Optogenetic modulation by multi-characteristic opsins for vision restoration and other applications thereof

EP4704877A2Pending Publication Date: 2026-03-11NANOSCOPE THERAPEUTICS INC
View PDF 0 Cites 0 Cited by

Patent Information

Authority / Receiving Office
EP · EP
Patent Type
Applications
Current Assignee / Owner
Filing Date
2024-04-24
Publication Date
2026-03-11

AI Technical Summary

Technical Problem

Current optogenetic approaches for vision restoration, such as those using Channelrhodopsin-2, require high light intensities and do not produce a characteristic photoreceptor-rod signal, limiting their effectiveness in ambient light conditions and causing potential damage to retinal cells.

Method used

Development of Multi-Characteristics Opsins (MCOs), specifically enhanced Multi-Characteristic Opsin 1 (eMCO1), which are highly sensitive to visible light, can be packaged into viral vectors like Adeno-Associated Virus, and expressed in retinal cells to produce a long-lasting inward current similar to a photoreceptor-rod signal, enabling vision restoration at low light levels.

Benefits of technology

eMCO1 allows for efficient and stable in-vivo expression in degenerated retinas, significantly improving visually guided behavior and visual acuity in animal models, even at light intensities orders of magnitude lower than required for Channelrhodopsin-2, with minimal risk of retinal cell damage.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure US2024026082_31102024_PF_FP_ABST
    Figure US2024026082_31102024_PF_FP_ABST
Patent Text Reader

Abstract

This invention, in one aspect, relates generally to compositions and methods for modulating cellular activities by synthetic opsins. Further, the invention provides method for the use of synthetic opsins for vision restoration and other applications, wherein the amino acid sequence of the synthetic opsin is modified to provide enhanced light sensitivity, kinetics and ion-selectivity.
Need to check novelty before this filing date? Find Prior Art

Description

OPTOGENETIC MODULATION BY MULTI-CHARACTERISTIC OPSINS FOR VISION RESTORATION AND OTHER APPLICATIONS THEREOFCROSS-REFERENCE

[0001] This application is continuation-in-part of U.S. patent application US20220162275A1 filedNovember 22, 2021 which in turns claims benefit of US Patent application, serial no. 16 / 347,375 filed May 3, 2019, which in turn claims the benefit of priority to PCT application no. PCT / US2017 / 059922 filed on November s, 2017 and further claims the benefit of priority to U.S. provisional application serial no.62 / 418,196, filed November 11 , 2016, all of which are hereby incorporated by reference in their entirety.FIELD OF THE INVENTION

[0002] This invention relates generally to compositions and methods for modulating cellular activities by synthetic opsins. The invention provides enhanced light sensitivity to neurons for vision restoration and other therapeutic applications.BACKGROUND OF THE INVENTION

[0003] In retinal degenerative diseases such as dry age-related macular degeneration (AMD) and Retinitis Pigmentosa (RP), the photoreceptors (e.g., rods and cones) that are responsible for conversion of light into electro-chemical signals, are degenerated. This prevents the generation of photo-induced signals in retina, which breaks the vision-sensory related cascade of events within the visual system. Loss of photoreceptor cells and / or loss of photoreceptor cell function are the primary causes of reduced light sensitivity and blindness.SUMMARY OF THE INVENTION

[0004] In an aspect of the invention, the present disclosure provides several light-sensitive ion-channel and ligand molecules, methods of their preparation and different uses, including vision restoration. In another aspect, the invention comprises isolated nucleic acid sequences that encode light-sensitive ionchannels, ligands and constructs, including plasmids and other nucleic acid vectors that comprise such nucleic acid sequences.

[0005] In one aspect, the disclosure provides light-sensitive ion-channel and ligands (Multi-Characteristics Opsins) that are synthetic in origin, These Multi-Characteristics Opsins or MCOs: (i) have high photosensitivity at multiple visible wavelengths and (ii) can be packaged into a genomic vector such as a plasmid that can be packaged into a virus. The virus can include an adeno-associated virus or a lentivirus.

[0006] In addition, the disclosure in some aspects provides expression of MCOs in cells in-vitro or in-vivo as well as methods for modulating cellular activities by these synthetic opsins. In one aspect, the MultiCharacteristics Opsins are highly sensitive to visible light and ambient-light activatable. In some aspect, expression of a specific MCO in cell produces a long-lasting inward current in response to white light similar to that found in an unmodified photoreceptor-rod signal.

[0007] In another aspect, the disclosure provides a synthetic, ambient-light activatable, fast, enhanced Multi-Characteristics Opsin (eMCO1) which has a stabilizer-biomarker that play an active role in stabilizingeMCO1 expression on the cell membrane. In another aspect of the invention, the stabilized eMCO1 has a higher percentage of beta sheets and a lower percentage of a disordered structure (i.e. less prone to cleavage). In a further aspect, the stabilized eMCO1 enhances the photo-induced current in the cells expressing eMCO1 .

[0008] In another aspect, the disclosure provides a synthetic, ambient-light activatable, fast, enhanced Multi-Characteristic Opsin (eMCO1) that contains a stabilizer-biomarker can be used to confirm the MCO gene expression in targeted cells.

[0009] According to another aspect of the invention, the light emitted from the stabilizer-biomarker present in the enhanced Multi-Characteristics Opsin enhances the photo-induced current in the cells expressing eMCO1 by light emitted / re-emitted from the stabilizer-biomarker molecule.

[0010] According to another aspect of the invention, the disclosed invention provides method for the use of synthetic opsins for vision restoration and other applications. In an aspect of the invention, the amino acid sequence of the synthetic opsin is modified to provide enhanced light sensitivity, kinetics and ionselectivity.

[0011] In an aspect of the present invention, a method of delivering MCO to degenerated retinas in order to restore light sensitivity is provided. In another aspect, efficient and stable in-vivo expression of MCO- reporter protein in the retina occurs after intravitreal injection of Adeno-Associated Virus carrying MCO. In a further aspect, expression of MCO in the retina of an individual suffering from retinal degeneration can provide for the behavioral restoration of vision. In an aspect of the invention, the improvement in visually guided behavior occurs even at light intensity levels that are orders of magnitude lower than that required for Channelrhodopsin-2 opsin.

[0012] According to yet another aspect, the present disclosure provides a method of efficient restoration of vision in human. The method include use of MCO that is expressed in retinal cells. In another aspect, the MCO produces a slower depolarizing phase after initial response to a white light that is similar to a photoreceptor-rod signal. In a further aspect, an opsin can be delivered to retinal cells in-vivo by Adeno- Associated Virus (AAV) or a lentivirus administered to the eye of an individual that contains a nucleic acid vector comprising a promoter-MCO-gene, and / or a Pronase E and / or Alpha-Aminoadipic Acid (AAA). In an aspect the AAV and / or lentivirus can be modified or enhanced to increase efficiency to a targeted retinal layer that crosses the thick inner limiting membrane in humans.

[0013] In an aspect of the invention, an individual is administered a virus mediated MCO to treat diverse retinal degenerations in individuals suffering such diseases, including retinal degeneration or dystrophy.

[0014] In another aspect, the present disclosure provides the use of opsin that produces a slower depolarizing phase after an initial response to white light, which is similar to a characteristic photoreceptorrod signal. In an aspect, this results in the restoration of vision in blind individuals.

[0015] In an aspect of the invention, the nucleic acid molecule(s) encode for any of the polypeptides described herein. In another aspect, the nucleic acid molecule(s) is formulated to include a pharmaceutically acceptable carrier.

[0016] In another aspect, a method is provided wherein cells are contacted with or have been transformed with an isolated nucleic acid molecule that encodes for an isolated polypeptide molecule of the invention, including an MCO, and MCO1 and an eMCO1. In an aspect, the cells are rod bipolar cells, ON-type retinal ganglion cells, or ON-type bipolar cells.

[0017] In another aspect, a method is provided to use an opsin to modulate a cell and tissue function, and for use in diagnosis and treatment of retinal disorders.

[0018] In one embodiment, the present invention discloses a recombinant, ambient-light activatable, enhanced, fast Multi-Characteristics Opsin (eMCO1) chimeric protein comprising: an MCO1 protein mutated to modulate at least one of ion selectivity, light sensitivity, or kinetics of the MCO1 protein. In an aspect, the MCO1 protein has SEQ ID NO: 1 , 3, 5, 7, or 1 1 . In one aspect, one or more of the following single or combinations of mutations modulate ion selectivity, light sensitivity, or kinetics, wherein the mutation is selected from at least one of: S to C substitution at an amino acid residue corresponding to amino acid 132 of the MCO1 sequence; E to A substitution at an amino acid residue corresponding to amino acid 123 of the MCO1 sequence; D to A substitution at an amino acid residue corresponding to amino acid 253 of the MCO1 sequence; R to A substitution at an amino acid residue corresponding to amino acid 120 of the MCO1 sequence; Q to A, substitution at an amino acid residue corresponding to amino acid 56 of the MCO1 sequence; K to A substitution at an amino acid residue corresponding to amino acid 93 of the MCO1 sequence; E to A substitution at an amino acid residue corresponding to amino acid 90 of the MCO1 sequence; E to Q substitution at an amino acid residue corresponding to amino acid 90 of the MCO1 sequence; E to A substitution at an amino acid residue corresponding to amino acid 97 of the MCO1 sequence; E to A substitution at an amino acid residue corresponding to amino acid 101 of the MCO1 sequence; N to D substitution at an amino acid residue corresponding to amino acid 258 of the MCO1 sequence; E to T substitution at an amino acid residue corresponding to amino acid 83 of the MCO1 sequence; E to T substitution at an amino acid residue corresponding to amino acid 123 of the MCO1 sequence; or S to D substitution at an amino acid residue corresponding to amino acid 63 of the MCO1 chimeric protein sequence.

[0019] In another aspect, a protein is a recombinant, ambient-light activatable, slow Multi-Characteristics Opsin (MCO2) chimeric protein; wherein 7 amino acid residues (VNKGTGK) from 309 to 315 are deleted in the molecule of claim 1 to improve the gene expression on membrane; wherein S132L mutation is carried out in the trans-membrane domain 2 of SEQ ID NO: 1 to cause increased binding affinity towards retinal and increased light sensitivity; wherein the opsin is encoded in 658 amino acids; and wherein the MCO2- sensitized cell generates a slowly decaying inward current after initial fast current response to a pulse of white light. In one aspect, a single or a combination of mutations is selected from E473A, D603A, R469A of SEQ ID NO:1 that further modulate at least one of the ion selectivity, light sensitivity, or kinetics of the molecule. In another aspect, a trans-membrane sequence(TPARWVWISLYYAAFYVVMTGLFALCIYVLMQTI) is inserted after amino acid residue 315 in MCO1 (SEQ ID NOS:1 or 2) or 308 amino acid residues in MCO2 (SEQ ID NOS:3 or 4).

[0020] In another aspect, a recombinant, ambient-light activatable, fast, enhanced Multi-Characteristics Opsin (eMCO1 ) comprises MCO1 sequence (SEQ ID NO: 1) and a stabilizer-biomarker sequence. In one aspect, the recombinant eMCO1 further comprises at least one of: the stabilizer-biomarker is 900 amino acids of SEQ ID NO: 11 ; the stabilizer-biomarker is connected downstream with the ligand non-4- transmembrane domain by a linking sequence; a light emitted from the stabilizer-biomarker stabilizes eMCO1 expression in a membrane with higher percentage of beta sheets and lower percentage of disordered structure and is less prone to cleavage that a non-modified MCO1 ; the stabilizer-biomarker molecule enhances a photo-induced current in cells expressing eMCO1 by better orientation-stabilization of eMCO1 across a membrane; the stabilizer-biomarker molecule enhances a photo-induced current in cells expressing eMCO1 by light emitted / re-emitted from the stabilizer-biomarker molecule; a promoter is used upstream to eMCO1 to target specific cells; the promoter-eMCOI gene is packaged in a viral vector; cells can be transfected with the promoter-eMCOI gene using chemical, viral, or physical transfection; an examination of eMCO1 containing stabilizer-biomarker expression in retina (by fundoscopy) is an indicator for determining efficacy of gene delivery to targeted tissue(s); a light emitted / re-emitted by the stabilizer- biomarker is monitored used to determine presence of eMCO1 expression; or a loss of expression requires re-delivery of the promoter-eMCOI gene to re-photosensitize / functionalize target cells. In another aspect, the recombinant cMOC1 further comprises a reporter-gene is downstream from the MCO1 gene to detect cellular expression / activation, wherein the promoter-MCOI -reporter gene is packaged in a viral vector; and wherein cells can be transfected by the promoter-MCOI -reporter gene using either chemical, viral or physical method. In another aspect, MCO-sensitized cells are highly sensitive to light and can be activated at low intensity (-0.02 mW / mm2) ambient light. In another aspect, the MCO-sensitized retinal neurons (e.g. retinal ganglion cells, bipolar cells) produces a slower depolarizing phase after initial response to white light similar to a wild-type photoreceptor-rod signal. In another aspect, the opsin is sensitive to any wavelength of light in a visible and a near-infrared range. In another aspect, the opsin is activated by a single-photon including direct, and indirect (e.g., fluorescence, phosphorescence, up / down conversion) illumination light in a visible and a near-infrared range.

[0021] In another aspect, the present invention discloses methods and uses of the MCO1 , MCO2 or eMCO1 , or mutants thereof for restoration of lost vision. In one aspect, the vision loss is due to any degenerative retinal disease; wherein delivery of a recombinant MCO-gene to targeted cells is carried out by an intravitreal / sub-retinal injection of a virus carrying promoter-MCO-gene in an eye, in combination with Pronase E and / or alpha-aminoadipic acid (AAA) for enhancing delivery efficiency, or both; wherein delivery of the MCO-gene is carried out by intravitreal / sub-retinal injection of promotor-MCO-gene plasmids in eye, followed by either chemical, or physical transduction method or a combination thereof; wherein the MCO- gene delivery into eye does not cause either undesired expression in non-targeted cells and organs, or any adverse reaction or cytotoxicity in the treated eye; wherein significant visually guided behavioral improvement is observed after delivery of MCO-gene; or wherein reinjection and transfection of the MCO- gene is carried out in case of deficiency in MCO-gene expression.

[0022] In another aspect, the present invention discloses methods and uses of the MCO1 , MCO2 or eMCO1 for preventing or slowing down the vision loss, wherein the MCO-gene is delivered to retinal cells during progressive photoreceptor loss through transduction, including, through the use of a viral vector, including an AAV or lentivirus; wherein light stimulation of the MCO-sensitized retinal cells is carried out to prevent or slow down the photoreceptor loss; and wherein the light stimulation dose is optimized for maximal efficacy.

[0023] In another aspect, the present invention discloses methods and uses of the MCO1 , MCO2 or eMCOI for restoration of vision by regenerating the damaged RGC axons: wherein the MCO-gene is delivered to retinal ganglion cells through transduction, including, through the use of a viral vector, including an AAV or lentivirus during or after axonal degeneration; wherein light stimulation of the MCO-sensitized RGCs is carried out to slow down the rate of degeneration and / or to regenerate the axons; and wherein the light stimulation dose is optimized for minimizing the degeneration and / or maximizing the axonal regeneration.

[0024] In another aspect, the present invention discloses methods and uses of the MCO1 , MCO2 or eMCO1 for stimulation of different types of excitable cells including neurons, cardiac cells: wherein the use comprises delivery of the MCO-gene by either chemical, viral or physical transduction transformation method; wherein activation of MCO is achieved upon illumination of light; and wherein the effect is measured by electro / opto-physiology.

[0025] In another aspect, the present invention discloses methods and uses of the MCO1 , MCO2 or eMCO1 fortreatment of disorders: wherein the use comprises delivery of the MCO-gene to different organs by either chemical, viral or physical transduction method; wherein activation of MCO is achieved upon illumination of light; and wherein an effect is measured by an electrophysiology or other functional and behavioral analysis.

[0026] In another aspect, the present invention discloses a polypeptide comprising a sequence comprising at least 75%, 85%, 95% or 100% identity to SEQ ID NO: 1 , 3, 5, 7 or 11 , wherein said polypeptide exhibits the photosensitivity characteristics of the protein of at least one of SEQ ID NO: 1 , 3, 5, 7, or 11 .

[0027] In another aspect, the present invention discloses a recombinant nucleic acid encoding a polypeptide having at least 75%, 85%, 95% or 100% identity to SEQ ID NO: 1 , 3, 5, 7 or 11 , wherein said polypeptide exhibits the photosensitivity characteristics of the protein of at least one of SEQ ID NO: 1 , 3, 5, 7 or 11 . In one aspect, the nucleic acid has at least one of 75%, 85%, 95% or 100% identity to SEQ ID NO: 2, 4, 6, or 8. In another embodiment, the invention discloses a vector comprising the nucleic acid having 75%, 85%, 95% or 100% identity to at least one of SEQ ID NO: 1 , 3, 5, 7 or 11 . In one aspect, the vector is selected from an adenovirus, adeno-associated virus or lentivirus vector.

[0028] In another aspect, the present invention discloses a method of treating blindness comprising administering to a patient in need thereof a vector comprising the nucleic acid having 75%, 85%, 95% or 100% identity to at least one of SEQ ID NO: 1 , 3, 5, 7 or 11 .

[0029] In an aspect of the present invention, a light-sensitive ion-channel molecule (expressed in the transmembrane) is used that is capable of capturing blue light, along with a light-sensitive ligand to capture light from a green-red wavelength and a light-emitting enhancer that in an embodiment is located at the C- terminus. In a further aspect of the invention, an eMCO1 results in a fast light induced activity in a target cell at a low light threshold and over a broad spectral range. In another aspect of the invention, a blue light activates the trans-membrane (TM) domain of an eMCO1 and the eMCO1 acts as an ion channel. In a further aspect, red light absorbed by a non-TM, middle domain (non-ion channel) leads to a conformational change of a TM domain of an eMCO1 , which results in an ion flow through the TM-domain of the eMCO1. In an aspect ofthe present invention, following the absorption by an eMCO1 of a green light, the C-terminus domain (RFP) of the eMCO1 emits a red light that results in an enhancement of eMCO1 efficacy.

[0030] In an aspect of the present invention, an enhanced Multi-Characteristic Opsin (eMCO1) is transduced into cells in-vitro or in-vivo and expressed by the transduced cells. In a further aspect the transduced eMCO1 modulates a cellular activity following exposure to different wavelengths of visible light.

