Convergent recombination-derived hepatocellular carcinoma-specific tcrs and applications thereof
Patent Information
- Authority / Receiving Office
- EP · EP
- Patent Type
- Applications
- Current Assignee / Owner
- THE UNIVERSITY OF HONG KONG
- Filing Date
- 2024-07-05
- Publication Date
- 2026-05-13
AI Technical Summary
Current treatments for hepatocellular carcinoma (HCC) lack specificity and efficacy, as existing T-cell receptor (TCR) therapies struggle to effectively target HCC antigens while minimizing harm to healthy tissues.
Development of convergent recombination-derived HCC-specific TCRs, which include specific Complementarity Determining Regions (CDRs) and variable domains of TCR β and α chains, allowing for targeted recognition and destruction of HCC cells.
The HCC-specific TCRs demonstrate enhanced specificity and persistence, leading to effective expansion of CD4+ T cells and improved anti-tumor immune responses, potentially offering a more effective approach to HCC treatment.
Smart Images

Figure PCTCN2024103982-FTAPPB-I100001 
Figure PCTCN2024103982-FTAPPB-I100002 
Figure PCTCN2024103982-FTAPPB-I100003
Abstract
Description
CONVERGENT RECOMBINATION-DERIVED HEPATOCELLULAR CARCINOMA-SPECIFIC TCRS AND APPLICATIONS THEREOF
[0001] CROSS-REFERENCE TO RELATED APPLICATIONS
[0002] This application claims benefit of U.S. Provisional Application No. 63 / 512, 299, filed July 07, 2023. Application No. 63 / 512,299, filed July 07, 2023, is hereby incorporated herein by reference in its entirety.
[0003] REFERENCE TO SEQUENCE LISTING
[0004] The Sequence Listing XML submitted as a file named “UHK_01396_PCT_ST26, ” created on June 26, 2024, and having a size of 61, 683 bytes is hereby incorporated by reference pursuant to 37 C.F.R. § 1.834 (c) (1) .FIELD OF THE INVENTION
[0005] The present invention generally relates to T-cell receptor (TCR) , More specifically, the present invention relates to discovery and applications of convergent recombination derived hepatocellular carcinoma-specific TCRs.BACKGROUND OF THE INVENTION
[0006] The T-cell receptor (TCR) is a key component of the adaptive immune response, playing a crucial role in the recognition of specific antigens. The TCR is composed of two different protein chains, alpha and beta, or gamma and delta, that are linked together by disulfide bonds. The alpha and beta chains contain variable (V) , diversity (D) , and joining (J) gene segments that are rearranged during T cell development to generate a unique TCR sequence that can recognize specific antigens. This process of TCR rearrangement is known as V (D) J recombination and is mediated by the RAG1 and RAG2 proteins, which recognize recombination signal sequences (RSSs) flanking the V, D, and J gene segments. The RAG proteins cleave the DNA at the RSSs, creating double-strand breaks that are repaired by the non-homologous end joining (NHEJ) pathway. This process results in the formation of a unique TCR sequence that is specific to each T cell.
[0007] TCRs on T-cells can recognize specific cancer antigens. Modified T-cells targeting HCC antigens, such as AFP, GPC3, and MAGE-A, can be employed for adoptive cellular therapy (ACT) to destroy cancer cells. Viral antigens (HBsAg) are also targets for ACT. CD8 T cells have been traditionally considered the most effective immune cells for ACT, and infusion of CD8 CAR T cells alone has shown long-term B-cell eradication. However, CD4 T cells also play a crucial role in the immune response, and they can enhance the cytolytic activities of CD8 T cells through cytokine production. Studies have shown that CD4 CAR T cells demonstrate comparable effectiveness in directly killing target tumor cells both in vitro and in vivo. While CD4 CAR T cells may exhibit slower granzyme B secretion and tumor killing at the onset, they are less prone to AICD and exhaustion compared to CD8 counterparts, which confers the CD4 compartment a relatively better persistence following antigen exposure.
[0008] Ideally, the antigen chosen for a target in ACT needs to be highly expressed in tumor cells and not by essential healthy tissues. Multiple strategies can be employed to identify TCRs that specifically recognize tumor antigens. One such method is single-cell TCR sequencing (TCR-seq) , which allows for the identification and characterization of TCRs at the single-cell resolution as disclosed herein.
[0009] Any discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is not to be taken as an admission that any or all of these matters form part of the prior art base or were common general knowledge in the field relevant to the present disclosure as it existed before the priority date of each claim of this application.
[0010] Throughout this specification the word “comprise, ” or variations such as “comprises” or “comprising, ” will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps.SUMMARY OF THE INVENTION
[0011] Disclosed are compounds, compositions, and methods that involve and can be used treat liver cancer. Disclosed are immune proteins related to or derived from T-cell receptors (TCRs) discovered to be associated with liver cancer. The disclosed immune proteins generally include and / or retain functional portions of the discovered TCRs. For example, in some forms, the immune proteins include (a) Complementarity Determining Regions (CDRs) having the sequences SGHSA (SEQ ID NO: 53) , FRNQAP (SEQ ID NO: 54) , and ASSLDRGQDTQY (SEQ ID NO: 55) , (b) CDRs having the sequences TISGNEY (SEQ ID NO: 56) , GLQQN (SEQ ID NO: 57) , and ILRGTGGNNKLT (SEQ ID NO: 58) , or (c) both.
