297A in activating IL-18 receptor-mediated signaling were characterized using the in vitro assay described in Section 6.1 of Example 6. As shown in Table 11 below, M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, M12-DB9-Fc_N297A, and M12-DB10-Fc_N297A showed much higher potency in activating IL-18 receptor-mediated signaling than WT IL-18. The signaling activities of M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, and M12-DB9-Fc_N297A tested were not inhibited in the presence of 1 μg / ml hIL-18BP-hFc. See Table 11.
[0366] Table 11. EC50s of M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, M12-DB9-Fc_N297A, and M12-DB10-Fc_N297A in an in vitro IL-18 Receptor Mediated Signaling Assay
[0367] Next, “DB6” substitutions, i.e., C38I, C68S, and S117C, were introduced into variant MM5 to generate MM5-DB6:
[0368] MM5-DB6
[0369] “DB6” substitutions were also introduced into wild-type IL-18 to generate WT IL18-DB6:
[0370] WT IL18-DB6
[0371] An additional variant, WT-DBo was designed by introducing an S117C substitution into wild-type IL-18:
[0372] WT IL-18-DBo
[0373] The C-termini of each of WT IL-18-DB6, WT IL-18-DBo, and MM5-DB6 was fused to the N-terminus of a human IgG1 Fc variant comprising an N297A substitution (EU numbering) . The resulting fusion polypeptides, WT IL18-DB6-Fc_N297A (SEQ ID NO: 328) , WT IL-18-DBo-Fc_N297A (SEQ ID NO: 329) , and MM5-DB6-Fc_N297A (SEQ ID NO: 330) , were expressed in CHO cells, harvested, and purified via Protein A chromatography. The purified preparations were analyzed via SEC and SDS PAGE (data not shown) . As shown in Table 12 below, there is no detectable protein of WT IL18-DBo-Fc_N297A after same expression and purification procedure. The expression yield of WT IL18-DB6-Fc was 157 mg / L, and WT IL18-DB6-Fc_N297A was 91.6%pure (as determined by SEC-HPLC) following one-step Protein A chromatography (see Table 12) . This data confirmed the highly advantageous strategy of promoting a disulfide bond between C76 and C117 while removing cysteine at position 38 and 68. Such data also indicate that merely introducing a disulfide bond between C76 and C117 may not be sufficient to improve fusion polypeptide expression in mammalian cells. Improved expression in mammalian cells is achieved with fusion polypeptides comprising an IL-18 variant that comprises (i) an engineered C76-C117 disulfide bond, (ii) a C38 substitution (see Table 9) , and (iii) a C68 substitution (see Table 9) . MM5-DB6-Fc_N297A consistently shows much higher expression yield and purity than MM5-SSS-Fc_N297A (see Table 12) . Such data also suggests that the C38X+C68X+C76+S117C mutation strategy such as “DB6” or “DB7” substitutions are suitable for improving the yield of WT IL-18 and IL-18 variant polypeptides during production in mammalian cells and following purification.
[0374] Next, fusion polypeptides in which the C-terminus of a human IgG1 Fc comprising an N297A substitution (EU numbering) was fused to the N termini of each of variants M12-DB6 and MM5-DB6 were designed. The resulting fusion polypeptides, i.e., Fc_N297A-MM5-DB6 (SEQ ID NO: 332) and Fc_N297A-M12-DB6 (SEQ ID NO: 331) were expressed in CHO cells, harvested and purified via Protein A chromatography. As shown in Table 12, both Fc_N297A-MM5-DB6 and Fc_N297A-M12-DB6 demonstrated comparable expression yield and purity in CHO cells when compared to the M12-DB6-Fc_N297A or MM5-DB6-Fc_N297A, respectively. Following one-step Protein A chromatography purification, Fc_N297A-MM5-DB6 was ~97%pure (as determined by SEC-HPLC) , and Fc_N297A-M12-DB6 was 89%pure (as determined by SEC-HPLC) . These data suggest that the cystine mutation plus disulfide bond introduction strategy is eligible for Fc fusion in either fusion order.