[0031] In an aspect of the present invention, a method is provided for delivering (through for example transduction) an eMCO1 to a degenerated retina to restore light sensitivity. In a further aspect of the invention, In a further aspect, an eMCO1 transduced into a retina, and in a further aspect, one or more cells that comprise the retina) is efficiently and stably expressed in vivo. In another aspect, an eMCO1 -reporter protein is administered to a patient through an intravitreal injection of an Adeno-Associated Virus (AAV) that includes a gene that codes for an eMCO1 into the retina. In an aspect of the present invention, the administration of an eMCO1 , including an AAV containing a gene coding for an eMCO1 into the retina of a patient results in the behavioral restoration of vision.

[0032] In an aspect of the present invention, administration of an eMCO1 to a patient, including an AAV containing a gene coding for an eMCO1 into the retina results in the restoration of part of all of the vision of the patient. In an aspect of the present invention, administration of an eMCO1 to a patient, including an AAV containing a gene coding for an eMCO1 into the retina results in results in the arrest of retinal degeneration and disorganization in the retina of the patient. In an aspect of the present invention, administration of an eMCO1 to a patient, including an AAV containing a gene coding for an eMCO1 into the retina results in the arrest of the degeneration and disorganization of an inner nuclear layer of the retina and its connectivity with ganglion cell layer.

[0033] In another aspect, methods are provided for use in treating a patient suffering from a retinal degenerative disease in one or both eyes by administering an eMCO1 (including through administration of an AAV containing the gene coding for an eMCO1 , through an intraocular injection into one eye.

[0034] In an aspect of the present invention, administration of an eMCO1 can be used to treat a retinal dystrophy or a retinal degeneration disease. In a further aspect, a retinal dystrophy or a retinal degeneration disease is characterized by the loss of part of all of the outer retina, including photoreceptor cells and / or retinal pigment epithelium.

[0035] In another aspect of the present invention, administration of eMCO1 can be used to treat macular degeneration diseases such as Stargardt macular degeneration and advanced macular degeneration, wherein degeneration or dysfunction of outer retinal cells including photoreceptor cells occur.

[0036] In another aspect of the present invention, administration of eMCO1 can be used to treat macular degeneration diseases with geographic atrophy or disciform scar, wherein the central portion of the retina (macula) is targeted.

[0037] In yet another aspect of the present invention, administration of eMCO1 can lead to an improvement in the vision function of subjects suffering from macular degenerative diseases.

[0038] In another aspect of the present invention, the eMCO1 treated patients can further increase the quality of vision via virtual reality (VR) headset by enhancing the contrast and / or optical zooming of the visual field.

[0039] In yet another aspect of the present invention, the eMCO1 treated macular degeneration subjects demonstrated an increase in visual acuity.

[0040] In another aspect of the present invention, the eMCO1 treated macular degeneration subjects demonstrated further increase in visual acuity while using the VR headset.BRIEF DESCRIPTION OF THE DRAWINGS

[0041] The following drawings illustrate by way of example and not limitation. For the sake of brevity and clarity, every feature of a given structure is not always labeled in every figure in which that structure appears.

[0042] Tables 1-4 show Amino acid sequences of Multi-Characteristics Opsins (MCOs): MCO1 , MCO2, MCO1T, MCO2T. MCO2 contains mutation (S 132 L) of MCO1 and deletion of 7 amino acid residues 6(VNKGTGK (SEQ ID NO: 13)) after 308. MCO1T and MCO2T contain additional trans-membrane sequence (TPARWVWISLYYAAFYVVMTGLFALCIYVLMQTI (SEQ ID NO: 14)) after 315 and 308 amino acid residues respectively.

[0043] Table-05 shows the DNA sequences of promoter (mGluR6) used upstream of MCO-sequences for targeting specific cells as an example; and Table-06 shows the DNA sequences of reporter (mCherry) used downstream of MCO-sequences for confirming expression in specific cells as an example.

[0044] Table-06 shows DNA sequences of reporter-stabilizer (mCherry) used downstream of MCO- sequences for confirming expression in specific cells as an example.

[0045] Table-07 shows Amino acid and DNA sequences of Enhanced Multi-Characteristics Opsin-1 (eMCO1). It contains MCO1 sequence (Table-01) and biomarker-stabilizer sequence (Table-06).

[0046] Table-08 shows the comparison of stability of the MCO1 and eMCO1 based on secondary structure and folding using theoretical modeling by RaptorX.

[0047] Fig. 1 A illustrates domain architecture of Multi-Characteristics Opsins (MCOs) with reporter protein, which includes eMCO1 . Fig. 1 B shows typical circular map showing the insertion of MCO gene cloned at the restriction sites (BamH I and Sal I).

[0048] Fig. 2 shows Theoretical modeling of the three-dimensional arrangement of amino acid chains of Multi-Characteristics Opsins. Fig. 2A shows the theoretical modeling of the three-dimensional arrangementof amino acid chains of Multi-Characteristics Opsin, MCO 1 . Fig. 2B depicts the theoretical modeling of the three-dimensional arrangement of amino acid chains of Multi-Characteristics Opsin, MCO 2. Fig. 2C shows the theoretical modeling of the three-dimensional arrangement of amino acid chains of Multi-Characteristics Opsin, eMCO1 .

[0049] Figs. 3A and 3 B show expression of eMCO1 in model HEK 293 cells. Fig. 3A shows Expression of eMCO1 is localized in plasma membrane. Confocal fluorescence images of HEK293 cells transfected with mGluR6-MCO1-mCherry (mGluR6-eMCO1), Fig. 3B shows Intensity of MCO1 reporter fluorescence along line across representative cells.

[0050] Figs. 4A and 4B illustrate functioning of enhanced Multi-Characteristics Opsin (eMCO1). Fig. 4A shows inward current profiles in MCO1 -expressing cells in response to light (average intensity: 0.024 mW / mm2). Fig. 4B shows Activation spectrum of eMCO1 . Average ± SEM.

[0051] Figs. 5A and 5B show the effect of eMCO1 (e.g., presence of mCherry on MCO1) function measured by cellular activity. Inward current profiles in HEK cells measured by Port-a-Patch automated Patch clamp electrophysiology. Fig. 5A shows photocurrent measured at white light intensity of 0.02 mW / mm2in cell transfected with mGluR6-eMCO1 (mGluR6-MCO1 -mCherry). Fig. 5B depicts photocurrent measured at white light intensity of 0.02 mW / mm2in cell transfected with mGluR6-MCO1 .

[0052] Figs. 6A and 6B illustrate functioning of Multi-Characteristics Opsin (MCO2). Fig. 6A shows Fluorescence upon lipofection of MCO2-mCherry into HEK293 cells. Fig. 6B shows Inward current in MCO2-expressing cells in response to light (average intensity: 0.024 mW / mm2) measured by Patch-clamp electrophysiology.

[0053] Figs. 7A and 7B illustrate AAV2-carried mGluR6-eMCO1 (vMCO1) transfection of cells. Fig. 7A depicts Three-dimensional reconstruction of eMCO1 expression in HEK 293 cells, scale bar: 30 pm. Fig. 7B shows Three-dimensional reconstruction of eMCO1 expression in Whole retinal cup, scale bar: 0.8 mm.

[0054] Figs. 8A and 8B show the patch-clamp recording of MCO1 transfected retina. Fig. 8A shows eMCO1 expression in the cells of mice retina explant. Fig. 8B shows Inward photocurrent induced by light pulse (100 ms) train.

[0055] Figs.9A -9F shows dose and time dependent layer-specific expression of MCO1 in rd10 mice after vMCO1 injection. Fig. 9A shows Fluorescence confocal image of rd10 mouse retina cup after 1 week of intravitreal vMCO1 injection. Fig. 9B shows Fluorescence confocal image of rd10 mouse retina cup 8 weeks after intravitreal injection of vMCO1. Scale bar: 200 pm. Fig. 9C shows Confocal fluorescence image of folded edge of retinal cup transfected with vMCO1 at dose of 1 .6 x 1011VG / ml. Scale bar: 100 pm. Fig. 9D shows Cross-sectional view of vMCO1 expression in retina 16 weeks after intravitreal injection at dose of 1 .6 x 1012VG / ml. Scale bar: 50 pm. Fig. 9E shows Kinetics of MCO1 expression in rd 10 mice retina at two different doses of vMCO1 . Average! SD. Fig. 9F shows Inter-animal variation of MCO1 -mCherry (eMCO1) expression (after background subtraction) in retina of rd10 mice 16 weeks after transfection at dose of 1 .6 x 1012VG / ml. Average+ SD. * p<0.01 vMCO1 injected vs. non-injected.

[0056] Figs. 10A - 10H show visually guided improvement in rd1O mice behavior in radial water maze. Fig. 10A shows Time-lapse images of visually guided rd10 mice behavior in radial water maze with white LED light before intravitreal vMCO1 injection. Fig. 10B shows Behavior of rd10 mouse with LED light ON six weeks after vMCO1 injection. Fig. 10C shows Latency to find the platform by the vMCO1 treated rd10 mouse, with and without light, dropped at center of the maze. Average ± SEM. N=5 for each mouse. Fig. 10D depicts Latency to find the platform by the vMCO1 treated rd10 mouse, with and without light, dropped at side arms-2 & 4 of the maze. Average ± SEM. N=5 for each mouse. Fig. 10E depicts Latency to find the platform by the vMCO1 treated rd10 mouse, with and without light, dropped at edge arm-3 of the maze. Average ± SEM. N=5 for each mouse. Fig. 10F shows Number of error arms traversed by the vMCO1 treated rd10 mouse dropped at center before finding the platform in presence and absence of light. Average ± SEM. N=5 for each mouse. Fig. 10G shows Number of error arms traversed by the vMCO1 treated rd10 mouse dropped at side arm before finding the platform in presence and absence of light. Average ± SEM. N=5 for each mouse. Fig. 10H shows Number of error arms traversed by the vMCO1 treated rd10 mouse dropped at edge before finding the platform in presence and absence of light. Average ± SEM. N=5 for each mouse.

[0057] Figs. 11 A and 11 B show longitudinal study of visually guided improvement in rd10 mice behavior in radial water maze. Fig. 11A depicts Schematic of the radial-arm water maze used to test improvement in visually guided behavior of vMCO1 injected rd10 mice. Fig. 11 B shows the Time to reach platform by the rd10 mice from center of the maze (light intensity: 0.007 mW / mm2) before vMCO1 injection and as a function of post-injection period. N=5; Average ± S.D. *P < 0.05. Fig. 1 1 C shows the Time to reach platform by the rd10 mice from near arm of the maze (light intensity: 0.014 mW / mm2) before vMCO1 injection and as a function of post-injection period. N=5; Average ± S.D. *P < 0.05. Fig. 11 D plots the Time to reach platform by the rd10 mice from side arm (light intensity: 0.004 mW / mm2) before vMCO1 injection and as a function of post-injection period. N=5; Average ± S.D. *P < 0.05.

[0058] Fig. 12 shows the Light-intensity dependence of improvement in rd10 mice behavior in radial water maze. Comparison of time to reach platform from center of the maze between two different light intensities as a function of post-injection period. Average ± S.D. *P < 0.01 . LOO.0005 mW / mm2; L2 .007 mW / mm2. Bright ambient level is ~ 0.01 mW / mm2.

[0059] Figs. 13A and 13B show optokinetic assessment of rd 10 and MCO-sensitized rd10 mice. Fig. 13A shows Quantitative comparison of number of head movement of rd10 mice before and 8 weeks after vMCO1 injection at speed of rotation of the vertical stripes at 1 rpm. N=4 mice. Average + SD. *p< 0.05. The light intensity at the center of the chamber is 0.001 mW / mm2. Fig. 13B shows Quantitative comparison of number of head movement of rd10 mice before and 8 weeks after vMCO1 injection at speed of rotation of the vertical stripes at 2 rpm. N=4 mice. Average + SD. *p< 0.05. The light intensity at the center of the chamber is 0.001 mW / mm2.

[0060] Figs. 14A - 14D show viability of MCO1 sensitized retinal cells after chronic light exposure. Fig. 14A shows that Similar to the wild-type (non-blind) mice, vMCO1 treated rd10 mice avoid bright light bystaying away and blocking light (via creating a heap out of bedding material, as shown in the arrow). Fig. 14B shows Fluorescence image of retina stained with Caspase-3 (green) for vMCO1 -treated rd10 mouse 4 weeks after 8-hr / day illumination of white light (intensity: 0.1 mW / mm2). Fig. 14C shows Fluorescence image of retina stained with Caspase-3 (green) for wild-type mouse 4 weeks after 8-hr / day illumination of white light (intensity: 0.1 mW / mm2). Fig. 14D shows Quantitative comparison of % apoptotic retinal cells between wild type and vMCO1 treated rd10 mice. 0 % apoptotic cells in inner nuclear layer of vMCO1 treated rd 10 mice.

[0061] Figs. 15A and 15B show results of evaluation of structural integrity of retina after vMCO1 injection in rd10 mice. Fig. 15A shows an OCT image of rd10 mice retina after vMCO1 injection. Fig. 15B shows the Comparison of retinal thickness of 4 different rd10 mice before and 1 week after injection. N=10 B-scans / mice. Average + SD.

[0062] Figs. 16A -16C show results of immune-toxicity in vMCO1 injected rd10 mice. Fig. 16A shows Quantitative comparison of IL-6 (pro-inflammatory marker) in plasma between group-1 (1.6 x 1010VG / ml) and group-2 (1.6 x 1011VG / ml) before and after 7 and 14 days of vMCO1 injection. N=5 mice / group. Average ± SD. Fig. 16B shows Quantitative comparison of IL-10 (anti-inflammatory marker) in plasma between group-1 (1.6 x 101° VG / ml) and group-2 (1.6 x 1011VG / ml) before and after 7 and 14 days of vMCO1 injection. N=5 mice / group. Average ± SD. Fig. 16C shows Quantitative comparison of IFN-Y (pro- inflammatory marker) in plasma between group-1 (1 .6 x 1010VG / ml) and group-2 (1 .6 x 1011VG / ml) before and after 7 and 14 days of vMCOI injection. N=5 mice / group. Average ± SD.

[0063] Fig. 17 shows biodistribution of AAV2 packaged Multi-Characteristics Opsin (vMCO1). QPCR detection of vector sequences in rd10 mice at different doses and post-injection period very small or non- detectable quantities of vector DNA in tissues outside of the treated eyes. N=5 mice / dose / time-point

[0064] Figs. 18A-18F show immunohistochemistry of vMCOI injected rd10 mice eye. Fig. 18A shows that MCO-mCherry (red) is selectively targeted and expressed in INL of rd10 mice 8 wks after intravitreal injection of vMCOI . The absence of arrestin (green) suggests a complete loss of photoreceptors. Fig. 18B shows PKCa stain (green) in rod bipolar cells expressing mCherry (red, intrinsic) in rd10 mice 8 wks after intravitreal injection of vMCO1. Fig. 18C shows mGluR6 stain (green) in ON bipolar cells expressing mCherry (red) in rd10 mice 8 wks after intravitreal injection of vMCOI . Fig. 18D shows mCherry (green- immunostained) expression in rd10 retina 8 wks following intravitreal delivery of vMCOI to rd10 mice. Fig. 18E shows that GFAP (green) in rd10 mice 18 wks after intravitreal injection of vMCO1 as reported in photoreceptor degenerated retina. Fig. 18F shows no CD45 (green) expression suggesting no immune cells in rd10 mice 8 wks after intravitreal injection of vMCOI .

[0065] Fig. 19 illustrates the structure of eMCO1 and activation of its different domains by light. Blue light activates the trans-membrane (TM) domain (ion-channel) of eMCO1 allowing a flow of cations. Green & Red light activates the non-TM, middle domain (non-ion channel).

[0066] Fig. 20A shows the Inward current profile measured at blue (450 nm) light intensity of 0.06 mW / mm2in HEK cell transfected with eMCO1 .

[0067] Fig. 20B shows the inward current profile measured at green (520 nm) light intensity of 0.06 mW / mm2in HEK cell transfected with eMCO1.

[0068] Fig. 20C shows the inward current profile measured at red (630 nm) light intensity of 0.06 mW / mm2in HEK cell transfected with eMCO1 .

[0069] Fig. 20D shows Inward current profile measured at blue (450 nm) light intensity of 0.06 mW / mm2in HEK cell transfected with eMCO1 , in presence of Ca2+chelator (BAPTA).

[0070] Fig. 20E shows the comparison of photocurrent in cells generated by light of different wavelengths and the effect of the presence of Ca2+chelator (BAPTA) on eMCO1 transmembrane-domain function that has been probed by blue (450 nm) light activation. Average ± SEM. Fig. 20F shows the comparison of light activation ON-time generated by blue and green light. Average ± SEM, *p<0.05.

[0071] Fig 21 A shows results of longitudinal monitoring of retina of rd mice with SDOCT before and after different doses of AAV2-eMCO1 or AAV2-vehicle injection. Group AA: 1.0 x 1012VG / ml AAV2-eMCO1 (vMCO1); group BB: 1 ,0 x 1012VG / ml AAV2 (no transgene); and group CC: 1.0 x 1010VG / ml AAV2-eMCO1. Comparison of retinal thickness before, day 1 , month 1 and 4 after injection in different groups and sexes in each group. Average ± SEM.

[0072] Fig. 21 B shows the scattered plot showing comparison of retinal thickness before, and 4 months after injection in different groups. Group AA: 1.0 x 1012VG / ml AAV2-eMCO1 ; group BB: 1 .0 x 1012VG / ml AAV2 (no transgene); and group CC: 1 .0 x 1010VG / ml AAV2-eMCO1 .

[0073] Fig. 21 C shows the mean difference of retina-thickness between baseline and intravitreally-injected mice shown as Gardner-Altman estimation plot. Group AA: 1 .0 x 1012VG / ml AAV2-eMCO1 ; group BB: 1 .0 x 1012VG / ml AAV2 (no eMCO1); and group CC: 1 .0 x 1010VG / ml AAV2-eMCO1 . The curve indicates the resampled distribution of the mean difference, given the observed data. The 95% confidence level of the mean difference is illustrated by the black vertical line. * p< 0.05 in Group BB between Baseline and 4 months after vehicle injection.