[0012] In some forms, the immune proteins include comprising (a) a TCR β chain variable domain (TCR-β domain) comprising Complementarity Determining Regions (CDRs) having the sequences SGHSA (SEQ ID NO: 53) , FRNQAP (SEQ ID NO: 54) , and ASSLDRGQDTQY (SEQ ID NO: 55) , (b) a TCR α chain variable domain (TCR-α domain) comprising CDRs having the sequences TISGNEY (SEQ ID NO: 56) , GLQQN (SEQ ID NO: 57) , and ILRGTGGNNKLT (SEQ ID NO: 58) , or (c) both. In some forms, the immune proteins include a T-cell receptor (TCR) that includes the TCR-β domain, the TCR-α domain, or both.
[0013] In some forms, the TCR-β domain has a sequence identity of at least 75%to SEQ ID NO: 51 and the TCR-α domain has a sequence identity of at least 75%to SEQ ID NO: 52. In some forms, the TCR-β domain has a sequence identity of at least 85%to SEQ ID NO: 51 and the TCR-α domain has a sequence identity of at least 85%to SEQ ID NO: 52. In some forms, the TCR-β domain has a sequence identity of at least 90%to SEQ ID NO: 51 and the TCR-αdomain has a sequence identity of at least 90%to SEQ ID NO: 52. In some forms, the TCR-β domain has a sequence identity of at least 95%to SEQ ID NO: 51 and the TCR-α domain has a sequence identity of at least 95%to SEQ ID NO: 52. In some forms, the TCR-β domain has a sequence identity of at least 75%to SEQ ID NO: 51 and the TCR-α domain has a sequence identity of at least 75%to SEQ ID NO: 52. In some forms, the TCR-β domain includes the sequence SEQ ID NO: 51, and the TCR-α domain includes the sequence SEQ ID NO: 52.
[0014] In some forms, the immune protein targets hepatocellular carcinoma (HCC) antigens.
[0015] Also disclosed are nucleic acids encoding one or more of the disclosed immune proteins. Also disclosed are vectors that include one or more of the disclosed nucleic acids. In some forms, the nucleic acid or vector includes an expression segment that includes coding regions in the following order: a signal sequence (such as fibroin protein from silk moth (FiBL) ) , the TCR-β domain, a TCR β constant region, a furin cleavage site, a flexible linker, T2A, the TCR-α domain, and a TCR α constant region.
[0016] Also disclosed are cells that express one or more of the disclosed immune proteins. In some forms, the cell is a genetically modified T-cell.
[0017] Also disclosed are populations of cells derived by expanding one or more of the disclosed cells.
[0018] Also disclosed are pharmaceutical compositions. In some forms, the composition includes one or more disclosed immune proteins and a pharmaceutically acceptable buffer, carrier, diluent or excipient. In some forms, the composition includes one or more of the disclosed populations of cells and a pharmaceutically acceptable buffer, carrier, diluent or excipient.
[0019] Also disclosed are methods of treating a subject having a disease, disorder, or condition. In some forms, the disease, condition, or disorder is associated with the target of the immune protein. Generally, the methods involve administering to the subject an effective amount of one or more of the disclosed pharmaceutical compositions.
[0020] In some forms, the subject has HCC or has been identified as being at increased risk of developing HCC. In some forms, the population of cells were isolated from or derived from the expansion of a cell obtained from the subject having the disease, disorder, or condition prior to the introduction to the cell. In some forms, the population of cells were isolated from, or derived from the expansion of a cell obtained from a healthy donor.
[0021] Also disclosed are T-cell receptors (TCRs) that can specifically target liver cancer cells. These T-cell receptors (TCRs) contain TCR β chain variable domain of SEQ ID NO: 51 and α chain variable domain of SEQ ID NO: 52, wherein the three Complementarity Determining Regions (CDRs) of the β chain variable domain comprise: CDR1: SGHSA (SEQ ID NO: 53) , CDR2: FRNQAP (SEQ ID NO: 54) , CDR3: ASSLDRGQDTQY (SEQ ID NO: 55) , and wherein the three CDRs of the α chain variable domain comprise: CDR1: TISGNEY (SEQ ID NO: 56) , CDR2: GLQQN (SEQ ID NO: 57) and CDR3: ILRGTGGNNKLT (SEQ ID NO: 58) .
[0022] The T cells carrying the specific TCRs are activated in HCC-bearing livers but not in the normal livers. These TCRs also exhibit TCR convergence which indicates TCR amino acid sequence was shared by T cells from multiple HCC-bearing subjects, despite being encoded by different mRNA variants. The TCR convergence across HCC-bearing mice indicates that this TCR specific for HCC antigens elicits the expansion of CD4+ T cells.
[0023] In some forms, the disclosed TCR sequences can then be introduced into T cells, which can be expanded and infused into subjects to target and treat cancer cells.
[0024] In some forms, the disclosed TCRs can be used for adoptive T cell immunotherapy to treat liver cancer.
[0025] In some forms, the disclosed TCRs can be engineered for the treatment of various other cancers, such as melanoma or leukemia.