[0375] Table 12. Yield and Purity of WT IL18-DB6-Fc_N297A, WT IL18-DBo-Fc_N297A, MM5-DB6-Fc_N297A, Fc_N297A-MM5-DB6, and Fc_N297A-M12-DB6 following expression in CHO cells and Protein A Chromatography
[0376] Next, the potencies of WT IL18-DB6-Fc_N297A, MM5-DB6-Fc_N297A, Fc_N297A-MM5-DB6 and Fc_N297A-M12-DB6 in activating IL-18 receptor-mediated signaling were characterized using the in vitro assay described in Section 6.1 of Example 6B. Both WT IL18-DB6-Fc_N297A and MM5-DB6-Fc_N297A exhibited potent IL-18 receptor cell activation signal, stronger than that of WT IL-18 (see Table 13) . Fc_N297A-MM5-DB6 shown similar potency with WT IL-18, while Fc_N297A-M12- DB6 resulted in much stronger activation signal to the IL-18 reporter cell (see Table 13) . In the presence of 1 μg / mL IL-18BP-hFc, activity of WT IL18-DB6-Fc_N297A was greatly decreased, whereas the activity of MM5-DB6-Fc_N297A was resistant to inhibition by IL-18 BP (see Table 13) . Both M12-DB6-Fc_N297A and MM5-DB6-Fc_N297A keeps the IL-18 BP resistant activity, meanwhile activity of WT IL18-DB6-Fc_N297A keeps decreased by IL-18 BP, indicating that the “DB6” set of mutations (i.e., C38I, C68S, and S117C, see Table 9) improve expression profile of IL-18 and IL-18 variant without affecting the IL-18BP’s dependency.
[0377] Above all, such results demonstrate that the strategy of introduction C38X+C68X+C76+S117C mutation into a WT IL-18-Fc fusion polypeptide or into an IL-18 variant-Fc fusion polypeptide dramatically improves the expression yield of the fusion polypeptide during production in mammalian cells and improves the yield of purified fusion polypeptide following chromatography, without affecting the IL-18 BP resistant activity. Further, WT IL-18 and IL-18 variants that have been engineered to comprise the “DB6” set of mutations exhibit higher potencies of activating IL-18 receptor-mediated signaling. Such results were observed with fusion polypeptides in which the C-terminus of the Fc region was fused to the N-terminus of the IL-18 variant, as well as with fusion polypeptide in which the C-terminus of the IL-18 variant was fused to the N-terminus of the Fc domain (see Table 14) .
[0378] Table 13. EC50s of WT IL-18-DB6-Fc_N297A, MM5-DB6-Fc_N297A, Fc_N297A-MM5-DB6, and -Fc_N297A-M12-DB6 in an in vitro IL-18 Receptor Mediated Signaling Assay
[0379] See Table 14 below as a summary of data described above.
[0380] Table 14.
[0381] The present disclosure is not to be limited in scope by the specific embodiments described which are intended as single illustrations of individual aspects of the disclosure, and any compositions or methods which are functionally equivalent are within the scope of this disclosure. It will be apparent to those skilled in the art that various modifications and variations can be made in the methods and compositions of the present disclosure without departing from the spirit or scope of the disclosure. Thus, it is intended that the present disclosure cover the modifications and variations of this disclosure provided they come within the scope of the appended claims and their equivalents.
[0382] All publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
[0383] The present invention has been described in terms of particular embodiments found or proposed by the present inventor to comprise preferred modes for the practice of the invention. It will be appreciated by those of skill in the art that, in light of the present disclosure, numerous modifications and changes can be made in the particular embodiments exemplified without departing from the intended scope of the invention. For example, due to codon redundancy, changes can be made in the underlying DNA sequence without affecting the protein sequence. Moreover, due to biological functional equivalency considerations, changes can be made in protein structure without affecting the biological action in kind or amount. All such modifications are intended to be included within the scope of the appended claims.