[0074] Fig. 22A shows the PKCa stain (green) showing rod bipolar cells expressing mCherry (red, intrinsic) in rd10 mouse after intravitreal injection of AAV2-eMCO1 . ONL: Outer Nuclear layer; INL: Inner Nuclear Layer; GCL: Ganglion Cell Layer.

[0075] Fig. 22B shows eMCO1 (mCherry: red reporter) expression in bipolar cells (INL) of rd10 mouse after intravitreal injection of AAV2-eMCO1.

[0076] Fig. 22C shows the quantification of eMCO1 (reporter mCherry) expression in bipolar cells of three rd10 mice.

[0077] Fig. 22D shows the immunostained cross-sections of the retina showing Bipolar cell terminals (green: PKCa) costoring CtBP (a synaptic ribbon marker, red) in close contact with retinal ganglion cells (RGCs) in the AAV2-eMCO1 treated rd10 mouse retina.

[0078] Fig. 22E shows the images of immunostained cross-sections of the retina showing Bipolar cell terminals (green: PKCa) costoring CtBP (a synaptic ribbon marker, red) in close contact with retinal ganglion cells (RGCs) in the untreated rd10 mouse retina.

[0079] Fig. 22F illustrates stronger PKCa immunostained signal in axonal terminals (*p< 0.05) and CtBP signal is found in the AAV2-eMCO1 treated rd10 mice retina.

[0080] Fig. 23A illustrates the time to reach platform by the Stargardt (ABCA4- / -) mice from side-arms of the radial-arm water maze (light intensity: 0.004 mW / mm2) before and after AAV2 (no transgene, -ve control) injection. N=5; Average ± S.D, ns: Not statistically significant.Fig. 23B shows the time to reach platform by the Stargardt (ABCA4- / -) mice from side-arms of the radialarm water maze (light intensity: 0.004 mW / mm2) before and after AAV2-eMCO1 (vMCO1) injection. N=5; Average ± S.D. ****p < 0.001 .

[0077] Fig. 23C plots the time to reach platform by the Rpe65rd12 (LCA) mice from side-arms of the radialarm water maze (light intensity: 0.004 mW / mm2) before and after AAV2 (no transgene, -ve control) injection. N=5; Average ± S.D, ns: Not statistically significant.

[0078] Fig. 23D shows the time to reach platform by the Rpe65rd12 (LCA) mice from side-arms of the radial-arm water maze (light intensity: 0.004 mW / mm2) before and after AAV2-eMCO1 injection. N=5; Average ± S.D. **p < 0.01 .

[0079] Fig. 24A shows results of longitudinal monitoring of retina of Abca4tm1Ght / JStargardt mice using SDOCT before and after AAV2-eMCO1 injection as compared to control (non-injected group). Comparison of retinal thickness before, Week 4, 12 and 16 after injection. Average ± SEM.

[0080] Fig. 24B shows the measured change in ERG b-wave amplitude (with respect to baseline) at 1 cd. s / m2of Abca4tm1Ght / JStargardt mice after AAV2-eMCO1 injection as compared to control (non-injected group).

[0081] Fig. 24C shows the change in ERG b-wave amplitude (with respect to baseline) at 10 cd. s / m2of Abca4tm1Ght / JStargardt mice after AAV2-eMCO injection as compared to control (non-injected group).

[0082] Fig. 25 illustrates the method of vison restoration via intraocular eMCO1 administration. 100: Retina; 110: Retinal Ganglion cells; 120: Bipolar cells; 130: photoreceptors; 140: Retinal pigment epithelium; 150: Loss of photoreceptors / retinal pigment epithelium; 160: Delivery device; 170: AAV-carried eMCO1 ,; 180: Optic nerve; 190: Optic tract; 200: Optic Chiasm; 210: Transfer of AAV2-carried eMCO1 to contralateral eye; 220: AAV2-eMCO1 Transduced retinal cells; 230: Projected external visual field; 240: Light-activated bipolar cells; 250: Activated retinal ganglion cells; 260: Electro-chemical signal transmitted via optic nerve; 270: Brain for visual processing of light-activated signal received from eMCO1 -sensitized retina.

[0083] Fig. 26A shows eMCO1 gene expression in retina subsequent to intravitreal injection in mice. Reporter (mCherry) fluorescence images of retina cups from mice (N=4) eyes, 6 months after intravitreal injection with 1 pl of 1 E12 vg / ml AAV2-eMCO1 (vMCO1).

[0084] Fig. 26B shows contralateral transfer of eMCO1 gene and expression in retina subsequent to uniocular intravitreal injection in mice. Reporter (mCherry) fluorescence images of retina cups from mice (N=4) eyes, 6 months after intravitreal injection of 1 pl of 1 E12 vg / ml AAV2-eMCO1 (vMCO1). Fig. 26C shows reporter (mCherry) immuno-fluorescence image of retina slice from a dog eye 4 months afteruniocular (right eye) intravitreal injection with 75g I of 2E11 VG / ml vMCO1 . GCL: Ganglion Cell Layer; INL: Inner Nuclear layer; ONL: Outer Nuclear layer.

[0085] Fig. 26D shows evidence of contralateral transfer of eMCO1 gene and expression in retina subsequent to uniocular intravitreal injection in a dog. Immunofluorescence image of eMCO1 reporter (mCherry) in contralateral (left eye) retina. GCL: Ganglion Cell Layer; INL: Inner Nuclear layer; ONL: Outer Nuclear layer. Fig. 26E shows qPCR detection of vMCO1 vector sequences in tissues of visual system of dogs 1 and 2, after uniocular intravitreal injection of right eye with 75 pl of 2E11 VG / ml AAV2-eMCO. Av ± SD.

[0086] Fig. 27A shows the fundus imaging of mCherry (reporter for eMCO1) fluorescence. Fig. 27B shows the fundus imaging of mCherry(reporter) fluorescence showing enhancement in contralateral eye, 8 week after AAV2-eMCO1 injection in Retinitis Pigmentosa patient. Fig. 27C shows results of longitudinal monitoring of retinal thickness in injected and contralateral eyes by OCT imaging after injection of AAV2- eMCO1 in in Retinitis Pigmentosa patient. N=1 1 , Av ± SD.X31 weeks data is missing patients 2-4, and 7- 9 due to COVID-related lockdown;xx52 weeks data does not include patient 8, who did not travel due to COVID-situation.

[0087] Fig. 28 shows results of longitudinal monitoring of Visual Acuity (LogMAR) in AAV2-eMCO1 injected (3.5E11 vg) and contralateral eyes of patients with severe retinal degeneration. Mean ± SEM (N=8).

[0088] Fig. 29A and 29B show improved visually-guided behavior in mice with opsin-sensitized retinal ganglion cells being stimulated by a strobe light of frequency ~ 0.5Hz. Fig. 29A shows the Schematic of Visually-guided Y-mobility assay to evaluate vision in mice. +Light: Light ON; -Light: Light OFF. Fig. 29B shows the Number of events (finding Light ON vs. OFF) by mice for different conditions. Baseline: No optic nerve crush; ON crush: Optic nerve crush; After Light Stimulation: 2 weeks after (8 hours / day) 0.5 Hz strobe light stimulation of opsin-sensitized retinal ganglion cells in optic nerve crush mice.

[0089] Fig 30A shows longitudinal improvement in an eMCO1 treated subject for visual acuity letter score measured using ETDRS eye chart.

[0090] Fig 30B shows longitudinal improvement in an eMCO1 treated subject with VR headset (with 100% contrast and 3X zoom) for visual acuity letter score measured using ETDRS eye chart.DETAILED DESCRIPTION OF THE INVENTION

[0091] Modulation of cellular activities by electrical and other means has enabled quantitative evaluation of cellular characteristics and changes associated with disease progression. Opsins (light-sensitive ionchannel proteins) or ligands in combination with light have been used for modulation of cellular activity and can be used for different therapeutic applications including vision restoration, as well as for drug screening.

[0092] Since higher order neurons are still intact in degenerated retina, several stimulation methods target the higher order neurons, e.g. Bipolar cells and retinal Ganglion cells, which carry the visual information to the visual cortex. While direct electrical stimulation approaches require mechanical contact of electrodes to the retinal cells, indirect stimulation approaches such as optogenetic stimulation does not necessitate suchphysical contact. Thus, the indirect methods provide clear advantage of being non-intrusive. In addition, cellular specificity and high (single cell) resolution can be achieved while using optogenetic stimulation.

[0093] In order to achieve optogenetic stimulation of retinal neurons, the cells are generally transfected by a virus to express opsin (light-sensitive molecular ion-channel and ligand as well as enhancer), which is then activated. The opsin depolarizes the opsin-expressing cells following illumination by light of a specific visible wavelength. For example, retinal cells expressing Channelrhodopsin-2 (ChR2) are sensitive to blue light.

[0094] Various light-activated ion channels (opsins) and ligands have been developed to either enhance photosensitivity of cells, or to be activated by different wavelengths of visible light. In order to be activated by broadband visible light, complex of three opsins (ChR2 for blue, C1V1 for green, and ReaChR for red photosensitivity) has been delivered to cells by chemical or physical method. However, such large complexes cannot be packaged into commonly used viral vectors (i.e. Adeno-Associated Virus). Further, use of a chemical or physical method for delivery is less efficient and / or compromises cell viability, thus limiting their ready usefulness.

[0095] The opsins developed and utilized to date for vision restoration, when stimulated by light, do not produce a characteristic photoreceptor-rod signal, i.e., the voltage signal does not have a slower depolarizing phase after an initial fast response. The present invention provides for an effective optogenetic vision restoration at a low light level.

[0096] The present invention provides for vision restoration by optogenetics, protein administration or gene therapy methods by delivering an opsin or other genes, through methods that include viral means (e.g. recombinant adeno-associated virus, rAAV), and where the administration is into the vitreous of the eye.

[0097] In an embodiment, the present disclosure comprises an ability to produce characteristic photoreceptor-rod signal that do not require an external active stimulation device. This embodiment avoids obstacles that are associated with or encountered by existing opsin-based approaches. In an embodiment, the present invention provides for the restoration of an individual’s vision that is lost due to a retinal degenerative disease. Further advantage of the present invention is that the method of delivering opsin / other therapeutic gene include a combination of rAAV and chemical agent that can transiently permeabilize the inner limiting membrane of the human eye.

[0098] The present invention highlights the unique structure of eMCO leading to fast light induced activity of cells at low light threshold and over a broad spectral range. The blue light activates the trans-membrane (TM) domain of eMCO1 that in an embodiment acts as an ion channel. In a further embodiment a red light absorbed by the non-TM, middle domain (non-ion channel) leads to a conformational change of an eMCO1 - TM domain, which in turn leads to an ion flow via the eMCO1 TM-domain. In another embodiment, absorption of a green light by a C-terminus domain (RFP) results in the emission of a red light that enhances the eMCO1 efficacy.

[0099] In another embodiment, the present invention provides for the expression of an enhanced MultiCharacteristic Opsin (eMCO1) in cells in-vitro or in-vivo, as well as methods for modulating cellular activities by different wavelengths of visible light.

[0100] Currently, use of optogenetic sensitization of retinal cells combined with activation / inhibition has allowed the possibility of replacing the retinal implants, eliminating the requirement of placing electrodes near every single neuron for high resolution (4). Optogenetic stimulation provides high temporal precision (5-10) by introducing light-activatable molecular channels (e.g. channelrhodopsin-2, ChR2; halorhodopsin, NpHR) into cells by genetic targeting. In addition to higher temporal and spatial resolution, optogenetics has several advantages over electrical stimulation such as cellular specificity (e.g. spared cones, ganglion or bipolar cells) and minimal invasiveness (11). Light-induced activation of ChR2, a non-selective cation channel, results in depolarization of only those cells that express ChR2. Selective activation of neurons by ms-pulsed blue light has been demonstrated in culture (9), brain slices, as well as in small animals (12-15). This optogenetic activation method is very promising for controlling cellular activities in-vitro as well as in- vivo as it only requires light of moderate intensity (~ 0.1 mW / mm2) that can be delivered from a light emitting diode (LED) or laser (5, 6).

[0101] The present disclosure provides several light-sensitive ion-channel and ligand molecules (MultiCharacteristics Opsins) made by synthetic means: (i) having high photosensitivity at multiple visible wavelengths, (ii) with plasmid size small enough to be packaged into safe Adeno Associated Virus. The invention also includes isolated nucleic acid sequences that encode light-sensitive ion-channels and ligands of the invention, and constructs that comprise such nucleic acid sequences. In some embodiments MCOs that find use the methods disclosed herein comprise amino acids as shown in Tables 1-4, 7 and as represented by SEQ ID NOS: 1 , 3, 5, 7, or 11 . In some embodiments the MCO has at least around 70, or 75, or 80, or 85 or 90 or 95, or 96 or 97, or 98 or 99% identity with a sequence as shown in SEQ ID NOS:I , 3, 5, 7, or 11 , wherein said MCO has the photosensitivity characteristics of SEQ ID NOS: 1 , 3, 5, 7, orI I . In some embodiments, the MCO is encoded by a nucleic acid as shown in Tables 1-4, 7 and as represented by SEQ ID NOS: 2, 4, 6, 8, or 12. In some embodiments the nucleic acids encoding the MCO have at least around 70, or 75, or 80, or 85, or 90, or 95, or 96, or 97, or 98 or 99% identity with a sequence as shown in SEQ ID NOS: 2, 4, 6, 8, or 12, wherein said encoded MCO has the photosensitivity characteristics of SEQ ID NOS: 1 , 3, 5, 7, or 11 .

[0102] The nucleic acids encoding the MCO find use when incorporated into vectors for delivery to a patient in need thereof. In some embodiments the vectors are plasmids with appropriate promoters as is known in the art. In some embodiments the vectors are viral vectors. Viral vectors that find use in the methods disclosed herein include adenovirus vectors, adeno-associated virus vectors, and the like.

[0103] The invention in some aspects includes expression of Multi-Characteristics Opsins (MCOs) in cells in-vitro or in-vivo as well as methods for modulating cellular activities by these synthetic opsins.

[0104] One of the examples where MCO is used for treatment of disease is blindness caused by retinal degenerative diseases. Retinitis Pigmentosa (RP) and age-related macular degeneration (AMD) refer todisorders characterized by degeneration of photoreceptors in the eye, which hinders visual ability by nonfunctional neuronal activation and transmission of signals to the visual cortex (16-20). While AMD is the leading cause of new vision loss in ~15 million persons older than 65 years of age (21), the prevalence of RP is at least one million individuals world-wide (22, 23). RP is most often inherited as an autosomal recessive trait with large number of cases having this form of inheritance (18, 22, 24). Further, the degree of visual loss increases with ageing (25) and this is a major concern for our demographic changes towards elderly population.

[0105] Most of the current clinical treatments are primarily focused on slowing down the progression of the disease (26), as there is neither a cure that can stop the degeneration (27) nor a therapy, other than retinal prostheses, that can restore vision lost due to the degeneration (28). Partial restoration of vision involves invasive surgical procedure for retinal implants (29). Two different types of retinal implants are being developed: subretinal and epiretinal implants (30). The subretinal implants are positioned in the area of the retina where the photoreceptor cells reside, between the pigmented epithelium and the bipolar cells (31). These retinal prostheses have been successful in generating visual perception in blind subjects (32- 34). The disadvantages of using such subretinal implants include (i) chronic damage of the implanted electrodes, and (ii) insufficient current produced by microphotodiode from the ambient light to stimulate adjacent neurons (35, 36). The epiretinal implants are placed in the area of the retinal ganglion cells (RGCs) and the device functions by stimulating the RGCs in response to input obtained from a camera that is placed outside of the eye or within an intraocular lens (36, 37). The disadvantages of epiretinal implants include (i) cellular outgrowth due to surgical implantation, and (ii) disordered stimulation pattern resulting from the electrical stimulation of both the axons and cell bodies of the RGCs (36). Besides being invasive in nature, these methods for restoration of vision in blind patients are based on non-specific cellular activation and have low spatial resolution due to low number of electrodes (higher number or density of electrodes requires more power, leading to damage of neural tissue by heat), and hence able to improve vision with low spatial resolution.

[0106] Optogenetic method has been employed for vision restoration in blind mice model either by nonspecific stimulation of retina (38) or in a promoter-specific manner including Thy1 for RGCs (39-43), mGluR6 targeting ON bipolar cells (44, 45). Attempts have also been made for stimulation of RGCs by use of melanopsin (46) or photochemical genetics (47). Further, use of active light stimulation of chloride- channel opsin (Halorhodopsin) expressing in longer-persisting cone photoreceptors (48) has shown new promise for therapeutic intervention for restoration of vision (49). The re-sensitized photoreceptors have shown to drive retinal circuitry functions, activate cortical circuits, and mediate visually guided behaviors.

[0107] The earlier approaches for restoration of vision by optogenetic stimulation of retinal cells use opsins such as ChR2 (38) and others, which requires light intensities order of magnitude higher than ambient lighting conditions. Therefore, clinical success of such opsin molecules in ambient environment for vision restoration is not yet achieved. Further, use of external light source or device (e.g. LED array (50)) to activate such opsins can substantially damage the retinal cells in long-term usage. In addition, these opsins(used for vision restoration) have fast (millisecond) ON and OFF response to light pulses, i.e., when stimulated by light the opsin-sensitized cells do not produce characteristic photoreceptor-rod signal, i.e., the voltage signal do not have slower depolarizing phase after initial fast response to light pulse. Therefore, effective optogenetic vision restoration at ambient light level has not been shown until the present invention.

[0108] The disclosed invention includes methods of preparation of extremely- light sensitive ion-channels and ligands as well as different uses including vision restoration. In some aspect, expression of a specific MCO in cell produces a long-lasting inward current in response to white light similar to characteristic photoreceptor-rod signal. According to another aspect of the invention, the disclosed invention provides method for the use of synthetic opsins for vision restoration and other applications, wherein the amino acid sequence of the synthetic opsin is modified to provide enhanced light sensitivity, kinetics and ion-selectivity.