[0026] In some forms, the disclosed TCRs can guide the identification of the cognate tumor antigen (s) , leading to the development of more therapeutic TCRs and other immunotherapeutic strategies for treatment of liver cancer. This can also help in the design of vaccines or immunotherapies that target the tumor antigen and stimulate an immune response against the cancer cells.
[0027] In some forms, TCR-expressing vectors can be used to generate T cell clones that recognize the specific tumor antigen. These T cell clones can then be used to screen libraries of peptides derived from the tumor antigen to identify the specific peptide epitope recognized by the TCR. This can aid in the development of personalized immunotherapies that target the patient's specific tumor antigens.
[0028] In some forms the disclosed TCRs can be expressed in specific cells to study their function and activation in response to various stimuli which can help elucidate T cell biology.
[0029] Also disclosed are the methods of identifying TCRs. These methods include generating a liver cancer animal model that mimics the multi-stage and multi-hit process of human liver carcinogenesis. Liver cancer was induced by ablating Trp53 and Pten using CRISPR, and over-expressing Myc using a transposon vector. The specific delivery of plasmids to hepatocytes was achieved by hydrodynamic injection. Following induction of liver cancer, single-cell TCR-seq was used to identify TCR types. This technique was used to compare the TCR repertoire in healthy livers and those with HCC to identify TCRs specific to HCC.
[0030] Additional advantages of the disclosed method and compositions will be set forth in part in the description which follows, and in part will be understood from the description, or may be learned by practice of the disclosed method and compositions. The advantages of the disclosed method and compositions will be realized and attained by means of the elements and combinations particularly pointed out in the appended claims. It is to be understood that both the foregoing general description and the following detailed description are exemplary and explanatory only and are not restrictive of the invention as claimed.BRIEF DESCRIPTION OF THE DRAWINGS
[0031] Figs. 1A-1H show presence of immunosurveillance in CRISPR-and transposon-induced hepatocellular carcinoma in mice. Fig. 1A shows schematic diagrams of the plasmids used to induce (top) CRISPR / Cas9-mediated deletion of Trp53 and Pten, and (bottom) transposon-mediated overexpression of Myc in mouse livers. Arrowheads indicate tumor nodules. Fig. 1B shows representative macroscopic views of livers from mice injected with the combination of plasmids shown in panel (Fig. 1A) at the indicated days post-injection. Control received transposase vector only. Fig. 1C shows representative histological sections of tumor-burdened livers immunostained to detect MYC, P53 and PTEN. Fig. 1D shows distribution of immunostained liver tumor nodules from the livers in (Fig. 1C) . Numbers of tumor nodules with the indicated immunostaining patterns are labeled in the pie plot, which is a summary of two independent experiments. Sections were resected from 3 mice / group on day 25 of HCC induction. Figs. 1E-1F are representative flow cytometry plots (Fig. 1E) and quantification (Fig. 1F) showing changes in the percentages of the indicated immune cell populations during the development of liver cancer in mice. In Fig. 1F, each dot represents an individual mouse. Significance was assessed by unpaired, two-tailed t-test; *p<0.05 and **p<0.01, representative of three independent experiments. Control group received transposase vector only. Fig. 1G shows representative histological sections from HCC-bearing livers that were immunostained to detect MYC or CD3 in areas of either (left) preneoplastic cells or (right) HCCs. Fig. 1H shows survival of immunodeficient (NSG) and control WT mice (n=10 / group) following injection of Trp53 / Pten CRISPR and Myc overexpression plasmids to induce HCC development. p=0.001 by log-rank test.
[0032] Figs. 2A-2D show scRNAseq of CD4+ T cells in HCC. Figs 2A-2B show the transcriptional landscape of CD4+ T cells in livers from control and HCC mice. UMAP representation of total hepatic CD4+ T cells (Fig. 2A) and split according to HCC conditions (Fig. 1B) , based on scRNAseq analysis. CD4+ T cells were sorted from 4 HCC mice and 4 control mice. Cells from each mouse were stained with unique barcoded antibodies. Fig. 2C is a bubble plot comparing expression of Chat and the indicated marker genes across the 11 clusters in (Fig. 2A-2B) . Fig. 2D is a heatmap depicting the relative expression of the indicated genes in cluster C3 (Cxcr6+Pdcd1+) and cluster C7 (Cxcr6+Pdcd1-) .
[0033] Figs. 3A-3E show Clonal expansion of CD4+ T cells in HCC. Figs 3A-3B show circos plots showing the distribution of TCR types among CD4+ T cells from control (Fig. 3A) and HCC-bearing (Fig. 3B) mice. T cells of the same TCR type are those sharing the same TCR-α chain and TCR-β chain in amino acid sequences. The top 30 TCRs are numbered and highlighted with different colors. Fig. 3C shows CDR3 sequences of clonotypes encoding TCR #1.