[0384] SEQUENCE SUMMARY TABLE
Claims
1.An activatable interleukin 18 (IL-18) polypeptide comprising:(a) an IL-18 polypeptide, and(b) a masking moiety,wherein the IL-18 polypeptide is attached to the masking moiety via a cleavable linker.2.The activatable IL-18 polypeptide of claim 1, wherein the masking moiety inhibits the IL-18 polypeptide from activating IL-18 receptor mediated signaling when the masking moiety is attached to the IL-18 polypeptide via the cleavable linker, optionally wherein the activation of IL-18 receptor is decreased at least by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%or 90%by the masking moiety.3.The activatable IL-18 polypeptide of claim 1 or 2, wherein the masking moiety comprises an IL-18 pro-peptide (i.e., pro-IL-18 pro-peptide) , an extracellular domain of IL-18Rα, an extracellular domain of IL-18Rβ, an IL-18 binding protein, a fragment of any one of the preceding, or a variant of any one of the preceding.4.The activatable IL-18 polypeptide of any one of claims 1-3, wherein the masking moiety comprises an IL-18 pro-peptide (i.e., pro-IL-18 pro-peptide) , optionally wherein the IL-18 pro-peptide comprises a pro-peptide of human IL-18 (hIL-18) , optionally wherein the pro-peptide of hIL-18 comprises the amino acid sequence of SEQ ID NO: 333.5.The activatable IL-18 polypeptide of claim 4, wherein the masking moiety comprises a truncated pro-peptide of pro-IL-18.6.The activatable IL-18 polypeptide of claim 5, wherein the truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336.7.The activatable IL-18 polypeptide of any one of claims 1-3, wherein the masking moiety comprises an extracellular domain of IL-18Rα or a fragment thereof, optionally wherein the fragment of the extracellular domain of IL-18Ra comprises a) the first and the second domains of the extracellular domain, or b) the third domain of the extracellular domain.8.The activatable IL-18 polypeptide of claim 3 or claim 7, wherein the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356.9.The activatable IL-18 polypeptide of any one of claims 1-8, wherein the cleavable linker comprises one or more set of amino acid sequences that are recognized and cleaved by one or more proteases, optionally wherein the one or more proteases are one or more tumor microenvironment (TME) proteases.10.The activatable IL-18 polypeptide of claim 9, wherein the one or more proteases are one or more tumor microenvironment (TME) proteases, and wherein the one or more TME proteases are selected from the group consisting of: urokinase-type Plasminogen Activator, matriptase, legumain, prostate specific antigen, a dipeptidyl peptidase, hepsin, a matrix metalloprotease, a disintegrin and metalloproteinase, human leukocyte elastase, Proteinase 3, prourokinase, plasminogen, staphylokinase, a cathepsin, a tissue kallikrein and a Kallikrein-related peptidase.11.The activatable IL-18 polypeptide of claim 10, wherein the one or more TME proteases are matrix metalloproteases, and wherein the matrix metalloproteases are selected from the group consisting of: matrix metalloprotease 1, matrix metalloprotease 2, matrix metalloprotease 3, matrix metalloprotease 8, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 12, and matrix metalloprotease 14.12.The activatable IL-18 polypeptide of any one of claims 1-11, wherein the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by one or more of matrix metalloprotease 2, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 14, urokinase-type Plasminogen Activator, matriptase and legumain.13.The activatable IL-18 polypeptide of any one of claims 1-12, wherein the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by at least two, three, or four proteases, optionally wherein the one or more amino acid sequences are recognized and cleaved by a) both legumain and MMP9 / MMP2 / MMP14, b) both uPA and MMP9 / MMP2 / MMP14, c) all of uPA, legumain, MMP2, MMP14 and MMP9.14.The activatable IL-18 polypeptide of any one of claims 1-13, wherein the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377.15.The activatable IL-18 polypeptide of any one of claims 1-14, wherein the cleavage linker