[0109] The results presented in this invention show efficient and stable in-vivo expression of MCO-reporter protein in mice retina after intravitreal injection of Adeno-Associated Virus carrying MCO. The results also demonstrated that the expression of MCO in retina of mouse model of retinal degeneration enables behavioral restoration of vision. The number of error arms and time to reach platform in a radial-arm water maze significantly reduced after delivery of MCO to the mice having degenerated retina. Notably, the improvement in visually guided behavior was observed even at light intensity levels orders of magnitude lowerthan that required for Channelrhodopsin-2 opsin (1). According to yet another aspect of the invention, method of efficient restoration of vision in human is provided. The method include use of MCO which when expressed in retinal cells produces a slower depolarizing phase after initial response to white light similar to characteristic photoreceptor-rod signal, and delivery of the opsin to retinal cells in-vivo by Adeno- Associated Virus (AAV) carrying promoter-MCO-gene in eye, and / or in combination with pronaseE or Alpha-Aminoadipic Acid (AAA) for enhancing delivery efficiency to targeted retinal layer crossing the thick inner limiting membrane in humans.

[0110] In an embodiment, a method is provided to administer an eMCO1 to a degenerated retina to restore light sensitivity in a patient. In another embodiment, administration of an eMCO1 to a patient suffering from a retinal degeneration or a retinal dystrophy, including through an intravitreal injection an Adeno-Associated Virus that includes a gene that codes for an eMCO1 , results in the efficient expression of the eMCO1 gene and the production of the eMCO1 protein. In another embodiment, the invention comprises a method wherein the administration of an eMCO1 to a retinal degenerated eye of a patient results in a long-term improvement in a retinal function and a visual behavior compared to a patient who is not administered an eMCO1 into a retinal degenerated eye. In another embodiment, administration of an eMCO1 into the retina of a patient reverses the retinal degeneration (including as measured by Stargardt and LCA) and results in the behavioral restoration of vision.

[0111] In yet another embodiment, the invention describes a method wherein the administration of eMCO1 to a retinal degenerated eye results in the arrest of a retinal degeneration or retinal dystrophy. In another embodiment, the invention describes a method wherein the administration of eMCO1 to a retinal degenerated eye results in the arrest or slowing down of a disorganization of an inner nuclear layer and itsconnectivity with ganglion cell layer. In a further embodiment, administration of an eMCO1 to a patient to one eye results in the expression of the eMCO1 in the other eye of the patient. In an embodiment of the present invention, administration of an eMCO1 to a patient to one eye results in the expression in noninjected eye and the arrest of a retinal degeneration or a retinal dystrophy and the maintenance of retinal thickness in the non-injected eye.

[0112] The present invention provides an approach to treat a retinal dystrophy or a retinal degeneration that is characterized by loss / mutation of outer retina including photoreceptors and / or retinal pigment epithelium.

[0113] In another embodiment, administration of an eMCO1 (including through administration of an AAV that includes the gene for the eMCO1) into one eye of a patent results in expression of the eMCO1 in the other eye of the patient, which results in in long term improved retinal function and visual behavior in the non-injected eye of the patient as compared to a patient who did not receive an administration of an eMCO1. In another embodiment, an eMCO1 administered into one eye of a patient is only expressed in the other eye of the patient.

[0114] In yet another embodiment, following administration of an eMCO1 into a patient, the patient has improved visual function and behavior. The administration of an eMCO1 results in improved visual function and behavior regardless of the retinal dystrophy or retinal degeneration.

[0115] In an embodiment, administration of an eMCO1 to a patient results in a restoration of vision and arresting of the symptoms associated with the progression of a retinal dystrophy or a retinal degeneration.

[0116] In a further embodiment, an enhanced multi-characteristic opsin (eMCO1) is administered to a patient suffering from a neurodegeneration. In an embodiment, an eMCO1 is administered to a patient to modulate retinal cellular activities.

[0117] In an embodiment, a method to administer an eMCO1 , including an AAV containing a gene coding for an eMCO1 is through the use of a device that is capable of injecting the eMCO1 (protein alone or an AAV) through one or more of intraocularly, intravitreally or intraretinally.

[0118] In another aspect of the present invention, administration of an eMCO1 treats macular degenerative diseases such as Stargardt macular degeneration and advanced macular degeneration, wherein degeneration or dysfunction of outer retinal cells including photoreceptor cells occur.

[0119] In another embodiment, administration of an eMCO1 treats macular degeneration diseases wherein the central portion of the retina (macula) is targeted, enabling expression of the eMCO1 in higher order neurons of retina.

[0120] In yet another embodiment of the present invention, administration of an eMCO1 leads to an improvement in the vision function of patients suffering from macular degenerative diseases.

[0121] In another embodiment, an eMCO1 treated subject experiences increase in the quality of vision through the use of a virtual reality (VR) headset. The VR headset enhances the contrast and / or optical zooming of the visual field to enhance a patient’s improvement following treatment with the eMCO1 .

[0122] In another embodiment of the present invention, an eMCO1 treated macular degeneration subject demonstrates an increase in visual acuity.

[0123] In another embodiment, the eMCO1 treated macular degeneration subject demonstrates further increase in visual acuity while using a VR headset.

[0124] In a further embodiment, the VR headset has a variable magnification of 1X, 2X, 3X, 4X, 5X, 6X, 7X, 8X, 9X, 10X, 11X, 12X, 13X, 14X, 15X, 16X, 17X, 18X zoom. In another embodiment, the VR headset has a 1 ,5X, 2.5X, 3.5X, 4.5X, 5.5X, 6.5X, 7.5X, 8.5X, 9.5X, 10.5X, 11.5X, 12.5X, 13.5X, 14.5X, 15.5X, 16.5X, 17.5X, 18.5X zoom. In another embodiment, the VR headset has an about 1X, about 2X, about 3X, about 4X, about 5X, about 6X, about 7X, about 8X, about 9X, about 10X, about 11X, about 12X, about 13X, about 14X, about 15X, about 16X, about 17X, about 18X zoom. In another embodiment, the VR headset has an at least 1X, at least 1 .5X, at least 2X, at least 2.5X, at least 3X, at least 3.5X, at least 4X, at least 4.5X, at least 5X, at least 5.5X, at least 6X, at least 6.5X, at least 7X, at least 7.5X, at least 8X, at least 8.5X, at least 9X, at least 9.5X, at least 10X, at least 10.5X, at least 11X, at least 11.5X, at least 12X, at least 12.5X, at least 13X, at least 13.5X, at least 14X, at least 14.5X, at least 15X, at least 15.5X, at least 16X, at least 16.5X, at least 17X, at least 17.5X, at least 18X zoom. In another embodiment, the VR headset has no more than 1X, no more than 1 ,5X, no more than 2X, no more than 2.5X, no more than 3X, no more than 3.5X, no more than 4X, no more than 4.5X, no more than 5X, no more than 5.5X, no more than 6X, no more than 6.5X, no more than 7X, no more than 7.5X, no more than 8X, no more than 8.5X, no more than 9X, no more than 9.5X, no more than 10X, no more than 10.5X, no more than 11X, no more than 11 .5X, no more than 12X, no more than 12.5X, no more than 13X, no more than 13.5X, no more than 14X, no more than 14.5X, no more than 15X, no more than 15.5X, no more than 16X, no more than 16.5X, no more than 17X, no more than 17.5X, no more than 18X zoom.

[0125] In another embodiment, the VR headset has a 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 100% contrast. In another embodiment, the VR headset has an about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90% or about 95% contrast. In another embodiment, the VR headset has an at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90% or at least 95% contrast. In another embodiment, the VR headset has a no more than 20%, no more than 25%, no more than 30%, no more than 35%, no more than 40%, no more than 45%, no more than 50%, no more than 55%, no more than 60%, no more than 65%, no more than 70%, no more than 75%, no more than 80%, no more than 85%, no more than 90% or no more than 95% contrast.

[0126] In a further embodiment, the VR headset has different contrast options: Normal View, Black on White, or White on Black.

[0127] The visual acuity letter score was measured using an ETDRS eye chart presented to the patient at a distance of 10 cm, 20 cm, 30 cm, 40 cm, 50 cm, 60 cm, 70 cm, 80 cm, 90 cm, 100 cm or more. Thevisual acuity letter score was measured using an ETDRS eye chart presented to the patient at a distance of at least 10 cm, at least 20 cm, at least 30 cm, at least 40 cm, at least 50 cm, at least 60 cm, at least 70 cm, at least 80 cm, at least 90 cm, at least 100 cm or more. The visual acuity letter score was measured using an ETDRS eye chart presented to the patient at a distance of no more than 10 cm, no more than 20 cm, no more than 30 cm, no more than 40 cm, no more than 50 cm, no more than 60 cm, no more than 70 cm, no more than 80 cm, no more than 90 cm, no more than 100 cm or more. The visual acuity letter score was measured using an ETDRS eye chart presented to the patient at a distance of about 10 cm, about 20 cm, about 30 cm, about 40 cm, about 50 cm, about 60 cm, about 70 cm, about 80 cm, about 90 cm, about 100 cm or more.

[0128] When the VR headset was used, the gain in the letter score after eMCO1 injection was enhanced by 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50 or more letters at 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50 weeks.

[0129] When the VR headset was used with a 3X zoom (and 100% contrast), the gain in the letter score after eMCO1 injection was further enhanced to about 30 letters at 24 weeks.EXAMPLES

[0130] Example 1 -Fig. 1A illustrates domain architecture of Multi-Characteristics Opsins (MCOs) with reporter protein. These MCOs were synthesized using A typical circular map with insertion of MCO gene cloned at the restriction sites is shown in Fig. 1 B. The MCO genes were synthesized using DNA synthesizer and sequence was verified. Gel electrophoresis was carried out on amplified MCO1 gene (digested by restriction enzymes BamH I and Sal I with restriction fragments) using 0.8% agarose. Western blot was performed to confirm that the MCO is expressed in retinal cells. Retinas of mice were transfected using lipofectamine and expressed protein was extracted for western blot. Western blot was developed using primary (anti-mCherry polyclonal) antibody and secondary (Goat anti-Rabbit IgG) antibody with 1-step NBT / BCIP substrate.

[0131] Example 2 -Fig. 2 shows Theoretical modeling of the three-dimensional arrangement of amino acid chains of Multi-Characteristics Opsins using web-based protocol (RaptorX). The RaptorX uses a conditional neural fields (CNF), a variant of conditional random fields and multiple template treating procedure to develop the following predicted structure of MCO. Fig. 2A shows the theoretical modeling of the three- dimensional arrangement of amino acid chains of Multi-Characteristics Opsin, MCO 1. Fig. 2B depicts the theoretical modeling of the three-dimensional arrangement of amino acid chains of Multi-Characteristics Opsin, MCO 2. Fig. 2C shows the theoretical modeling of the three-dimensional arrangement of amino acid chains of Multi-Characteristics Opsin, eMCO1. The expression of the gene and functioning of the MCO1 and eMCO1 was investigated. The eMCO1 was found to fold / express in membrane better, and therefore, function effectively as compared to MCO1. In the eMCO1 design, a special element between MCO1 and mCherry was placed, thus increasing the interaction between the MCO1 gene and mCherry, which makesmCherry play an active role in stabilizing the whole therapeutic molecule (eMCO1) in the membrane. Table- 08 shows higher percentage of beta sheets and lower percentage of disordered structure (i.e. less prone to cleavage) in eMCO1 as compared to MCO1 . Further, the presence of mCherry in eMCO1 serves as an indicator for determining efficacy of gene delivery to targeted tissue(s), and to determine presence of the opsin at different time points. In case of loss of opsin expression, re-injection of the opsin-gene for rephotosensitization of targeted cells can thus be carried out. For example, if visual ability is reduced or lost with time after initial improvement (by vMCO-1 injection), examination of mCherry expression in retina (by fundoscopy) will serve as a biomarker to determine if the vMCO-1 expression is lost (requiring reinjection). If the mCherry expression is intact (but the improvement in vision is lost / degraded), it will imply that the targeted retinal cells have lost connection with retinal ganglion cells, which carry visual information to visual cortex.

[0132] Example 3- For evaluating membrane trafficking of MCOs, the expression of MCOs in cell membrane (vs. cytoplasm) of transfected HEK293 cells was quantified using fluorescence intensity of reporter protein (mCherry). HEK293 cells were transfected with MCO constructs using lipofectamine 3000 (Life Technologies). After transfection, the HEK293 cells were maintained in DMEM / F-12 with 10% fetal bovine serum, 0.2 mg / mL Gentamycin in Petri dishes. The cultures were maintained at 37°C in a 5% CO2 humidified atmosphere. Cells were incubated for 48 hours after transfection to allow MCO expression. Visualization of the reporter (mCherry) fluorescence was carried out under epifluorescence microscope. The fluorescence images of HEK293 cells expressing eMCO1 (MCO1 -mCherry) and MCO2-mCherry are shown in Fig. 3A and Fig.6A respectively. Further, to quantify the relative expression of the eMCO1 in cell membrane and intracellular components, intensity profiles are plotted. Fig. 3B shows the Intensity of eMCO1 reporter fluorescence along line across representative HEK293 cells transfected with mGluR6- MCO1- eMCO1 (mGluR6-mCherry). No significant intracellular (cytoplasmic) aggregation was observed implying effective trafficking of MCOs to the plasma membrane.

[0133] Example 4- To determine the light dependent inward photocurrent, the MCOs-expressing cells were exposed to pulses of light with intensity of 0.024 mW / mm2. A single mode optical fiber coupled to a supercontinuum laser source (NKT Photonics) delivered the broadband light to the sample for optogenetic stimulation. A power meter (818-SL, Newport) was used to quantify the light intensity at the sample plane. The light pulse width was synchronized with the electrophysiology recording system, controlled by Axon Instruments Digidata system (Molecular Devices). Cells, transfected with MCOs were incubated with all- trans retinal (ATR, 1 pM) for 4 hours before conducting the patch clamp experiments.

[0134] The patch-clamp recording setup includes an inverted Nikon fluorescence microscope (TS 100) platform using an amplifier system (Axon Multiclamp 700B, Molecular Devices). Micropipettes were pulled using a two-stage pipette puller (Narshinghe) to attain resistance of 3 to 5 MQ when filled with a solution containing (in mM) 130 K-Gluoconate, 7 KCI, 2 NaCI, 1 MgCb, 0.4 EGTA, 10 HEPES, 2 ATP-Mg, 0.3 GTP- Tris and 20 sucrose. The micropipette-electrode was mounted on a micromanipulator. The extracellular solution contained (in mM): 150 NaCI, 10 Glucose, 5 KCI, 2 CaCb, 1 MgCb was buffered with 10 mMHEPES (pH 7.3). Photocurrents were measured while holding cells in voltage clamp at -70 mV. The electrophysiological signals from the amplifier were digitized using Digidata 1440 (Molecular devices), interfaced with patch-clamp software (Clampex, Molecular Devices). For activation of MCO expressing cells, the light stimulation beam was delivered by the optical fiber. pCIamp 10 software was used for data analysis. Fig.4A shows representative inward current in MCO1 -expressing cells in response to light (average intensity: 0.024 mW / mm2) measured by Patch-clamp electrophysiology. The inward photocurrent was found to be order of magnitude higher in eMCO1 sensitized cells than that in the ChR2 expressing cells. Inward photocurrent (195 ± 32 pA) in eMCO1 -sensitized cells at ambient light level (0.02 mW / mm2) is above threshold for action potential (AP) unlike that in cells sensitized with ChR2 and White-Opsin(51). It may be noted that for a good fidelity of the light-evoked spiking of opsin-sensitized cells, faster response time is required. The ON response time of ambient-light activatable MCO1 (Fig. 4A) is measured to be 2.94 ± 0.70 ms, which is similar to that measured for other fast-opsins (52). However, the on response time depends on the intensity of activation light and is known to increase as the light intensity decreases (53).

[0135] To obtain the activation spectrum of eMCO1 , the inward photocurrent was measured using stimulation light at different wavelengths (with bandwidth: 30 nm). In Fig. 4B, we show the normalized activation spectrum of eMCO1. In addition to acting as stabilizer-biomarker, mCherry enhances the photoinduced current in the cells expressing eMCO1 by (i) better orientation-stabilization of eMCO1 across the membrane; and (ii) light emitted / re-emitted from the stabilizer-biomarker molecule enhance the activation of eMCO1. Fig.5 shows Inward current profiles in HEK cells measured by Nanion Port-a-Patch automated Patch clamp electrophysiology. Fig. 5A shows photocurrent measured at white light intensity of 0.02 mW / mm2in cell transfected with mGluR6-eMCO1 (mGluR6-MCO1 -mCherry). Fig. 5B depicts photocurrent measured at white light intensity of 0.02 mW / mm2in cell transfected with mGluR6-MCO1 . The effect of presence of mCherry on enhanced MCO1 function is clearly demonstrated here. MCO1 was found to have broad activation spectrum matching to the white ambient light.

[0136] The inward photocurrent in MCO2-expressing cells in response to light at the same average intensity (0.024 mW / mm2) is shown in Fig.6B. The peak photocurrent generated in eMCO1 -cells at light intensity of 0.024 mW / mm2was -160 pA as compared to -320 pA in MCO2 expressing cells. While the on- rate of induced photocurrent in eMCO1 and MCO2 expressing cells in response to light did not differ significantly, the off-response (decay of current in absence of light) of MCO2 was found to be significantly slower than eMCO1 (Fig. 6B vs. Fig. 4A). In MCO2 expressing HEK293 cells, the threshold peak current for generating action potential (54) could be achieved at light intensity of 0.02 mW / mm2, which is at the ambient light level. Therefore, ambient light is expected to generate sufficient photocurrent (for action potential) in MCO expressing retinal cells. Fig. 8 shows the patch-clamp recording of MCO1 transfected rd mouse retina. Fig. 8A shows eMCO-1 expression in the cells of mice retina explant. Fig. 8B shows Inward photocurrent induced by light pulse (100 ms) train. The spectral and intensity sensitivity combined with the fast kinetics and small size (allowing packaging by AAV) of eMCO1 makes it uniquely suitable forphotosensitizing higher-order retinal neurons in subjects with retinal degeneration to enable vision restoration in ambient light environment.