[0034] TCR-β CDR3 of TCR #1 nucleotide sequence of Clone 1 is SEQ ID NO: 1; Clone 3 is SEQ ID NO: 2; Clone 5 is SEQ ID NO: 3; Clone 10 is SEQ ID NO: 4; Clone 14 is SEQ ID NO: 5; Clone 21 is SEQ ID NO: 6; Clone 22 is SEQ ID NO: 7; Clone 25 is SEQ ID NO: 8; Clone 32 is SEQ ID NO: 9; Clone 42 is SEQ ID NO: 10; Clone 49 is SEQ ID NO: 11; Clone 54 is SEQ ID NO: 12; Clone 63 is SEQ ID NO: 13; Clone 64 is SEQ ID NO: 14; Clone 83 is SEQ ID NO: 15; Clone 124 is SEQ ID NO: 16; Clone 133 is SEQ ID NO: 17; Clone 134 is SEQ ID NO: 18; Clone 140 is SEQ ID NO: 19; Clone 209 is SEQ ID NO: 20; Clone 222 is SEQ ID NO: 21; Clone 248 is SEQ ID NO: 22; Clone 266 is SEQ ID NO: 23; Clone 461 is SEQ ID NO: 24; and Clone 862 is SEQ ID NO: 25. The amino acid sequence of TCR-β CDR3 of TCR #1 is SEQ ID NO: 55.
[0035] TCR-α CDR3 of TCR #1 nucleotide sequence of Clone 1 is SEQ ID NO: 25; Clone 3 is SEQ ID NO: 26; Clone 5 is SEQ ID NO: 27; Clone 10 is SEQ ID NO: 29; Clone 14 is SEQ ID NO: 30; Clone 21 is SEQ ID NO: 31; Clone 22 is SEQ ID NO: 32; Clone 25 is SEQ ID NO: 33; Clone 32 is SEQ ID NO: 34; Clone 42 is SEQ ID NO: 35; Clone 49 is SEQ ID NO: 36; Clone 54 is SEQ ID NO: 37; Clone 63 is SEQ ID NO: 38; Clone 64 is SEQ ID NO: 39; Clone 83 is SEQ ID NO: 40; Clone 124 is SEQ ID NO: 41; Clone 133 is SEQ ID NO: 42; Clone 134 is SEQ ID NO: 43; Clone 140 is SEQ ID NO: 44; Clone 209 is SEQ ID NO: 45; Clone 222 is SEQ ID NO: 46; Clone 248 is SEQ ID NO: 47; Clone 266 is SEQ ID NO: 48; Clone 461 is SEQ ID NO: 49; and Clone 862 is SEQ ID NO: 50. The amino acid sequence of TCR-α CDR3 of TCR #1 is SEQ ID NO: 58.
[0036] Fig. 3D shows the composition of cell clusters in the indicated T cell clonotypes of TCR #1, color-coded by cell clusters. Each bar represents an individual clonotype and is labeled with the Clone ID as shown in (Fig. 3C) . Horizontal axis labels indicate cell numbers.
[0037] Fig. 3E is a UMAP representation of CD4+ T cells bearing TCR #1 induced in HCC, color-coded by cell clusters and shape-coded by mouse ID.
[0038] Figs. 4A-4D show nucleotide and amino acid sequences of clone5 of HCC TCR #1. Figs. 4A-4B show the nucleotide sequence of Trbv (Fig. 4A, SEQ ID NO: 59) and Trav (Fig. 4B, SEQ ID NO: 60) of TCR clone5. The gene segments were denoted with different colors. Figs. 4C-4D are the amino acid sequence of Trbv (Fig. 4C, SEQ ID NO: 51) and Trav (Fig. 4D, SEQ ID NO: 52) of TCR clone5. The gene segments were denoted with different colors.
[0039] Figs. 5A-5B shows development of an engineered expression cassette for HCC-specific TCR. Fig. 5A is a schematic diagram of the engineered construct for the expression of HCC-specific TCR. Fig. 5B show the sequence of the construct in part. The entire construct sequence is SEQ ID NO: 61) . The parts of the construct are: FiBL signal (amino acids 1 to 17 of SEQ ID NO: 61) , TCRb variable region (amino acids 18 to 129 of SEQ ID NO: 61) , TCRb constant region (amino acids 130 to 302 of SEQ ID NO: 51) , Furin cleavage site (amino acids 303 to 306 of SEQ ID NO: 61) , Flexible linker (amino acids 307 to 310 of SEQ ID NO: 61) , T2A (amino acids 311 to 328 of SEQ ID NO: 61) , FiBL signal (amino acids 329 to 345 of SEQ ID NO: 61) , TCRa variable region (amino acids 346 to 457 of SEQ ID NO: 61) , and TCRa constant region (amino acids 458 to 593 of SEQ ID NO: 61) .DETAILED DESCRIPTION OF THE INVENTION
[0040] The disclosed method and compositions can be understood more readily by reference to the following detailed description of particular embodiments and the Example included therein and to the Figures and their previous and following description.
[0041] A. DEFINITIONS
[0042] Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains.
[0043] As used herein, the singular forms “a” , “an” , and “the” include both singular and plural referents unless the context clearly dictates otherwise.
[0044] “Encode, ” as used in reference to a nucleotide sequence of nucleic acid encoding a gene product, e.g., a protein, of interest, is meant to include instances in which a nucleic acid contains a nucleotide sequence that is the same as the endogenous sequence, or a portion thereof, of a nucleic acid found in a cell or genome that, when transcribed and / or translated into a polypeptide, produces the gene product. In some instances, a nucleotide sequence or nucleic acid encoding a gene product does not include intronic sequences. In particular instances, a nucleotide sequence or nucleic acid encoding a T cell receptor includes a nucleotide sequence that can be translated, in silico, into an amino acid sequence corresponding to variable and constant domains of a T cell receptor, with no intervening intronic sequences.