further comprises a spacer sequence, optionally wherein the cleavage linker comprises two spacer sequences flanking both N-and C-terminus of the amino acid sequence that is recognized and cleaved by one or more proteases.16.The activatable IL-18 polypeptide of any one of claims 1-15, wherein the cleavage linker comprises two or more set of amino acid sequences that are recognized and cleaved by one or more proteases.17.The activatable IL-18 polypeptide of claim 16, wherein at least one of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker, wherein each of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker.18.The activatable IL-18 polypeptide of any one of claims 1-17, wherein the spacer sequence comprises a GS linker, optionally the GS linker has a length of no more than about 10, 9, 8, 7, 6, or 5 amino acids.19.The activatable IL-18 polypeptide of any one of claims 1-18, wherein the cleavage linker consists of no more than about 50, 40, 35, or 30 amino acids.20.The activatable IL-18 polypeptide of any one of claims 1-19, wherein the cleavage linker consists of no less than about 10, 15, 20, or 25 amino acids.21.The activatable IL-18 polypeptide of, wherein the cleavage linker consists of about 25 to about 30 amino acids, and wherein the masking moiety comprises an extracellular domain of IL-18Rα, further optionally wherein the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356.22.The activatable IL-18 polypeptide of any one of claims 1-21, wherein the cleavage linker comprises any one of amino acid sequences of SEQ ID NOs: 399-407.23.The activatable IL-18 polypeptide of any one of claims 1-22, wherein the IL-18 polypeptide comprises a wild-type IL-18, optionally wherein the wild-type IL-18 comprises a wild-type human IL-18, optionally wherein the wild-type human IL-18 comprises an amino acid sequence of SEQ ID NO: 1.24.The activatable IL-18 polypeptide of any one of claims 1-23, wherein the IL-18 polypeptide comprises an IL-18 variant polypeptide.25.The activatable IL-18 polypeptide of claim 24, wherein the IL-18 variant polypeptide specifically binds to IL-18 receptor α (IL-18Rα) and exhibits (i) substantially reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18 or (ii) no binding to IL-18BP.26.The activatable IL-18 polypeptide of claim 24 or 25, wherein the IL-18 variant polypeptide exhibits an increased binding to IL-18Rα relative to the wild-type IL-18.27.The activatable IL-18 polypeptide of any one of claims 24-26, wherein the IL-18 variant polypeptide comprises at least three, four, five, or six mutations at G3, E6, D54, Q56, P57, N91 and R104 of an IL-18 polypeptide, wherein amino acid positions are relative to a wild type (WT) human IL-18 set forth in SEQ ID NO: 1.28.The activatable IL-18 polypeptide of any one of claims 24-27, wherein the IL-18 variant polypeptide comprises a cysteine at position 117 and a cysteine at position 76, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1, optionally wherein the IL-18 variant polypeptide does not comprise a cysteine at position 38, and / or the IL-18 variant polypeptide does not comprise a cysteine at position 68.29.The activatable IL-18 polypeptide of any one of claims 24-28, wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 2-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150.30.The activatable IL-18 polypeptide of any one of claims 1-29, wherein the IL-18 polypeptide comprises from N-to C-terminus, a) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336, b) a cleavage linker, and c) an IL-18 variant polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.31.The activatable IL-18 polypeptide of any one of claims 1-29, wherein the IL-18 polypeptide comprises from N-to C-terminus, a) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, b) a cleavage linker, and c) an IL-18 variant polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.32.The activatable IL-18 polypeptide of any one of claims 1-29, wherein the IL-18 polypeptide comprises from N-to C-terminus, a) an IL-18 variant polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 variant polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, b) a