[0137] Example 5 - MCO1 and MCO2 plasmids were packaged in Adeno-associated virus (serotype 2) with mGluR6 promoter and mCherry reporter. The synthesized plasmids were cloned into pAAV MCS vector via its BamH1 and Sall sites. AAV physical titers were obtained by quantitative PCR using primers designed to selectively bind AAV inverted terminal repeats. TCID50 assay was conducted according to ATCC protocol. Verification of purity of purified virus was confirmed by SDS / PAGE. Fig. 7A illustrates fluorescence image of HEK293 cells expressing mCherry, 2 days after transfection with AAV2-mGluR6- MCO1 -mCherry. Robust expression was observed with no detectable change in morphology, confirm that transfected cells are healthy. For in-vivo transfection of rd10 mice, intravitreal injection of 1 l of AAV2- mGluR6-MCO1 -mCherry (vMCO1), was carried out for targeted expression in ON bipolar cells. Uniformity of MCO expression was confirmed by the 3D reconstruction from the confocal mCherry-expression in z- slices of the whole retinal cup oirdlO mice injected with vMCO1 intravitreally (Fig. 7B).

[0138] Example 6- The rd10 mice (retinal degeneration 10, spontaneous missense point mutation in Pde6b) have a later onset and progressive retinal degeneration, closer to the human retinal degeneration phenotype. After anesthetization of the rd10 mice, AAV2-mGluR6-MCO1 -mCherry (1 pl) solution (1.6 x 1012GC / ml) was injected by a sterilized needle of a Hamilton syringe inserted through the sclera into the vitreous cavity. The AAV2-mGluR6-MCO1 -mCherry solution was injected to both the eyes. The cornea was kept moist with a balanced salt solution during the entire surgical procedure. In-vivo transfection of vMCO1 in rd10 mouse retina was carried out for four different final doses of vMCO1. At different time points after vMCO1 injection, the mice in each group were euthanized and retina tissues harvested. Confocal fluorescence microscopy was carried out for analysis of eMCOI expression in retina. To evaluate retention of the MCO, the reporter fluorescence expression level (fluorescence intensity) of transfected retina was evaluated using confocal microscope. At different time points after vMCO1 injection, the mice were sacrificed and retina was extracted and imaged by confocal microscopy. The vMCO1 -transfected rd10 mice retina showed distinct expression of reporter (mCherry) on cell membrane in targeted cell layer. In contrast to significant expression in vMCO1 -injected eyes, no characteristic mCherry expression (only background autofluorescence) was observed in PBS injected eyes monitored up to 16 weeks. Further, no significant increase in mCherry expression (only background autofluorescence) was observed 1 wk after injection for three different vMCO1 doses. eMCO1 expression was significantly higher at 4-8 wk after intravitreal injection of vMCO1 (Fig. 9B). In-vivo viral transfection was conducted for delivery of the eMCO1 to the bipolar cells in the retina of the rd10 mouse model. eMCO1 expression was found to be localized in targeted retinal cells (Fig. 9C). Fig. 9D shows cross-sectional view of eMCOI expression in retina 16 weeks after intravitreal injection at dose of 1 .6 x 1012VG / ml. Furthermore, expression level was significant even after 4 months of injection. Fig. 9E shows kinetics of MCO1 expression in rd10 mice retina at two different doses of vMCO1. Fig. 9F shows the inter-animal variation of MCO1 -mCherry (eMCO1) expression (afterbackground subtraction) in retina of rd10 mice 16 weeks after transfection of vMCO1 at dose of 1.6 x 1012VG / ml.

[0139] Example 7- For testing spatial memory and learning capabilities of vMCO treated rd10 mice towards light, a visual radial arm water maze was used (55). Briefly, mice are placed into the center of the maze and a platform is placed just below the water’s surface at the end of one of the arms. The mice rapidly learn to determine the location of the platform by utilizing visual cues (LEDs emitting light with visible spectrum). The platform (in one of the arms) provided a reward to them where they can rest instead of having to swim. The time to reach platform and number of error(s) made before finding the platform was quantified for both light On and off conditions. Data (video) recording was stopped once the mice find the platform or before 60 sec of dropping the mice in water in order to prevent the mice from getting tired of swimming. The selection of dropping site (center, side, edge) was random for each mice and each trial. The exclusion criterion consists of mouse that does not swim (and floats). Visual acuity in this test was determined by measuring the latency to reach the platform, and the number of errors the mouse makes before reaching the platform as the quality of the visual stimulus (cue) degrades. At ~10 wks after birth, the rd10 mice were intravitreally injected with vMCO targeting the bipolar cells. The platform provides a reward where mice can rest instead of having to swim. Intravitreal injection of virus carrying vMCO1 led to significant improvement in visually guided behavior of rd10 mice as assessed by radial-arm water maze assay. At ~8 weeks after birth, the rd10 mice, were intravitreally injected with MCO1 targeted to bipolar cells in retina. Fig. 10 shows visually guided improvement in rd10 mice behavior in radial water maze. Fig. 10A shows Time-lapse images of visually guided rd10 mice behavior in radial water maze with white LED light before intravitreal vMCO1 injection. Fig. 10B shows Behavior of rd10 mouse with LED light ON six weeks after vMCO1 injection. The distances and time traveled by the MCO-transfected rd10 mice before arriving at the platform were much shorter than the rd10 mice. Fig. 10C shows Latency to find the platform by the vMCO1 treated rd10 mouse, with and without light, dropped at center of the maze. Average ± SEM. N=5 for each mouse. Fig. 10D depicts Latency to find the platform by the vMCO1 treated rd10 mouse, with and without light, dropped at side arms-2 & 4 of the maze. Fig. 10E depicts the latency to find the platform by the vMCO1 treated rd10 mouse, with and without light, dropped at edge arm-3 of the maze. In consistence with the latency to find the platform, the number of errors made by the MCO-transfected rd10 mice before they reached the platform is significantly smaller (<1) than that of the mice without transfection (>2) (56). Fig. 10F shows the number of error arms traversed by the vMCO1 treated rd10 mouse dropped at center before finding the platform in presence and absence of light. Fig. 10G shows Number of error arms traversed by the vMCO1 treated rd10 mouse dropped at side arm before finding the platform in presence and absence of light. Average ± SEM. N=5 for each mouse. Fig. 10H shows Number of error arms traversed by the vMCO1 treated rd10 mouse dropped at edge before finding the platform in presence and absence of light. Average ± SEM. N=5 for each mouse.

[0140] Fig. 11 shows longitudinal study of visually guided improvement in rd10 mice behavior in radial water maze. We collected data to determine visual acuity at baseline (previral transfection) and over time(every 4 wks for 4 months). Fig. 11A depicts Schematic of the radial-arm water maze used to test improvement in visually guided behavior of vMCO1 injected rd1 O mice. 4 wks after injection, all mice significantly restored their visually guided behavior that lasted through the 16 wks trial. The number of errors made by the MCO-transfected rd10 mice before they reached the platform is significantly smaller (<1) than that of the mice without transfection (>2) (56). In consistence with the number of error arms, the distances and time traveled by the MCO-transfected mice before arriving at the platform were much shorter than the rd10 mice (n=5 for both groups). Fig. 11 B shows the Time to reach platform by the rd10 mice from center of the maze (light intensity: 0.007 mW / mm2) before vMCO1 injection and as a function of post-injection period. N=5; Average ± S.D. *P < 0.05. Fig. 11 C shows the Time to reach platform by the rd10 mice from near arm of the maze (light intensity: 0.014 mW / mm2) before vMCO1 injection and as a function of postinjection period. N=5; Average ± S.D. *P < 0.05. Fig. 11 D plots the Time to reach platform by the rd 10 mice from side arm (light intensity: 0.004 mW / mm2) before vMCO1 injection and as a function of post-injection period. N=5; Average ± S.D. *P < 0.05.

[0141] Most importantly, the MCO-treated rd10 mice, when randomly placed in five different arms of the radial water maze in a single sequence, they could find the platform (in 6tharm) from all the other arms without a single error. Furthermore, the MCO treated rd10 mice performed better in visually guided tasks even at low light intensities (0.005-0.01 mW / mm2), comparable to ambient light levels. To determine the light intensity-dependence of improvement of behavior for the vMCO1-treated mice, the intensity of the diverging LED light was varied from 0.0005 to 0.03 mW / mm2. The mean time taken by vMCO1 -treated rd10 mice to reach the platform was <20 sec, at ambient light intensity level of 0.007 mW / mm2. The behavioral scores were correlated with the light intensities and threshold for improvement in visually guided behavior was determined to be 0.004 mW / mm2. Fig. 12 shows the Light-intensity dependence of improvement in rd10 mice behavior in radial water maze. Comparison of time to reach platform from center of the maze between two different light intensities as a function of post-injection period. This is the first-time opsin- treated mice could perform significantly better at such low light levels. Earlier behavioral studies using ChR2-treated mice have utilized much higher light intensities, not suitable for practical application of optogenetics in vision restoration without use of active illumination sources. Example 8- Because measurement of the optomotor response is commonly used to determine thresholds of the visual system in humans and animals (57, 58), we utilized this tool for evaluating improvement in visual performance of rd10 mice with MCO sensitized retinas. The advantage of this method is that it does not require any previous training of the animal. Briefly, rd10 mouse was placed on a platform (in the center of a drum) surrounded by rotating stripes (Fig. 10). The optokinetic stimulation with varying speed was applied and average optomotor response and the score of the mice was measured. Fig. 13 shows optomotor assessment of rd10 and MCO-sensitized rd10 mice. Fig. 13A shows Quantitative comparison of number of head movement of rd10 mice before and 8 weeks after vMCO1 injection at speed of rotation of the vertical stripes (0.07 cpd) at 1 rpm. The light intensity at the center of the chamber is 0.001 mW / mm2. Fig. 13B shows Quantitative comparison of number of head movement of rd10 mice before and 8 weeks after vMCO1injection at speed of rotation of the vertical stripes at 2 rpm. The light intensity at the center of the chamber is 0.001 mW / mm2. Even at this low light intensity, the MCO-treated mice rotated its head in response to rotating stripes implying improved spatial visual acuity.

[0142] Example 9-Similar to the wild-type (non-blind) mice, vMCO treated rd10 mice were observed to avoid bright light by staying away and blocking light (Fig.14).

[0143] Example 10- Chronic exposure of opsin transfected retinal cells to light may raise concern about their viability. Therefore, to evaluate any detrimental effect of light exposure on retinal cell viability, wild type and MCO-injected rd10 mice were exposed to white light with intensity (i.e. 0.1 mW / mm2) ~10 times higher than that of ambient light level (~ 0.01 mW / mm2) for 4 weeks (8 hr / day). 4 weeks after light exposure, the MCO transfected rd10 as well as wild-type (control) mice were sacrificed, and the retina tissue was harvested for immuno-histochemical analysis. The retina was immunostained with apoptotic markers and imaged using confocal microscopy. Fig. 14 shows viability of eMCO1 sensitized retinal cells after chronic light exposure. Fig. 14A shows that Similar to the wild-type (non-blind) mice, vMCO1 treated rd10 mice avoid bright light by staying away and blocking light (via creating a heap out of bedding material, as shown in the arrow). Fig. 14B shows Fluorescence image of retina stained with Caspase-3 (green) for vMCO1- treated rd10 mouse 4 weeks after 8-hr / day illumination of white light (intensity: 0.1 mW / mm2). Fig. 14C shows Fluorescence image of retina stained with Caspase-3 (green) for wild-type mouse 4 weeks after 8- hr / day illumination of white light (intensity: 0.1 mW / mm2). Quantitative comparison (Fig. 14D) shows that there is no significant cell death in either of the wild type or MCO-injected rd10 mice, indicating no compromise of cell viability under chronic light exposure. 0 % apoptotic cells in inner nuclear layer of vMCO1 treated rd10 mice. Furthermore, since light-sensitivity of MCO expressing cells significantly reduces the required light intensity for generating action potential, use of MCO will minimize light-induced chronic damage to the retinal cells.

[0144] Example 11- Optical sectioning / imaging using SDOCT was carried out to monitor any changes in ocular structure due to intravitreal injection of vMCO1 . SDOCT images of cornea, lens, and retina 1wk after intravitreal vMCO injection in rd10 mice were compared to the images before injection. Fig. 15 shows results of evaluation of structural integrity of retina after vMCO1 injection in rd10 mice. Fig. 15A shows an OCT image of rd10 mice retina after vMCO1 injection. Fig. 15B shows the Comparison of retinal thickness of 4 different rd10 mice before and 1 week after injection. No detectable alteration to cornea, lens or retina (e.g. detachment) was observed after intravitreal injection of vMCO1. Imaged was used to analyze the SDOCT images. Quantitative comparison of retinal thickness before and 1 wk after vMCO1 injection (Fig. 15D) shows no change in retinal thickness.

[0145] Example 12-Though gene therapy has been controversial for the last decade due to undesired side effects (59, 60), opsins (e.g. ChR2) are reported to be non-toxic, not generate immune response, and maintain stable cell membrane properties. Therefore, the health of the mice was monitored to confirm the safety of our approach. For immunotoxicity studies, blood was drawn from mice (N=5 / dose) before and after intravitreal injection of two different doses (Group 1 : 1.66 x 101°, Group 2: 1 .66 x 1011GC / ml) of vMCOat 7 and 14 days. After anesthetization, blood (~0.2 ml) is drawn from facial vein (using sterile animal lancet) 1 week before intravitreal injection. After vMCO1 injection, blood was drawn (Table 6.1) for analysis. After the completion of the study period, the mouse was euthanized. For collecting the blood from the facial vein of the mice, the hairless freckle on the side of the jaw was located and pricked with a lancet. The pro- inflammatory (IL-6 and IFN-y) and anti-inflammatory (IL-10) cytokines in plasma were quantified using ELISA kits. Fig. 16 summarizes the results of the ELISA quantification of inflammatory cytokines showing that the intravitreal dose of vMCO is within safe limit. Fig. 16A shows quantitative comparison of IL-6 (pro- inflammatory marker) in plasma between group-1 and group-2 before and after 7 and 14 days of vMCO1 injection. Fig. 16B shows the quantitative comparison of IL-10 (anti-inflammatory marker) in plasma between the two groups. Fig. 16C shows the quantitative comparison of IFN-Y (pro-inflammatory marker) in plasma between the two groups before and after 7 and 14 days of vMCO1 injection.

[0146] Example 13-After monitoring behavioral restoration of vision by intravitreal injection of MCO, the mice were sacrificed and different organs were collected for analyzing the spread of MCO expression in non-targeted tissues samples (eye, heart, liver, muscle, skin, etc). The organs were stored in the 1 .8 ml cryovials and stored at -80 °C. Each vial was properly labeled with study number, animal identification number, date of extraction, and name of organ. qPCR detection of vector sequences in rd10 mice at different time points post-injection shows very small quantities of MCO-1 DNA in tissues outside of the treated eyes, confirming safety of our molecule and treatment method. Intravitreal administration of vMCOI in eye led to locally restricted distribution, minimizing off-target effects. Fig. 17 shows biodistribution of AAV2 packaged enhanced Multi-Characteristics Opsin (vMCO1). At a fixed time point after injection (1 week), the measured vector copy number in eye was found to decrease with decrease in injected dose. Further, 4-8 week after injection, very small or non-detectable quantities of vector DNA in the injected eyes was found. The Biodistribution studies showed minimal or non-detectable levels of the vector in nontargeted organs of intravitreally-injected rd10 mice. qPCR detection of vector sequences in rd10 mice at different doses and post-injection period very small or non-detectable quantities of vector DNA in tissues outside of the treated eyes. The biodistribution profile and the kinetics of transgene expression following administration of vMCOI via the intravitreal administration at multiple time points coincide with the onset of detection, peak vector / transgene levels, and decline / plateau of these levels.

[0147] Example 14- To further evaluate the safety, specificity and efficacy of our opsins, immunohistochemistry of vMCO1 injected rd10 retina was conducted. Fig. 18 shows immunohistochemistry of retinal sections ofvMCOI injected rd10 mice eye. Fig. 18A shows that MCO-mCherry (red) is selectively targeted and expressed in inner nuclear layer (INL) of rd10 mice 8 wks after intravitreal injection of vMCOI . The absence of arrestin (green) suggests a complete loss of photoreceptors. Fig. 18B shows PKCa stain (green) in rod bipolar cells expressing mCherry (red, intrinsic) in rd10 mice 8 wks after intravitreal injection of vMCO1 . Fig. 18C shows mGluR6 stain (green) in ON bipolar cells expressing mCherry (red) in rd10 mice 8 wks after intravitreal injection of vMCO1 . Fig. 18D shows mCherry (green-immunostained) expression in rd10 retina 8 wks following intravitreal delivery of vMCOI to rd10 mice. Fig. 18E shows that GFAP (green)in rd10 mice 18 wks after intravitreal injection of vMCO1 as reported in photoreceptor degenerated retina. Fig. 18F shows no CD45 (green) expression suggesting no immune cells in rd 10 mice 8 wks after intravitreal injection of vMCO1 .

[0148] The invention provides a method of improving or restoring vision, comprising administering to a subject any one of the compositions described herein. Compositions of methods of the invented enhanced MCO (eMCO) may be delivered and packaged in the plasmid or viral vectors that includes: (i) MCO Plasmid, (ii) rAAV-MCO, (iii) pAAV-MCO and (iii) Lenti Virus-MCO. Invention delivery is improvised by use of optimized formulation of AAA together with this invention molecule-MCO (naked plasmid or virus) to transiently permeabilize inner limiting membrane of retina.