[0045] As used herein, the term “nucleic acid, ” in its broadest sense, refers to any compound and / or substance that is or can be incorporated into an oligonucleotide chain. In some forms, a nucleic acid is a compound and / or substance that is or can be incorporated into an oligonucleotide chain via a phosphodiester linkage. In some forms, “nucleic acid” refers to individual nucleic acid residues (e.g., nucleotides and / or nucleosides) . In some forms, “nucleic acid” refers to an oligonucleotide chain including individual nucleic acid residues. As used herein, the terms “oligonucleotide” and “polynucleotide” can be used interchangeably. In some forms, “nucleic acid” encompasses RNA as well as single and / or double-stranded DNA and / or cDNA, any natural or synthetic linear and sequential arrays of nucleotides and nucleosides, for example, replicating RNA (repRNA) , messenger RNA (mRNA) , small interfering RNA (siRNA) , transfer RNA (tRNA) , microRNA (miRNA) , guide strand RNA (sgRNA) , polynucleotides, oligo-nucleotides, oligo-nucleosides and derivatives thereof. Such nucleic acids may be collectively referred to as “constructs, ” or “plasmids. ” Furthermore, the terms “nucleic acid” , “DNA” , “RNA” , and / or similar terms include nucleic acid analogs, i.e., analogs having other than a phosphodiester backbone. For example, the so-called “peptide nucleic acids, ” which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention. The term “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and / or encode the same amino acid sequence. Nucleotide sequences that encode proteins and / or RNA may include introns. Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can include nucleoside analogs such as analogs having chemically modified bases or sugars, backbone modifications, etc. A nucleic acid sequence is presented in the 5' to 3' direction unless otherwise indicated. The term “nucleic acid segment” is used herein to refer to a nucleic acid sequence that is a portion of a longer nucleic acid sequence. In many forms, a nucleic acid segment includes at least 3, 4, 5, 6, 7, 8, 9, l 0, or more residues. In some forms, a nucleic acid is or includes natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine) ; nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynylcytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, 0 (6) -methylguanine, and 2-thiocytidine) ; chemically modified bases; biologically modified bases (e.g., methylated bases) ; intercalated bases; modified sugars (e.g., 2'-fluororibose, ribose, 2'-deoxyribose, arabinose, and hexose) ; and / or modified phosphate groups (e.g., phosphorothioates and 5'-N-phosphoramidite linkages) .
[0046] The term “antigen” refers to any substance (e.g., peptide, protein, nuclei acid, lipid, small molecule, such as a moiety expressed by or otherwise associated with a pathogen or cancerous or pre-cancerous cell) that serves as a target for the receptors of an adaptive immune response. The antigen may be a structural component of a pathogen, cancerous or pre-cancerous cell.
[0047] As used herein, the term “T cell antigen” refers to any antigen that is recognized by and triggers an immune response in a T cell (e.g., an antigen that is specifically recognized by a T cell receptor on a T cell via presentation of the antigen or portion thereof bound to a major histocompatibility complex molecule (MHC) . In some forms, an antigen that is a T cell antigen is also a B cell antigen. In other forms, the T cell antigen is not also a B cell antigen. T cells antigens generally are proteins or peptides. T cell antigens may be an antigen that stimulates a CD8+ T cell response, a CD4+ T cell response, or both. The nanocarriers, therefore, in some forms can effectively stimulate both types of responses.
[0048] As used herein, the term “target” or “marker” refers to any entity that is capable of specifically binding to a particular targeting moiety. In some forms, targets are specifically associated with one or more particular tissue types. In some forms, targets are specifically associated with one or more particular cell types. For example, a cell type specific marker is typically expressed at levels at least 2 fold greater in that cell type than in a reference population of cells. In some forms, the cell type specific marker is present at levels at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 50 fold, at least 100 fold, or at least 1000 fold greater than its average expression in a reference population. Detection or measurement of a cell type specific marker may make it possible to distinguish the cell type or types of interest from cells of many, most, or all other types. In some forms, a target can include a protein, a carbohydrate, a lipid, and / or a nucleic acid, as described herein. A substance is considered to be “targeted” for the purposes described herein if it specifically binds to a target. In some forms, a targeting moiety specifically binds to a target under stringent conditions. An inventive nanocarrier, such as a vaccine nanocarrier, including a targeting moiety is considered to be “targeted” if the targeting moiety specifically binds to a target, thereby delivering the entire nanocarrier to a specific organ, tissue, cell, and / or subcellular locale.
[0049] As used herein, the term “therapeutic agent” refers to any agent that, when administered to a subject, has a therapeutic, prophylactic, and / or diagnostic effect and / or elicits a desired biological and / or pharmacological effect.
[0050] The terms “high, ” “higher, ” “increases, ” “elevates, ” or “elevation” refer to increases above basal levels, e.g., as compared to a control. The terms “low, ” “lower, ” “reduces, ” or “reduction” refer to decreases below basal levels, e.g., as compared to a control.