cleavage linker, and c) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.33.The activatable IL-18 polypeptide of any one of claims 1-32, wherein the IL-18 polypeptide comprises an amino acid sequence of any one of SEQ ID NOs: 340-343, and 345-352, or b) an amino acid sequence functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 340-343, and 345-352.34.The activatable IL-18 polypeptide of any one of claims 1-33, wherein the IL-18 polypeptide comprises a fusion protein comprising (1) a wild-type IL-18 or an IL-18 variant polypeptide and (2) a half-life extending domain, optionally wherein the half-life extending domain comprises a albumin binding moiety or an antibody Fc domain or variant thereof, optionally wherein the half-life extending domain is a human IgG Fc domain (such as hIgG1 Fc) .35.The activatable IL-18 polypeptide of claim 34, wherein the IL-18 variant polypeptide of the fusion protein specifically binds to IL-18 receptor α (IL-18Rα) and exhibits (i) substantially reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18 or (ii) no binding to IL-18BP.36.The activatable IL-18 polypeptide of claim 34 or 35, wherein the IL-18 variant polypeptide of the fusion protein exhibits an increased binding to IL-18Rα relative to the wild-type IL-18.37.The activatable IL-18 polypeptide of any one of claims 34-36, wherein the human IgG1 Fc domain variant of the fusion protein comprises an N297A mutation (EU numbering) , optionally wherein the human IgG1 Fc domain variant comprises an amino acid sequence of SEQ ID NOs: 371 or 390.38.The activatable IL-18 polypeptide of any one of claims 34-37, wherein the C-terminus of the IL-18 variant polypeptide of the fusion protein is fused to the N-terminus of the human IgG Fc domain or variant thereof of the fusion protein.39.The activatable IL-18 polypeptide of any one of claims 34-37, wherein the C-terminus of the human IgG Fc domain or variant thereof of the fusion protein is fused to the N-terminus of the IL-18 variant polypeptide of the fusion protein.40.The activatable IL-18 polypeptide of any one of claims 34-39, wherein the fusion polypeptide comprises an amino acid sequence of any one of SEQ ID NOs: 319-332, 378-389 and 408-418.41.The activatable IL-18 polypeptide of any one of claims 1-40, comprising an amino acid sequence of any one of SEQ ID NOs: 340-343, 345-352, 357-362, 364, 366-370, 391-398 and 408-418.42.A dimer comprising two activatable IL-18 polypeptides of any one of clams 1-41.43.The dimer of claim 42, wherein the dimer is a homodimer.44.The dimer of claim 42, wherein the dimer is a heterodimer.45.A nucleic acid encoding the activatable IL-18 polypeptide of any one of claims 1-41.46.A vector comprising the nucleic acid of claim 45.47.A host cell comprising the nucleic acid of claim 45 or the vector of claim 46.48.A method of producing an activatable IL-18 polypeptide, comprising:(a) culturing the host cell of claim 47 under conditions where the activatable IL-18 polypeptide is expressed, and;(b) recovering the activatable IL-18 polypeptide produced by the host cell.49.The method of claim 48, further comprising purifying the activatable IL-18 polypeptide.50.A pharmaceutical composition comprising activatable IL-18 polypeptide of any one of claims 1-41, the nucleic acid of claim 45, or the vector of claim 46.51.A method of treating a disease in an individual, comprising administering to the individual an effective amount of the pharmaceutical composition of claim 50.52.The method of claim 51, wherein the disease is cancer.53.A method of activating IL-18 receptor mediated signaling in an individual, comprising administering to the individual an effective amount of the pharmaceutical composition of claim 50.54.A method of stimulating antigen-experienced immune cells in an individual in need thereof, comprising administering to the individual an effective amount of the pharmaceutical composition of claim 50.55.The method of claim 54, wherein the stimulation comprises increasing activity and / or number of the antigen-experienced immune cells.56.The method of any one of claims 51-55, wherein the individual is human.