[0149] Table-01 : Amino acid and DNA sequences of Multi-Characteristics Opsin-1 (MCO1)

[0150] Amino acid sequence:MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAAGFSILLLMF YAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLRYAEWLLTCPVISIHLSNLTG LSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGYHTVPKGRCRQ VVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIR KTTKLNIGGTEIEVETLVEDESEAGSVNKGTGKMAELISSATRSLFAAGGINPWPNPYHHEDMGCGGMTP TGECFSTEVWVCDPSYGLSDAGYGYCFVEATGGYLVVGVEKKQAWLHSRGTPGEKIGAQVCQWIAFSIAI ALLTFYGFSAWKATCGWEEVYVCCVEVLFVTLEIFKEFSSPATVYLSTGNHAYCLRYFEWLLSCPVILIRLS NLSGLKNDYSKRTMGLIVSCVGMIVFGMAAGLATDWLKWLLYIVSCIYGGYMYFQAAKCYVEANHSVPK GHCRMVVKLMAYAYFASWGSYPILWAVGPEGLLKLSPYANSIGHSICEIIAKEFWTFLAHHLRIKIHEHILIH GDIRKTTKMEIGGEEVEVEEFVEEEDEDTV (SEQ ID NO:1)

[0151] DNA sequence:ATGGATTATGGCGGCGCGCTGAGCGCGGTGGGCCGCGAACTGCTGTTTGTGACCAACCCGGTGGT GGTGAACGGCAGCGTGCTGGTGCCGGAAGATCAGTGCTATTGCGCGGGCTGGATTGAAAGCCGCG GCACCAACGGCGCGCAGACCGCGAGCAACGTGCTGCAGTGGCTGGCGGCGGGCTTTAGCATTCTG CTGCTGATGTTTTATGCGTATCAGACCTGGAAAAGCACCTGCGGCTGGGAAGAAATTTATGTGTGCG CGATTGAAATGGTGAAAGTGATTCTGGAATTTTTTTTTGAATTTAAAAACCCGAGCATGCTGTATCTG GCGACCGGCCATCGCGTGCAGTGGCTGCGCTATGCGGAATGGCTGCTGACCTGCCCGGTGATTAG CATTCATCTGAGCAACCTGACCGGCCTGAGCAACGATTATAGCCGCCGCACCATGGGCCTGCTGGT GAGCGATATTGGCACCATTGTGTGGGGCGCGACCAGCGCGATGGCGACCGGCTATGTGAAAGTGA TTTTTTTTTGCCTGGGCCTGTGCTATGGCGCGAACACCTTTTTTCATGCGGCGAAAGCGTATATTGAA GGCTATCATACCGTGCCGAAAGGCCGCTGCCGCCAGGTGGTGACCGGCATGGCGTGGCTGTTTTTT GTGAGCTGGGGCATGTTTCCGATTCTGTTTATTCTGGGCCCGGAAGGCTTTGGCGTGCTGAGCGTG TATGGCAGCACCGTGGGCCATACCATTATTGATCTGATGAGCAAAAACTGCTGGGGCCTGCTGGGC CATTATCTGCGCGTGCTGATTCATGAACATATTCTGATTCATGGCGATATTCGCAAAACCACCAAACT GAACATTGGCGGCACCGAAATTGAAGTGGAAACCCTGGTGGAAGATGAATCGGAAGCGGGCTCGGT GAACAAAGGCACCGGCAAAATGGCTGAGCTGATCAGCAGCGCCACCAGATCTCTGTTTGCCGCCGGAGGCATCAACCCTTGGCCTAACCCCTACCACCACGAGGACATGGGCTGTGGAGGAATGACACCTAC AGGCGAGTGCTTCAGCACCGAGTGGTGGTGTGACCCTTCTTACGGACTGAGCGACGCCGGATACG GATATTGCTTCGTGGAGGCCACAGGCGGCTACCTGGTCGTGGGAGTGGAGAAGAAGCAGGCTTGG CTGCACAGCAGAGGCACACCAGGAGAAAAGATCGGCGCCCAGGTCTGCCAGTGGATTGCTTTCAGC ATCGCCATCGCCCTGCTGACATTCTACGGCTTCAGCGCCTGGAAGGCCACTTGCGGTTGGGAGGAG GTCTACGTCTGTTGCGTCGAGGTGCTGTTCGTGACCCTGGAGATCTTCAAGGAGTTCAGCAGCCCC GCCACAGTGTACCTGTCTACCGGCAACCACGCCTATTGCCTGCGCTACTTCGAGTGGCTGCTGTCTT GCCCCGTGATCCTGATCAGACTGAGCAACCTGAGCGGCCTGAAGAACGACTACAGCAAGCGGACCA TGGGCCTGATCGTGTCTTGCGTGGGAATGATCGTGTTCGGCATGGCCGCAGGACTGGCTACCGATT GGCTCAAGTGGCTGCTGTATATCGTGTCTTGCATCTACGGCGGCTACATGTACTTCCAGGCCGCCAA GTGCTACGTGGAAGCCAACCACAGCGTGCCTAAAGGCCATTGCCGCATGGTCGTGAAGCTGATGGC CTACGCTTACTTCGCCTCTTGGGGCAGCTACCCAATCCTCTGGGCAGTGGGACCAGAAGGACTGCT GAAGCTGAGCCCTTACGCCAACAGCATCGGCCACAGCATCTGCGAGATCATCGCCAAGGAGTTTTG GACCTTCCTGGCCCACCACCTGAGGATCAAGATCCACGAGCACATCCTGATCCACGGCGACATCCG GAAGACCACCAAGATGGAGATCGGAGGCGAGGAGGTGGAAGTGGAAGAGTTCGTGGAGGAGGAGG ACGAGGACACAGTG (SEQ ID NO:2)

[0152] Table-02: Amino acid and DNA sequences of Multi-Characteristics Opsin-2 (MCO2). It contains mutation (S 142 L) and deletion of 7 amino acid residues (VNKGTGK) after 308 of MCO1 sequence (TABLE-01).

[0153] Amino acid sequence:MDYGGALSAVGRELLFVTNPVWNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAAGFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLRYAEWLLTCPVILIHLSNLTG LSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGYHTVPKGRCRQ VVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIR KTTKLNIGGTEIEVETLVEDESEAGSMAELISSATRSLFAAGGINPWPNPYHHEDMGCGGMTPTGECFST EWWCDPSYGLSDAGYGYCFVEATGGYLVVGVEKKQAWLHSRGTPGEKIGAQVCQWIAFSIAIALLTFYG FSAWKATCGWEEVYVCCVEVLFVTLEIFKEFSSPATVYLSTGNHAYCLRYFEWLLSCPVILIRLSNLSGLK NDYSKRTMGLIVSCVGMIVFGMAAGLATDWLKWLLYIVSCIYGGYMYFQAAKCYVEANHSVPKGHCRMV VKLMAYAYFASWGSYPILWAVGPEGLLKLSPYANSIGHSICEIIAKEFWTFLAHHLRIKIHEHILIHGDIRKTT KMEIGGEEVEVEEFVEEEDEDTV (SEQ ID NO:3)

[0154] Nucleotide sequence:ATGGACTATGGCGGAGCATTGAGTGCAGTTGGGCGAGAATTGCTGTTCGTGACGAATCCCGTTGTT GTAAACGGAAGTGTACTGGTGCCAGAAGACCAATGTTATTGCGCGGGCTGGATAGAGTCGCGCGGA ACGAATGGAGCACAGACAGCGTCCAACGTACTGCAATGGCTCGCCGCTGGTTTCTCTATCCTGTTGT TGATGTTCTACGCATATCAAACGTGGAAAAGCACCTGCGGGTGGGAGGAAATATATGTGTGTGCCAT CGAGATGGTAAAAGTAATTTTAGAGTTTTTTTTTGAATTCAAGAACCCCTCAATGTTGTACCTTGCTAC GGGGCATAGAGTTCAATGGCTTCGGTATGCGGAATGGCTCTTGACATGTCCAGTAATACTAATTCATCTTAGTAACTTAACGGGACTCTCTAACGACTATTCACGGCGTACCATGGGACTACTGGTGTCAGACA TTGGGACGATAGTATGGGGAGCGACGAGCGCAATGGCTACAGGCTACGTAAAGGTTATCTTTTTCTG CCTCGGGCTTTGTTACGGCGCGAATACCTTCTTTCATGCCGCAAAGGCCTACATAGAGGGTTACCAT ACCGTACCGAAAGGGCGGTGCCGGCAAGTCGTCACAGGAATGGCTTGGCTCTTCTTTGTGAGTTGG GGAATGTTCCCTATCCTATTTATCTTAGGGCCTGAGGGTTTCGGCGTGCTTAGTGTTTACGGCAGTA CGGTCGGTCACACGATCATCGACCTGATGTCAAAGAATTGCTGGGGCTTGCTTGGTCATTATTTGCG TGTGTTAATCCACGAACATATTCTGATTCATGGTGACATCCGAAAAACTACCAAACTCAATATTGGCG GCACAGAGATAGAGGTTGAAACGTTGGTCGAGGACGAGTCTGAAGCGGGGTCAATGGCGGAACTAA TTTCATCTGCAACACGGTCGCTATTTGCTGCCGGGGGGATAAATCCCTGGCCCAACCCGTATCACCA CGAAGATATGGGATGCGGAGGGATGACTCCCACAGGAGAGTGTTTTTCGACCGAATGGTGGTGTGA CCCCTCGTACGGGTTATCAGATGCAGGCTATGGTTATTGTTTCGTGGAGGCCACGGGTGGTTATTTA GTCGTAGGGGTAGAGAAGAAACAGGCATGGCTTCATTCCCGGGGAACCCCCGGGGAGAAAATTGG AGCTCAGGTATGCCAGTGGATAGCGTTTTCTATCGCGATAGCTCTCCTGACTTTTTATGGATTTTCGG CTTGGAAGGCCACGTGCGGATGGGAAGAGGTATACGTATGTTGCGTCGAAGTGCTTTTCGTAACTCT GGAAATATTTAAAGAATTCTCAAGTCCGGCCACAGTTTATTTGAGCACTGGCAACCACGCCTATTGTT TGCGGTATTTTGAGTGGCTATTATCTTGCCCTGTTATTCTTATACGGTTATCAAACCTATCGGGTCTG AAGAATGATTATTCCAAGAGAACCATGGGCCTAATTGTCAGTTGCGTCGGGATGATCGTGTTCGGGA TGGCCGCGGGTCTTGCAACGGACTGGCTTAAGTGGCTATTATACATCGTCAGCTGCATTTACGGTGG TTACATGTACTTTCAAGCGGCTAAGTGCTATGTGGAGGCGAACCATTCAGTCCCGAAAGGCCACTGT CGCATGGTGGTTAAGTTAATGGCGTATGCGTACTTCGCTTCGTGGGGTTCATATCCAATCCTGTGGG CGGTCGGACCTGAAGGTCTCCTGAAACTGAGCCCCTATGCGAACTCCATAGGACATTCCATCTGTGA GATCATCGCCAAGGAATTCTGGACCTTCTTAGCTCACCATTTGCGGATTAAGATCCATGAACACATTC TCATTCACGGTGATATTAGGAAAACTACCAAGATGGAGATAGGTGGAGAAGAGGTGGAGGTAGAAG AGTTTGTAGAAGAGGAGGACGAGGACACTGTAGTATCAAAGGGGGAAGAAGACAAT (SEQ ID NO:4) Table-03: Amino acid and DNA sequences of Multi-Characteristics Opsin-1T (MCO1T). It contains additional trans-membrane sequence (TPARWVWISLYYAAFYVVMTGLFALCIYVLMQTI) after 315 amino acid residues of MCO1 (TABLE-01).

[0155] Amino acid sequence:MDYGGALSAVGRELLFVTNPWVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAAGFSILLLMF YAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLRYAEWLLTCPVISIHLSNLTG LSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGYHTVPKGRCRQ VVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIR KTTKLNIGGTEIEVETLVEDESEAGSVNKGTGKTPARWVWISLYYAAFYVVMTGLFALCIYVLMQTIMAELI SSATRSLFAAGGINPWPNPYHHEDMGCGGMTPTGECFSTEWWCDPSYGLSDAGYGYCFVEATGGYLV VGVEKKQAWLHSRGTPGEKIGAQVCQWIAFSIAIALLTFYGFSAWKATCGWEEVYVCCVEVLFVTLEIFKE FSSPATVYLSTGNHAYCLRYFEWLLSCPVILIRLSNLSGLKNDYSKRTMGLIVSCVGMIVFGMAAGLATDW LKWLLYIVSCIYGGYMYFQAAKCYVEANHSVPKGHCRMVVKLMAYAYFASWGSYPILWAVGPEGLLKLSPYANSIGHSICEIIAKEFWTFLAHHLRIKIHEHILIHGDIRKTTKMEIGGEEVEVEEFVEEEDEDTV (SEQ ID NO:5)

[0156] Nucleotide sequenceATGGATTACGGAGGAGCACTGAGCGCTGTTGGCCGCGAGTTGCTATTTGTGACCAACCCCGTCGTGGTCAATGGCAGCGTCCTTGTGCCTGAGGATCAATGTTATTGCGCTGGGTGGATTGAATCCCGAGGTACAAATGGTGCCCAGACGGCAAGCAACGTTTTGCAATGGCTAGCAGCTGGGTTTTCAATTCTACTTTTAATGTTTTACGCTTATCAAACCTGGAAGAGTACATGTGGCTGGGAGGAAATTTATGTCTGCGCTATTGAAATGGTTAAAGTAATTTTGGAATTTTTTTTTGAATTTAAGAATCCATCAATGTTGTATCTTGCCACAGGTCACAGGGTCCAATGGCTCCGATACGCGGAATGGCTTCTAACTTGCCCTGTTATTTCCATTCACCTAAGCAATCTGACTGGCCTTTCGAATGACTATAGCAGACGCACCATGGGACTGTTAGTTAGTGACATAGGGACTATAGTTTGGGGTGCCACTAGCGCCATGGCGACCGGTTATGTTAAAGTAATTTTTTTCTGCCTTGGGTTGTGTTATGGCGCTAACACTTTTTTCCACGCTGCTAAAGCATATATAGAAGGGTACCATACGGTGCCCAAAGGAAGATGTCGCCAAGTAGTTACAGGGATGGCGTGGCTGTTCTTTGTGAGCTGGGGGATGTTCCCTATACTGTTTATCCTTGGTCCAGAGGGTTTTGGAGTCCTAAGCGTGTACGGCAGTACTGTTGGGCATACTATAATAGATTTGATGAGCAAAAACTGCTGGGGGCTTCTCGGGCATTATTTACGAGTTCTTATTCACGAACATATTTTAATTCATGGGGATATCAGAAAAACAACGAAACTAAATATAGGAGGCACGGAAATAGAGGTTGAAACGCTCGTCGAAGACGAATCAGAGGCCGGCTCCGTGAATAAGGGAACTGGTAAAACTCCTGCTCGCTGGGTATGGATATCGCTTTACTACGCAGCATTTTACGTAGTTATGACTGGGCTTTTTGCTTTGTGCATATACGTGCTAATGCAGACGATTATGGCTGAGCTAATTTCATCTGCAACTAGATCCCTTTTCGCGGCAGGAGGGATCAACCCCTGGCCCAATCCATATCATCATGAAGATATGGGCTGTGGCGGTATGACCCCAACTGGTGAGTGCTTTTCTACCGAATGGTGGTGTGATCCGAGTTACGGTCTGTCAGATGCTGGGTATGGTTATTGCTTTGTCGAAGCCACGGGGGGATACCTTGTCGTCGGAGTAGAGAAAAAACAGGCCTGGCTCCATTCCCGGGGGACCCCAGGAGAGAAGATAGGGGCCCAAGTTTGCCAGTGGATCGCATTTAGTATTGCGATCGCATTACTGACATTCTATGGTTTCTCAGCGTGGAAGGCAACCTGCGGCTGGGAGGAGGTTTACGTATGCTGTGTTGAGGTACTGTTCGTAACCCTTGAGATTTTCAAAGAGTTTTCTTCTCCGGCGACGGTCTATCTCAGTACCGGTAACCATGCATATTGTTTACGTTATTTCGAATGGTTGCTTTCTTGCCCAGTGATTTTGATACGCTTGAGTAATTTATCTGGCCTAAAGAACGACTATAGCAAGCGAACCATGGGACTTATTGTATCTTGTGTTGGCATGATAGTTTTTGGTATGGCAGCCGGGCTCGCCACTGACTGGCTGAAGTGGTTGCTCTATATAGTGAGCTGTATTTATGGTGGCTACATGTACTTTCAGGCGGCCAAGTGTTACGTTGAAGCAAACCATTCGGTACCTAAAGGACATTGCCGTATGGTAGTTAAGCTGATGGCGTATGCGTACTTCGCGAGCTGGGGCAGCTACCCCATTCTGTGGGCGGTGGGACCAGAGGGGTTACTTAAGTTGTCGCCCTATGCTAATTCAATAGGCCATAGCATCTGTGAGATTATCGCGAAGGAATTTTGGACTTTCCTAGCACATCACCTTCGAATTAAAATACACGAACACATACTCATTCACGGGGACATACGCAAGACAACCAAGATGGAAATCGGAGGTGAGGAAGTGGAAGTAGAGGAGTTTGTAGAGGAGGAAGATGAGGACACGGTT (SEQ ID NO:6)

[0157] Table-04: Amino acid and DNA sequences of Multi-Characteristics Opsin-2T (MCO2T). It contains additional trans-membrane sequence (TPARVWWISLYYAAFYVVMTGLFALCIYVLMQTI) after 308 amino acid residues of MCO2 (TABLE-02).