[0051] The term “modulate” as used herein refers to the ability of a compound to change an activity in some measurable way as compared to an appropriate control. As a result of the presence of compounds in the assays, activities can increase or decrease as compared to controls in the absence of these compounds. Preferably, an increase in activity is at least 25%, more preferably at least 50%, most preferably at least 100%compared to the level of activity in the absence of the compound. Similarly, a decrease in activity is preferably at least 25%, more preferably at least 50%, most preferably at least 100%compared to the level of activity in the absence of the compound. A compound that increases a known activity is an “agonist” . One that decreases, or prevents, a known activity is an “antagonist” .
[0052] The term “inhibit” means to reduce or decrease in activity or expression. This can be a complete inhibition or activity or expression, or a partial inhibition. Inhibition can be compared to a control or to a standard level. Inhibition can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%.
[0053] The term “monitoring” as used herein refers to any method in the art by which an activity can be measured.
[0054] The term “providing” as used herein refers to any means of adding a compound or molecule to something known in the art. Examples of providing can include the use of pipettes, pipettemen, syringes, needles, tubing, guns, etc. This can be manual or automated. It can include transfection by any mean or any other means of providing nucleic acids to dishes, cells, tissue, cell-free systems and can be in vitro or in vivo.
[0055] The term “preventing” as used herein refers to administering a compound prior to the onset of clinical symptoms of a disease or conditions so as to prevent a physical manifestation of aberrations associated with the disease or condition.
[0056] The term “in need of treatment” as used herein refers to a judgment made by a caregiver (e.g. physician, nurse, nurse practitioner, or individual in the case of humans; veterinarian in the case of animals, including non-human mammals) that a subject requires or will benefit from treatment. This judgment is made based on a variety of factors that are in the realm of a care giver's expertise, but that include the knowledge that the subject is ill, or will be ill, as the result of a condition that is treatable by the compounds of the invention.
[0057] As used herein, “subject” includes, but is not limited to, animals, plants, bacteria, viruses, parasites and any other organism or entity. The subject can be a vertebrate, more specifically a mammal (e.g., a human, horse, pig, rabbit, dog, sheep, goat, non-human primate, cow, cat, guinea pig or rodent) , a fish, a bird or a reptile or an amphibian. The subject can be an invertebrate, more specifically an arthropod (e.g., insects and crustaceans) . The term does not denote a particular age or sex. Thus, adult and newborn subjects, as well as fetuses, whether male or female, are intended to be covered. A patient refers to a subject afflicted with a disease or disorder. The term “patient” includes human and veterinary subjects.
[0058] By “treatment” and "treating" is meant the medical management of a subject with the intent to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder. This term includes active treatment, that is, treatment directed specifically toward the improvement of a disease, pathological condition, or disorder, and also includes causal treatment, that is, treatment directed toward removal of the cause of the associated disease, pathological condition, or disorder. In addition, this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder. It is understood that treatment, while intended to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder, need not actually result in the cure, amelioration, stabilization or prevention. The effects of treatment can be measured or assessed as described herein and as known in the art as is suitable for the disease, pathological condition, or disorder involved. Such measurements and assessments can be made in qualitative and / or quantitiative terms. Thus, for example, characteristics or features of a disease, pathological condition, or disorder and / or symptoms of a disease, pathological condition, or disorder can be reduced to any effect or to any amount.
[0059] A cell can be in vitro. Alternatively, a cell can be in vivo and can be found in a subject. A “cell” can be a cell from any organism including, but not limited to, a bacterium.
[0060] By the term “effective amount” of a compound as provided herein is meant a nontoxic but sufficient amount of the compound to provide the desired result. As will be pointed out below, the exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease that is being treated, the particular compound used, its mode of administration, and the like. Thus, it is not possible to specify an exact “effective amount. ” However, an appropriate effective amount can be determined by one of ordinary skill in the art using only routine experimentation.
[0061] The dosages or amounts of the compounds described herein are large enough to produce the desired effect in the method by which delivery occurs. The dosage should not be so large as to cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. Generally, the dosage will vary with the age, condition, sex and extent of the disease in the subject and can be determined by one of skill in the art. The dosage can be adjusted by the individual physician based on the clinical condition of the subject involved. The dose, schedule of doses and route of administration can be varied.
[0062] By “pharmaceutically acceptable” is meant a material that is not biologically or otherwise undesirable, i.e., the material can be administered to a subject along with the selected compound without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained.
[0063] The term “vector” refers to a nucleic acid molecule or polynucleotide, such as a replicating RNA, plasmid, phage, or cosmid, into which another nucleic acid sequence segment may be inserted so as to bring about the replication of the inserted segment. The described vectors can be expression vectors. Vector also refers to a molecule incorporating nucleic acid sequences encoding regulatory elements for transcription, translation, transcript stability, replication, and other functions as are known in the art vector" refers to a molecule incorporating nucleic acid sequences encoding regulatory elements for transcription, translation, transcript stability, replication, and other functions as are known in the art. A vector may be a nucleic acid such as a plasmid or other DNA vector. The vector may comprise one or more genes in a linear or circularized configuration. The vector may also have a “plasmid backbone” that is involved in the production, manufacture, or analysis of a gene product. An "expression vector" is a vector that allows for production of a product encoded for by a nucleic acid sequence contained in the vector. For example, expression of a particular growth factor protein encoded by a particular gene. A "gene product" means products encoded by the nucleic acid sequences of the vector.