[0158] Amino acid sequence:MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAAGFSILLLMF YAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLRYAEWLLTCPVILIHLSNLTG LSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGYHTVPKGRCRQ VVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIR KTTKLNIGGTEIEVETLVEDESEAGSPARWVWISLYYAAFYVVMTGLFALCIYVLMQTIMAELISSATRSLFA AGGINPWPNPYHHEDMGCGGMTPTGECFSTEWWCDPSYGLSDAGYGYCFVEATGGYLVVGVEKKQA WLHSRGTPGEKIGAQVCQWIAFSIAIALLTFYGFSAWKATCGWEEVYVCCVEVLFVTLEIFKEFSSPATVY LSTGNHAYCLRYFEWLLSCPVILIRLSNLSGLKNDYSKRTMGLIVSCVGMIVFGMAAGLATDWLKWLLYIV SCIYGGYMYFQAAKCYVEANHSVPKGHCRMVVKLMAYAYFASWGSYPILWAVGPEGLLKLSPYANSIGH SICEIIAKEFWTFLAHHLRIKIHEHILIHGDIRKTTKMEIGGEEVEVEEFVEEEDEDTV (SEQ ID NO:7)

[0159] Nucleotide Sequence:ATGGACTATGGAGGAGCACTGTCAGCCGTTGGGAGAGAGTTGTTGTTTGTTACCAATCCTGTAGTAG TCAATGGCAGTGTGCTTGTACCAGAGGATCAATGCTACTGTGCCGGGTGGATAGAGTCCCGGGGAA CCAACGGGGCACAAACTGCGAGTAACGTTCTGCAATGGCTAGCAGCAGGCTTTAGCATACTGCTACT AATGTTCTATGCTTACCAAACATGGAAGTCGACTTGCGGGTGGGAGGAGATATACGTCTGCGCAATT GAAATGGTCAAGGTTATTCTCGAGTTCTTCTTCGAATTCAAAAACCCATCAATGTTATACTTAGCGACA GGACATCGAGTCCAGTGGTTACGTTACGCCGAGTGGCTCCTGACGTGCCCGGTAATTTTAATCCACC TCTCTAATTTGACCGGACTTTCCAATGATTACAGTCGAAGAACTATGGGGCTATTAGTCTCTGACATC GGGACTATTGTCTGGGGTGCGACTAGCGCTATGGCTACCGGGTATGTAAAAGTCATCTTCTTCTGTT TAGGACTGTGCTACGGCGCGAATACATTCTTTCACGCTGCGAAAGCTTATATTGAAGGCTATCACAC TGTACCTAAAGGTCGGTGTAGGCAGGTCGTCACCGGTATGGCGTGGTTGTTCTTCGTATCATGGGG AATGTTTCCAATCTTGTTTATACTAGGTCCCGAAGGATTTGGAGTGTTGTCCGTTTACGGATCAACAG TAGGCCACACTATTATCGATTTGATGTCTAAAAACTGCTGGGGGCTTTTAGGTCACTATCTAAGGGTG CTCATTCATGAGCACATATTAATCCATGGCGATATCAGAAAGACGACGAAACTGAATATTGGAGGCA CTGAGATCGAAGTAGAGACGCTTGTCGAAGACGAATCCGAAGCTGGTAGCCCCGCACGCTGGGTCT GGATATCTTTGTACTATGCCGCCTTCTATGTTGTTATGACAGGACTCTTTGCTTTATGCATCTATGTCC TAATGCAAACTATTATGGCTGAACTTATATCATCGGCAACAAGGAGTTTATTTGCGGCTGGGGGAATA AATCCGTGGCCCAACCCCTACCATCATGAAGATATGGGTTGCGGCGGCATGACCCCGACAGGGGAA TGCTTCTCGACGGAGTGGTGGTGTGATCCTTCTTATGGACTGAGTGATGCTGGGTATGGCTATTGCT TCGTAGAGGCTACGGGGGGGTACTTGGTCGTTGGAGTCGAGAAAAAACAGGCATGGTTACATAGCA GGGGGACTCCTGGAGAGAAAATAGGTGCCCAGGTTTGTCAATGGATTGCTTTCTCGATTGCAATAGC TCTGTTAACGTTCTATGGGTTCTCCGCGTGGAAGGCTACTTGTGGCTGGGAAGAGGTATATGTTTGT TGTGTTGAAGTTCTATTTGTAACACTTGAGATATTTAAAGAATTTTCTTCACCCGCAACGGTCTACTTAAGTACAGGCAATCATGCATACTGTCTAAGATACTTCGAATGGCTCTTATCATGTCCGGTGATCTTAAT TCGACTCTCGAACCTCTCTGGACTCAAGAATGACTATAGTAAGAGGACTATGGGACTCATTGTGTCG TGCGTTGGTATGATTGTGTTTGGTATGGCGGCAGGGCTGGCTACGGACTGGCTAAAGTGGCTGCTATATATAGTGAGCTGTATCTATGGCGGTTACATGTATTTCCAGGCGGCCAAGTGTTATGTCGAGGCGAATCACTCGGTCCCCAAAGGTCATTGTCGGATGGTGGTCAAGCTTATGGCGTACGCATATTTCGCCAG CTGGGGATCGTACCCGATACTTTGGGCCGTTGGCCCAGAAGGGCTACTAAAGTTGAGCCCGTACGC CAATTCAATTGGGCATAGTATCTGTGAGATAATTGCTAAGGAGTTTTGGACGTTTTTAGCTCACCATCTGAGAATTAAGATTCATGAGCACATCTTAATTCACGGGGATATCCGCAAGACTACCAAGATGGAGATA GGTGGGGAGGAGGTGGAGGTAGAAGAGTTTGTAGAAGAAGAGGATGAAGATACTGTA (SEQ ID NO:8)

[0160] Table-05: DNA sequences of promoter (mGluR6) used upstream of MCO-sequences for targeting specific cells as an example.CAGGGNNGATTGATTATTGACTAGTGATCTCCAGATGGCTAAACTTTTAAATCATGAATGAAGTAGATATTACCAAATTGCTTTTTCAGCATCCATTTAGATAATCATGTTTTTTGCCTTTAATCTGTTAATGTAGTGAATTACAGAAATACATTTCCTAAATCATTACATCCCCCAAATCGTTAATCTGCTAAAGTACA (SEQ ID NO:9)

[0161] Table-06: DNA sequences of reporter-stabilizer (mCherry) used downstream of MCO-sequences for confirming expression in specific cells as an example.ATGGCCATCATCAAGGAGTTCATGCGCTTCAAGGTGCACATGGAGGGCTCCGGAACGGCCCGAGTTCGAGATCGAGGGCGAGGGCGAGGGCCGCCCCTACGAGGGCACCCAGACCGCCAAGCTGAAGGTGACCAAGGGTGGCCCCCTGCCCTTCGCCTGGGACATCCTGTCCCCTCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCGCCGACATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGAGCGCGTGATGAACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACTCCTCCCTGCA GGACGGCGAGTTCATCTACAAGGTGAAGCTGCGCGGCACCAACTTCCCCTCCGACGGCCCCGTAAT GCAGAAGAAGACCATGGGCTGGGAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGCCCTGAAGGGCGAGATCAAGCAGAGGCTGAAGCTGAAGGACGGCGGCCACTACACGCTGAGGTCAAGACCA CCTACAAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGTCAACATCAAGTTGGACATCA CCTCCCACAACGAGGACTACACCATCGTGGAACAGTACGAACGCGCCGAGGGCCGCCACTCCACCGGCGGCATGGACGAGCTGTACAAG TAA (SEQ ID NO:10)

[0162] Table-07: Amino acid and DNA sequences of Enhanced Multi-Characteristics Opsin-1 (eMCO1).It contains MCO1 sequence (Table-01) and biomarker-stabilizer sequence (Table-06) with a linking sequence.

[0163] Amino acid sequence:MDYGGALSAVGRELLFVTNPVWNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAAGFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLRYAEWLLTCPVICIHLSNLTG LSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGYHTVPKGRCRQ VVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTKLNIGGTEIEVETLVEDEAEAGAVNKGTGKMAELISSATRSLFAAGGINPWPNPYHHEDMGCGGMTP TGECFSTEVWVCDPSYGLSDAGYGYCFVEATGGYLVVGVEKKQAWLHSRGTPGEKIGAQVCQWIAFSIAI ALLTFYGFSAWKATCGWEEVYVCCVEVLFVTLEIFKEFSSPATVYLSTGNHAYCLRYFEWLLSCPVILIRLS NLSGLKNDYSKRTMGLIVSCVGMIVFGMAAGLATDWLKWLLYIVSCIYGGYMYFQAAKCYVEANHSVPKGHCRMVVKLMAYAYFASWGSYPILWAVGPEGLLKLSPYANSIGHSICDIIAKEFWTFLAHHLRIKIHEHILIHGDIRKTTKMEIGGEEVEVEEFVEEEDEDTVVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGR PYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVV TVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHY DAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK (SEQ ID NO:11)

[0164] Nucleotide sequence:ATGGATTATGGCGGCGCGCTGAGCGCGGTGGGCCGCGAACTGCTGTTTGTGACCAACCCGGTGGT GGTGAACGGCAGCGTGCTGGTGCCGGAAGATCAGTGCTATTGCGCGGGCTGGATTGAAAGCCGCG GCACCAACGGCGCGCAGACCGCGAGCAACGTGCTGCAGTGGCTGGCGGCGGGCTTTAGCATTCTGCTGCTGATGTTTTATGCGTATCAGACCTGGAAAAGCACCTGCGGCTGGGAAGAAATTTATGTGTGCG CGATTGAAATGGTGAAAGTGATTCTGGAATTTTTTTTTGAATTTAAAAACCCGAGCATGCTGTATCTG GCGACCGGCCATCGCGTGCAGTGGCTGCGCTATGCGGAATGGCTGCTGACCTGCCCGGTGATTTGCATTCATCTGAGCAACCTGACCGGCCTGAGCAACGATTATAGCCGCCGCACCATGGGCCTGCTGGT GAGCGATATTGGCACCATTGTGTGGGGCGCGACCAGCGCGATGGCGACCGGCTATGTGAAAGTGA TTTTTTTTTGCCTGGGCCTGTGCTATGGCGCGAACACCTTTTTTCATGCGGCGAAAGCGTATATTGAAGGCTATCATACCGTGCCGAAAGGCCGCTGCCGCCAGGTGGTGACCGGCATGGCGTGGCTGTTTTTT GTGAGCTGGGGCATGTTTCCGATTCTGTTTATTCTGGGCCCGGAAGGCTTTGGCGTGCTGAGCGTG TATGGCAGCACCGTGGGCCATACCATTATTGATCTGATGAGCAAAAACTGCTGGGGCCTGCTGGGCCATTATCTGCGCGTGCTGATTCATGAACATATTCTGATTCATGGCGATATTCGCAAAACCACCAAACT GAACATTGGCGGCACCGAAATTGAAGTGGAAACCCTGGTGGAAGATGAAGCGGAAGCGGGCGCGG TGAACAAAGGCACCGGCAAAATGGCTGAGCTGATCAGCAGCGCCACCAGATCTCTGTTTGCCGCCGGAGGCATCAACCCTTGGCCTAACCCCTACCACCACGAGGACATGGGCTGTGGAGGAATGACACCTA CAGGCGAGTGCTTCAGCACCGAGTGGTGGTGTGACCCTTCTTACGGACTGAGCGACGCCGGATAC GGATATTGCTTCGTGGAGGCCACAGGCGGCTACCTGGTCGTGGGAGTGGAGAAGAAGCAGGCTTGGCTGCACAGCAGAGGCACACCAGGAGAAAAGATCGGCGCCCAGGTCTGCCAGTGGATTGCTTTCAG CATCGCCATCGCCCTGCTGACATTCTACGGCTTCAGCGCCTGGAAGGCCACTTGCGGTTGGGAGGA GGTCTACGTCTGTTGCGTCGAGGTGCTGTTCGTGACCCTGGAGATCTTCAAGGAGTTCAGCAGCCCCGCCACAGTGTACCTGTCTACCGGCAACCACGCCTATTGCCTGCGCTACTTCGAGTGGCTGCTGTC TTGCCCCGTGATCCTGATCAGACTGAGCAACCTGAGCGGCCTGAAGAACGACTACAGCAAGCGGAC CATGGGCCTGATCGTGTCTTGCGTGGGAATGATCGTGTTCGGCATGGCCGCAGGACTGGCTACCGATTGGCTCAAGTGGCTGCTGTATATCGTGTCTTGCATCTACGGCGGCTACATGTACTTCCAGGCCGCC AAGTGCTACGTGGAAGCCAACCACAGCGTGCCTAAAGGCCATTGCCGCATGGTCGTGAAGCTGATG GCCTACGCTTACTTCGCCTCTTGGGGCAGCTACCCAATCCTCTGGGCAGTGGGACCAGAAGGACTGCTGAAGCTGAGCCCTTACGCCAACAGCATCGGCCACAGCATCTGCGACATCATCGCCAAGGAGTTTTGGACCTTCCTGGCCCACCACCTGAGGATCAAGATCCACGAGCACATCCTGATCCACGGCGACATCCGGAAGACCACCAAGATGGAGATCGGAGGCGAGGAGGTGGAAGTGGAAGAGTTCGTGGAGGAGGAGGACGAGGACACAGTGGTGAGCAAGGGCGAGGAGGATAACATGGCCATCATCAAGGAGTTCATGCGCTTCAAGGTGCACATGGAGGGCTCCGTGAACGGCCACGAGTTCGAGATCGAGGGCGAGGGCGAGGGCCGCCCCTACGAGGGCACCCAGACCGCCAAGCTGAAGGTGACCAAGGGTGGCCCCCTGCCCTTCGCCTGGGACATCCTGTCCCCTCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCGCCGACATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGAGCGCGTGATGAACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACTCCTCCCTGCAGGACGGCGAGTTCATCTACAAGGTGAAGCTGCGCGGCACCAACTTCCCCTCCGACGGCCCCGTAATGCAGAAGAAGACCATGGGCTGGGAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGCCCTGAAGGGCGAGATCAAGCAGAGGCTGAAGCTGAAGGACGGCGGCCACTACGACGCTGAGGTCAAGACCACCTACAAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGTCAACATCAAGTTGGACATCACCTCCCACAACGAGGACTACACCATCGTGGAACAGTACGAACGCGCCGAGGGCCGCCACTCCACCGGCGGCATGGAC GAGCTGTACAAGTAA (SEQ ID NO:12)

[0165] Table-08: Comparison of stability of the MCO1 and eMCO1 based on secondary structure and folding using theoretical modeling by RaptorX.

[0166] Example 15- Structure of eMCO1 and activation of its different domains by light is shown in Fig. 19. Blue light activates the trans-membrane (TM) domain (ion-channel) of eMCO1 allowing for the flow of cations. Green & Red light activates the non-TM, middle domain (non-ion channel) leading to its conformational change that result in the conformational change of the TM domain and thus, facilitate flow of cations via the TM-domain. Upon green light absorption, the C-terminus domain (enhancer) emits red light that enhances overall eMCO1 efficacy. These unique structures of eMCO1 allow for the activation of the eMCO1 even at a low level of light with a wavelength ranging from the blue to red spectrum in a fast and efficient manner. Patch clamp experiment (voltage clamp) on eMCO1 transfected HEK cells (transfected by JetPrime) was conducted under different stimulation wavelengths. Fig. 20A shows an inward current profile measured at a blue (450 nm) light intensity of 0.06 mW / mm2in HEK cells transfected with eMCO1 . Fig. 20B shows an inward current profile measured at a green (520 nm) light intensity of 0.06mW / mm2in HEK cell transfected with eMCO1 . Fig. 20C shows an inward current profile measured at a red (630 nm) light intensity of 0.06 mW / mm2in HEK cell transfected with eMCO1 . BARTA (known calcium chelator) was added to the extracellular solution (final concentration up to 100 mM). Fig. 20D shows a reduced inward current profile measured at blue (450 nm) light intensity of 0.06 mW / mm2in HEK cells transfected with eMCO1 , in presence of Ca2+chelator BAPTA. Comparison of photocurrent in cells generated by light of different wavelengths and the effect of the presence of a Ca2+chelator (BAPTA) on the eMCO transmembrane-domain function that was probed by blue (450 nm) light activation is shown in Fig. 20E. The fact that use of the BAPTA reduced the current by more than half at 450 nm means that the ratio of Ca2+permeability to other cation permeability is determined to be >1 .

[0167] In addition to broad activation spectrum, specific ion conductivity, and light sensitivity, eMCO has fast ON and OFF-kinetics. Fig. 20F shows a quantitative comparison of photocurrent ON-time (time to the -ve peak from baseline) generated by the blue and green light. The ON-time of photocurrent measured in cell was ~4 times higher at 520 nm light stimulation as compared to that at 450 nm.

[0168] Example 16- To determine if eMCO1 sensitization of retinal bipolar cells could preserve their organization, a structural comparison of the retinal thickness before, and after intravitreal injection in rd mice was conducted using different doses of an AAV2 carried eMCO1 protein (vMCO1 vehicle), including AAV-vehicle (without eMCO1) using OCT based measurement. Group AA mice eyes were intravitreally injected with 1 pl of 1 .0 x 1012VG / ml AAV2-eMCO; group BB mice eyes were injected by 1 pl of 1 .0 x 1012VG / ml AAV2 (no transgene, -ve control). Another group CC mice were injected with 1 pl of low dose (1 .0 x 1010VG / ml) AAV2-eMCO. Fig 21A shows longitudinally measured retinal thickness of rd mice measured by SDOCT before and after different doses of AAV2-eMCO or AAV2-vehicle injection. The measurement of the retinal thickness from priorto injection, one day after injection and one and four months after injection for each group was carried out. A scattered plot showing the comparison of retinal thickness prior to injection, and 4 months after injection in the different groups is shown in Fig. 21 B. Fig. 21 C shows the mean difference of retinal-thickness between baseline and intravitreally-injected mice shown as a Gardner-Altman estimation plot. In the eMCO1 injected mice group (AA and CC), retina thickness was preserved overtime compared to vehicle injected group (BB). The observed stable retina thickness in eMCO1 injected groups (as compared to vehicle injected group) can be attributed to stabilization of retina thickness by arresting further disorganization of the retinal layer(s).

[0169] Example 17- To determine if the synaptic spread of bipolar cells and / or connectivity between bipolar cells and retinal ganglion cells is enhanced due to eMCO1 sensitization of bipolar cells, immunostaining of the retinal section of rd10 mice after vMCO injection (intravitreally injected of 1 pl of vMCO1) was conducted. The expression of reporter mCherry in bipolar cells (INL) 16 weeks after AAV2-eMCO1 injection is shown in Fig. 22B. Quantification of eMCOI (reporter mCherry) expression in bipolar cells of three rd10 mice is shown in Fig. 22C. Fig. 22D shows immunostained cross-sections of the retina showing Bipolar cell terminals (green: PKCa) co-stained with CtBP (a synaptic ribbon marker, red) in close contact with retinal ganglion cells (RGCs) in the eMCO injected rd 10 mouse retina. Fig. 22E shows immunostainedcross-sections of the retina showing Bipolar cell terminals (green: PKCa) co-stained with CtBP (a synaptic ribbon marker, red) in close contact with retinal ganglion cells (RGCs) in the untreated rd1 O mouse retina. Stronger PKCa immunostained signal in axonal terminals (*p< 0.05) and CtBP signal was found in the AAV2-eMCO1 treated rd10 mice retina compared to non-treated mice (Fig. 22F). The results show that though synaptic connections of bipolar cells with ganglion cells deteriorate in photoreceptor-degenerated retina, eMCO1 sensitization (and ambient light activation) enhanced the synaptic terminals allowing transmission of light activated signals from eMCO1 expressing bipolar cells to brain via retinal ganglion cell axons (the optic nerve).

[0170] Example 18- The gene agnostic therapeutic benefit of an eMCO1 was established by demonstrating improvement of the vision in retinal degenerated mice models for Retinitis pigmentosa (rd 1 , rd10), Stargardt (ABCA4- / -) and Lieber Congenital Amaurosis (LCA). Intravitreal injection of vMCO1 (1 pL of 3.5E12 vg / mL) lead to behavioral improvement of vision assayed by a radial water maze. Fig. 23A shows the time to reach the platform by the Stargardt (ABCA4- / -) mice from side-arms of the radial-arm water maze (light intensity: 0.004 mW / mm2) before and after AAV2 (no transgene, -ve control) injection. In the absence of the transgene (eMCO), there was no statistical difference before and after AAV2-vehicle injection. However, after injection with AAV2-eMCO, the latency to find the lighted platform decreased significantly. Fig. 23B shows the time to reach the platform by the Stargardt (ABCA4- / -) mice from sidearms of the radial-arm water maze (light intensity: 0.004 mW / mm2) before and after vMCO1 injection. Similar, behavioral efficacy results were obtained in an LCA mice model after vMCO1 injection (Fig. 23C and Fig. 23D). The vehicle (AAV2) injected LCA mice did now show improvement in the water maze (Fig. 23C). However, the time taken to reach the platform (latency) significant decreased in the vMCO1 treated LCA mice group compared to baseline (Fig. 23D).

[0171] Example 19- To determine if eMCO1 sensitization of bipolar cells could lead to electrophysiological recovery in addition to arresting degeneration and imparting light-sensitivity to the retina, the Stargardt mice were injected with AAV2-eMCO. Arresting of further retinal degeneration in Stargardt mice model is demonstrated by longitudinal monitoring of retina thickness in Stargardt (ABCA4- / -) mice after vMCO1 injection using SDOCT. For comparison, a separate mouse group that was not treated was followed up longitudinally. Comparison of retinal thickness before, Week 4, 12 and 16 after vMCO1 injection found that the retinal thickness does not decrease significantly overtime (further degeneration is arrested). In contrast, in the non-treated mouse group, the retinal thickness decreased significantly with progression of time as shown in Fig. 24A. An electroretinogram (ERG) study conducted on vMCO1 treated Stargardt mice found an enhanced ERG response at 1 cds / m2and 10 cd s / m2compared to a vehicle injected mouse group (Fig. 24B and Fig. 24C). Both the SD-OCT and ERG measurement demonstrated the therapeutic benefit (arresting of further retinal degeneration as well as improved light sensitivity) of eMCO treatment for vision restoration.

[0172] Example 20- Fig. 25 illustrates a method of vison restoration via intraocular AAV2-eMCO administration. As the retina (100) degenerates, the retinal ganglion cells (1 10) and bipolar cells (120)survive. Further, the photoreceptors (130) and / or retinal pigment epithelium (140) are mutated or lost (150). In those retinal degenerated subjects, via use of a delivery device (160), AAV-carried eMCO (vMCO1) (170) is delivered intraocularly. As evidenced in our animal and human studies, the vMCO1 propagates via the Optic nerve (180), Optic tract (190) and Optic Chiasm (200) to get transferred to the contralateral eye (210). This contra I ate rally-transferred AAV-eMCO transduces retinal cells (220). With a natural scene in the visual field or projected patterns to retina (230) activates bipolar cells (240), which in turn activates the retinal ganglion cells (250). The electro-chemical signal (260) is transmitted via the optic nerve to the brain (270) for visual processing of light-activated signal received from eMCO1 -sensitized retina.

[0173] Example 21- This example demonstrates that an AAV that includes a gene that codes for an eMCO1 that is injected intravitreal is capable of contralateral transfer. An eMCO1 gene expressed in the retina subsequent to an intravitreal injection in a mouse was observed in the injected as well as the contralateral eye (Fig. 26 A: Injected eye and 26B: Contralateral eye). The transfer of vMCO1 from the injected eye to the non -injected eye was also observed in rd10 mice wherein the expression of eMCO1 (reporter mCherry) expression was observed in both the injected and the non-injected eye after 6 month of injection. The contralateral vMC01-010 transfer after intravitreal injection was also identified in dogs 4 months after each received a uniocular injection (75pl of 2E11 VG / ml AAV2-eMCO). This was measured in the dogs by immunofluorescence of the transgene (eMCO with mCherry enhancer / reporter) (Fig. 26C: injected eye, Fig. 26D: Contralateral eye). Further, qPCRwas performed to quantify the presence ofvMCOI vector copies. Fig. 26E shows the measured vector copy numbers in left / right optic nerves, optic chiasm and left / right LGN in treated dogs that were intravitreally injected with vMCO1 in the right eye (only). The data indicates contralateral transport of vMCOI via optic nerve and optic chiasm.

[0174] Example 22- To determine if uniocular injection of vMCO1 will lead to contralateral transfer (as seen in animals) in humans, subjects with advanced retinal pigmentosa were injected with vMCO1 through a single intravitreal injection in the eye that had the greater impaired vision (the eye with the greater reduction in sight). For the evaluation of eMCO1 expression in the subjects after vMCO1 injection, visualization of the reporter (mCherry) fluorescence was carried out by Fundus Autofluorescence imaging through a red filter using a Topcon Triton Plus imaging system. As shown in Fig. 27A, the reporter fluorescence increased in the injected eye. Similarly, the contralateral eye elicited higher reporter fluorescence intensity eight weeks after vMCO1 injection in the other eye. Besides an increase in diffused fluorescence in the fundus, patches and speckles of fluorescence were visible (Fig. 27A, Fig. 27B). To examine if eMCO1 expression in a retina leads to arrest of further retinal degeneration in retinitis pigmentosa patients, longitudinal monitoring of retinal thickness in injected and contralateral eyes by OCT imaging was conducted before and after injection of vMCOI was carried out. Longitudinally monitoring of retinal thickness in injected and contralateral eyes was carried out by OCT imaging and quantified (Fig. 27C). Measured average retinal thickness did not change after vMCO1 injection. No significant change in retina thickness was observed even at 52 weeks with respect to baseline, implying arrest / slowdown of the degeneration process.

[0175] Example 23- To determine vision restoration by vMCO1 in humans, 11 subjects with advanced retinal pigmentosa were injected with 1.75E11 vg / eye (in low dose group n=3) and 3.5E11 vg / eye (in high dose, n=8) through a single intravitreal injection in worse seeing eye. The mean visual acuity value of injected eyes in the high-dose group showed >0.68 logMAR improvement as compared to 0.1 logMAR improvement in the low-dose group 16 weeks after injection. Remarkably, at 16 weeks after injection, 7 out of these 8 subjects demonstrated >0.3 logMAR gain (with respect to baseline) and 6 out of 8 high-dose subjects showed > 0.6 logMAR gain. Fig. 28 shows longitudinally monitored Visual Acuity (LogMAR) in vMCO1 injected (3.5E11 vg) and contralateral eyes of patients with severe retinal degeneration. As can be seen, the intravitreal injection of AAV2-eMCO in humans also led to improvement of vision in contralateral eyes. The mean improvement in the logMAR acuity value in high-dose contralateral eyes was found to be 0.34 logMAR at 16 weeks as compared to 0.68 logMAR in the injected eyes (Fig. 28).

[0176] Example 24- To determine if opsin sensitization and optogenetic stimulation of retinal ganglion cells would enable axonal regeneration leading to vision restoration, visually guided behavior in mice during baseline and after optic nerve crush was examined in two different groups: (i) without optogenetic stimulation and (ii) with optogenetic stimulation. Fig. 29A shows the Schematic of Visually-guided Y-mobility assay to evaluate vision in mice. Fig. 29B shows the Number of events (finding Light ON vs. OFF) by mice for different conditions. 6 trials per conditions were conducted. In Baseline (No optic nerve crush) measurements, the number of mice finding the light ON (+Light) panel of the Y-maze is significantly higher than the event of finding light OFF (-Light) panel. With optic nerve crush (ON crush), the number of events of finding light ON and OFF are same. After optic nerve crush, the mice were exposed to strobe (0.5 Hz) light (Philips Hue) stimulation (8 hours / day). 2 weeks after strobe light stimulation in optic nerve crush animals, improved visually-guided behavior of mice toward light ON panel was observed, similar to baseline (prior to ON crush) behavior. This implied that optogenetic stimulation of opsin-sensitized retinal ganglion cells led to regeneration of the degenerated (by ON crush) axons, which led to vision restoration.

[0177] Example 25- To determine if administration of eMCO1 resulted in some level of vision restoration in patients suffering from m Stargardt macular degeneration, these patients were injected with 1.2E11gc / eye through a single intravitreal injection. Fig 30A shows longitudinal improvement for visual acuity letter scores measured in an eMCO1 treated patients using an ETDRS eye chart. As shown in Fig 30A, at week 24 following eMCO1 treatment of the patient, an about an 11 letter gain was observed as compared to the baseline. Fig 30B shows longitudinal improvement in visual acuity of the eMCO1 treated subject with a VR headset (with 100% contrast and 3X zoom). The visual acuity letter score was measured using an ETDRS eye chart presented to the patient at a distance of 50 cm. When the VR headset was used with a 3X zoom (and 100% contrast), the gain in the letter score after eMCO1 injection was further enhanced to about 30 letter gain at 24 weeks (Fig. 30B).

[0178] The terms “a” and “an” are defined as one or more unless this disclosure explicitly requires otherwise. The term “substantially” is defined as largely but not necessarily wholly what is specified (andincludes what is specified; e.g., substantially 90 degrees includes 90 degrees and substantially parallel includes parallel), as understood by a person of ordinary skill in the art. In any disclosed embodiment, the terms “substantially,” “approximately,” and “about” may be substituted with “within [a percentage] of’ what is specified, where the percentage includes 0.1 , 1 , 5, and 10 percent.

[0179] Further, a molecule or method that is configured in a certain way is configured in at least that way, but it can also be configured in other ways than those specifically described.

[0180] The terms “comprise” (and any form of comprise, such as “comprises” and “comprising”), “have” (and any form of have, such as “has” and “having”), “include” (and any form of include, such as “includes” and “including”) and “contain” (and any form of contain, such as “contains” and “containing”) are open- ended linking verbs. As a result, an apparatus that “comprises,” “has,” “includes” or “contains” one or more elements possesses those one or more elements but is not limited to possessing only those elements. Likewise, a method that “comprises,” “has,” “includes” or “contains” one or more steps possesses those one or more steps but is not limited to possessing only those one or more steps.

[0181] Any embodiment of any of the apparatuses, systems, and methods can consist of or consist essentially of - rather than comprise / include / contain / have - any of the described steps, elements, and / or features. Thus, in any of the claims, the term “consisting of’ or “consisting essentially of’ can be substituted for any of the open-ended linking verbs recited above, in order to change the scope of a given claim from what it would otherwise be using the open-ended linking verb.

[0182] The feature or features of one embodiment may be applied to other embodiments, even though not described or illustrated, unless expressly prohibited by this disclosure or the nature of the embodiments.

[0183] Below, the presently disclosed invention will be further described by way of examples, which are provided for illustrative purposes only and accordingly are not to be construed as limiting the scope of the invention.

[0184] Some references, which may include publications, patents, and patent applications, are cited and discussed in the description of this invention. The citation and / or discussion of such references is provided merely to clarify the description of the present invention and is not an admission that any such reference is “prior art” to the invention described herein. All references cited and discussed in this specification are incorporated herein by reference in their entireties and to the same extent as if each reference were individually incorporated by reference.

[0185] The specification and examples herein provide a complete description of the structure and use of illustrative embodiments. Although certain embodiments have been described with a certain degree of particularity, or with reference to one or more individual embodiments, those skilled in the art could make numerous alterations to the disclosed embodiments without departing from the scope of this invention. As such, the various illustrative embodiments of the devices are not intended to be limited to the particular forms disclosed. Rather, they include all modifications and alternatives falling within the scope of the claims, and embodiments other than the one shown may include some or all of the features of the depicted embodiment. For example, components may be omitted or combined as a unitary structure, and / orconnections may be substituted. Further, where appropriate, aspects of any of the examples described above may be combined with aspects of any of the other examples described to form further examples having comparable or different properties and addressing the same or different problems. Similarly, it will be understood that the benefits and advantages described above may relate to one embodiment or may relate to several embodiments.

[0186] Furthermore, the claims are not intended to include, and should not be interpreted to include, means-plus- or step-plus-function limitations, unless such a limitation is explicitly recited in a given claim using the phrase(s) “means for” or “step for,” respectively.

[0187] To the extent that any specific disclosure in the references or other literature may be considered to anticipate any generic aspect of the present invention, the disclosure of the present invention should be understood to include a proviso or provisos that exclude of disclaim any such species that were previously disclosed. The aspects of the present invention, which are not anticipated by the disclosure of such literature, are also nonobvious from the disclosure of these publications, due at least in part to the unexpectedly superior results disclosed herein.

Claims

What is claimed is:

1. A method to restore the vision of a patient suffering from a retinal dystrophy or a retinal degeneration, wherein a vector comprising a nucleic acid having 75%, 85%, 95% or 100% identity to at least one of SEQ ID NO: 1 , 3, 5, 7 or 11 is administered to the patient suffering from the retinal degeneration or retinal dystrophy.

2. The method of claim 1 , wherein the nucleic acid comprises a sequence of a broadband eMCO protein that is comprised of a blue light sensitive transmembrane ion-channel domain, which is attached to a ligand, a non-transmembrane domain, and an enhancer that has a fluorescence reporter and stabilizer activity.

3. The method of claim 2, wherein, the eMCO1 protein responds to a blue, a green and a red light.

4. The method of claim 2, wherein the eMCO1 protein has enhanced calcium ion permeability as compared to the permeability of eMCO1 protein with other cations.

5. The method of claim 2, wherein the ligand attached to the transmembrane domain of the eMCO1 protein is sensitive to a green light and a red light.

6. The method of claim 5, wherein the greater light sensitivity of the eMCO1 protein is due to the attached ligand domain.

7. The method of claim 2, wherein the non-transmembrane ligand domain of the eMCO1 protein increases the ON kinetics of the green and red light induced current through the transmembrane domain of the eMCO1 as compared to the ON kinetics of the blue light induced current through the transmembrane domain of the eMCO1 .

8. The method of claim 2, wherein a reporter domain of the eMCO1 protein is activated by light and the re-emission of light from the reporter domain is captured by the red light-sensitive ligand to enhance the composite light sensitivity.

9. The method of claim 1 , wherein the method is to arrest a retinal degeneration or retinal dystrophy by administering to a patient in need thereof, a nucleic acid whose coding region has a 75%, 85%, 95% or 100% identity to at least one of SEQ ID NO: 1 , 3, 5, 7 or 11 .

10. A method of treating a degenerative retinal disease that results in vision loss in a patient; wherein the patient is administered a recombinant eMCO1-gene through an intravitreal, sub- retinal or supra choroidal injection into the eye with a vector that includes a nucleic acid comprising a promoter-eMCOI-gene, and further wherein, the vector comprising the promoter-eMCOI gene is administered to the patient in combination with one or more a Pronase E or an alpha-aminoadipic acid (AAA).

11. The method of claim 10, wherein following the injection of the vector comprising a promotor-eMCOI- gene into the eye, one or both of a chemical or physical transduction method is administered to the eye of the patient.

12. The method of claim 10, wherein prior to injecting the vector comprising a promoter-eMCOI-gene into the eye, the internal limiting membrane is peeled back.

13. The method of claim 10, wherein administration of the vector comprising a promoter-eMCOI -gene results in localized expression of the eMCO1-gene in targeted retinal degenerated regions of a retina.

14. The method of claim 10, wherein following injection of the vector comprising a promoter-eMCOI-gene, the patient experiences improvement in visually guided behavioral improvement.

15. The method of claim 10, wherein the vector comprising the promoter-eMCOI-gene is administered two or more times to the patient.

16. A method to maintain the retinal thickness comprising administering to a patient in need thereof, a vector comprising a nucleic acid having 75%, 85%, 95% or 100% identity to at least one of SEQ ID NO: 1 , 3, 5, 7 or 11.

17. The method of claim 15, wherein the administration of the vector comprising the nucleic acid to a retinal degenerated eye results in transgene expression in a non-injected eye.

18. The method of claim 15, wherein the improvement in retinal function and visual behavior is observed in both the injected eye and the non-injected eye.

19. The method of claim 1 wherein the expression of eMCOI in cells and light activation leads to improved structural organization and cellular connectivity in targeted tissue.

20. The method of claim 1 , wherein the method for restoration of vision is through the regeneration of the damaged retinal ganglion cell (RGC) axons in a patient in need thereof, wherein the patient is administered a vector comprising a nucleic acid having 75%, 85%, 95% or 100% identity to at least one of SEQ ID NO: 1 , 3, 5, 7 or 11 ; and further wherein the eMCO1 gene is delivered to the RGCs prior to or following axonal degeneration; wherein light stimulation of the eMCO1 -sensitized RGCs results in a reduction in the rate of degeneration and / or to regenerate the axons; and and wherein the light stimulation dose is optimized for minimizing the degeneration and / or maximizing the axonal regeneration.

21. The method of claim 10 wherein the eMCO1-gene is administered to a patient with macular degenerative disease, wherein, the macular degenerative disease comprises one or both of Stargardt macular degeneration and advanced age-related macular degeneration.

22. The method of claim 21 , wherein the administration of the nucleic acid comprising the MCOI-gene to a patient suffering from a macular degenerated eye results in an improvement in the patient’s visual acuity and other visual functions.

23. The method of claim 22, wherein the improvement in visual acuity and other visual functions is enhanced by the use of a contrast-enhancing and zooming device.

24. The method of claim 23, wherein the contrast-enhancing and zooming device is a VR headset.

25. The method of claim 10 wherein the optogenetic treatment is administered to a patient with macular degenerative disease, wherein, the macular degenerative disease comprises one or both of Stargardt macular degeneration and advanced age-related macular degeneration.

26. The method of claim 25, wherein the administration of the nucleic acid comprising the optogenetic treatment to a patient suffering from a macular degenerated eye results in an improvement in the patient’s visual acuity and other visual functions.

27. The method of claim 26, wherein the improvement in visual acuity and other visual functions is enhanced by the use of a contrast-enhancing and zooming device.

28. The method of claim 27, wherein the contrast-enhancing and zooming device is a VR headset.