[0064] The term “gene” or “genes” refers to isolated or modified nucleic acid sequences, including both RNA and DNA, that encode genetic information for the synthesis of a whole RNA, a whole protein, or any portion of such whole RNA or whole protein. Genes that are not naturally part of a particular organism's genome are referred to as “foreign genes” , “heterologous genes” or “exogenous genes” and genes that are naturally a part of a particular organism's genome are referred to as “endogenous genes” . The term “gene” as used with reference to genomic DNA includes intervening, non-coding regions as well as regulatory regions and can include 5’ and 3’ ends.
[0065] The term “expressed” or “expression” refers to the transcription from DNA to an RNA nucleic acid molecule at least complementary in part to a region of one of the two nucleic acid strands of the gene. The term “expressed” or “expression” also refers to the translation from said RNA nucleic acid molecule to give a protein or polypeptide or a portion thereof.
[0066] The term “coding region” refers to a portion of nucleic acid containing codons which may be translated into amino acids, although "stop codons" (TAG, TGA, or TAA) are not translated into an amino acids, but may also be considered to be part of a coding region. Unless stated otherwise, promoters, ribosome binding sites, transcriptional terminators, introns, and the like, are not considered part of a coding region. Coding regions of the present invention can be present in a single polynucleotide construct, e.g., on a single vector, or in separate polynucleotide constructs, e.g., on separate (different) vectors. Furthermore, any vector may contain a single coding region, or may comprise two or more coding regions. In addition, a vector, polynucleotide, or nucleic acid embodiments may encode heterologous coding regions, either fused or unfused to a nucleic acid encoding a different heterologous polypeptide. Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain.
[0067] The term "regulatory element" refers to a DNA sequence that controls and regulates the transcription of another DNA sequence.
[0068] The term "promoter" refers to a nucleic acid sequence sufficient to direct transcription of a gene. Also included in the invention are those promoter elements which are sufficient to render promoter dependent gene expression controllable for cell type specific, tissue specific or inducible by external signals or agents. Promoters that are induced and cause a gene to be expressed following exposure or treatment of the cell with an agent, biological molecule, chemical, ligand, light, or the like that induces the promoter are commonly referred to as "inducible promoters" or "regulatable” promoters.
[0069] As used herein, the terms “approximately” or “about” in reference to a number are generally taken to include numbers that fall within a range of 5%, 10%, 15%, or 20%in either direction (greater than or less than) of the number unless otherwise stated or otherwise evident from the context (except where such number would be less than 0%or exceed 100%of a possible value) .
[0070] The terms “immunologic” , “immunological” or “immune” response refer to the development of a beneficial humoral (antibody mediated) and / or a cellular (mediated by antigen-specific T cells or their secretion products) response directed against an immunogen in a recipient patient. Such a response can be an active response induced by administration of immunogen or a passive response induced by administration of antibody or primed T-cells. The relative contributions of humoral and cellular responses to the protective or therapeutic effect of an immunogen can be distinguished by separately isolating antibodies and T-cells from an immunized syngeneic animal and measuring protective or therapeutic effect in a second subject.
[0071] As used herein, the term “immunostimulatory agent” refers to an agent that modulates an immune response to an antigen but is not the antigen or derived from the antigen. “Modulate” , as used herein, refers to inducing, enhancing, suppressing, directing, or redirecting an immune response. Such agents include immunostimulatory agents that stimulate (or boost) an immune response to an antigen but, as defined above, is not the antigen or derived from the antigen. Immunostimulatory agents, therefore, include adjuvants. In some forms, the immunostimulatory agent is on the surface of the nanocarrier and / or is encapsulated within the nanocarrier. In some forms, the immunostimulatory agent on the surface of the nanocarrier is different from the immunostimulatory agent encapsulated within the nanocarrier. In some forms, the nanocarrier includes more than one type of immunostimulatory agent. In some forms, the more than one type of immunostimulatory agent act on different pathways. Examples of immunostimulatory agents include those provided elsewhere herein.
[0072] As used herein, the terms “single guide RNA” or “sgRNA” refer to the polynucleotide sequence comprising the guide sequence, tracr sequence and the tracr mate sequence. “Guide sequence” refers to the around 20 base pair (bp) sequence within the guide RNA that specifies the target site and may be used interchangeably with the terms “guide” or “spacer. ”
[0073] The terms “Cas9, ” “Cas9 protein, ” or “Cas9 nuclease” refer to a RNA-guided endonuclease that is a Cas9 protein that catalyzes the site-specific cleavage of double stranded DNA. Also, referred to as “Cas nuclease” or “CRISPR-associated nuclease. ”
[0074] Use of the term “about” is intended to describe values either above or below the stated value in a range of approx. + / -10%; in other forms the values may range in value either above or below the stated value in a range of approx. + / -5%; in other forms the values may range in value either above or below the stated value in a range of approx. + / -2%; in other forms the values may range in value either above or below the stated value in a range of approx. + / -1%.The preceding ranges are intended to be made clear by context, and no further limitation is implied. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., "such as" ) provided herein, is intended merely to better illuminate the disclosure and does not pose a limitation on the scope of the disclosure unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the disclosure.
[0075] Every compound disclosed herein is intended to be and should be considered to be specifically disclosed herein. Further, every subgroup that can be identified within this disclosure is intended to be and should be considered to be specifically disclosed herein. As a result, it is specifically contemplated that any compound, or subgroup of compounds can be either specifically included for or excluded from use or included in or excluded from a list of compounds.
[0076] Disclosed are the components to be used to prepare the disclosed compositions as well as the compositions themselves to be used within the methods disclosed herein. These and other materials are disclosed herein, and it is understood that when combinations, subsets, interactions, groups, etc. of these materials are disclosed that while specific reference of each various individual and collective combinations and permutation of these compounds may not be explicitly disclosed, each is specifically contemplated and described herein. For example, if a particular polypeptide is disclosed and discussed and a number of modifications that can be made to a number of polypeptides are discussed, specifically contemplated is each and every combination and permutation of polypeptides and the modifications that are possible unless specifically indicated to the contrary. Thus, if a class of molecules A, B, and C are disclosed as well as a class of molecules D, E, and F and an example of a combination molecule, A-D is disclosed, then even if each is not individually recited each is individually and collectively contemplated meaning combinations, A-E, A-F, B-D, B-E, B-F, C-D, C-E, and C-F are considered disclosed. Likewise, any subset or combination of these is also disclosed. Thus, for example, the sub-group of A-E, B-F, and C-E would be considered disclosed. This concept applies to all aspects of this application including, but not limited to, steps in methods of making and using the disclosed compositions. Thus, if there are a variety of additional steps that can be performed it is understood that each of these additional steps can be performed with any specific form or combination of forms of the disclosed methods.
[0077] B. COMPOSITIONS
[0078] 1. Immune Proteins
[0079] Disclosed are immune proteins related to or derived from T-cell receptors (TCRs) discovered to be associated with liver cancer. The disclosed immune proteins generally include and / or retain functional portions of the discovered TCRs. For example, in some forms, the immune proteins include (a) Complementarity Determining Regions (CDRs) having the sequences SGHSA (SEQ ID NO: 53) , FRNQAP (SEQ ID NO: 54) , and ASSLDRGQDTQY (SEQ ID NO: 55) , (b) CDRs having the sequences TISGNEY (SEQ ID NO: 56) , GLQQN (SEQ ID NO: 57) , and ILRGTGGNNKLT (SEQ ID NO: 58) , or (c) both.
[0080] In some forms, the immune proteins include comprising (a) a TCR β chain variable domain (TCR-β domain) comprising Complementarity Determining Regions (CDRs) having the sequences SGHSA (SEQ ID NO: 53) , FRNQAP (SEQ ID NO: 54) , and ASSLDRGQDTQY (SEQ ID NO: 55) , (b) a TCR α chain variable domain (TCR-α domain) comprising CDRs having the sequences TISGNEY (SEQ ID NO: 56) , GLQQN (SEQ ID NO: 57) , and ILRGTGGNNKLT (SEQ ID NO: 58) , or (c) both. In some forms, the immune proteins include a T-cell receptor (TCR) that includes the TCR-β domain, the TCR-α domain, or both.
[0081] In some forms, the TCR-β domain has a sequence identity of at least 75%to SEQ ID NO: 51 and the TCR-α domain has a sequence identity of at least 75%to SEQ ID NO: 52. In some forms, the TCR-β domain has a sequence identity of at least 85%to SEQ ID NO: 51 and the TCR-α domain has a sequence identity of at least 85%to SEQ ID NO: 52. In some forms, the TCR-β domain has a sequence identity of at least 90%to SEQ ID NO: 51 and the TCR-αdomain has a sequence identity of at least 90%to SEQ ID NO: 52. In some forms, the TCR-β domain has a sequence identity of at least 95%to SEQ ID NO: 51 and the TCR-α domain has a sequence identity of at least 95%to SEQ ID NO: 52. In some forms, the TCR-β domain has a sequence identity of at least 75%to SEQ ID NO: 51 and the TCR-α domain has a sequence identity of at least 75%to SEQ ID NO: 52. In some forms, the TCR-β domain includes the sequence SEQ ID NO: 51, and the TCR-α domain includes the sequence SEQ ID NO: 52.
[0082] In some forms, the immune protein targets hepatocellular carcinoma (HCC) antigens.
[0083] 2. T-cell receptors
[0084] It was observed that convergent TCR sequences in T cells that are reactive to specific tumor antigens and expanded in hepatocellular carcinoma across individual animals. These findings demonstrate that T cells carrying this specific TCR amino acid sequence are important for anti-tumor immune responses. Convergent TCRs are particularly significant in cancer immunotherapy because they offer a more efficient way to identify and isolate tumor-reactive T cells for use in adoptive cell therapy. By isolating T cells from HCC-bearing liver tissue and performing single-cell RNA sequencing on both the transcriptome and TCR, the identified tumor-specific TCR sequences are more relevant to the tumor-responsive T cells in vivo. Additionally, the observation of TCR convergence and clonal expansion in different mice indicates the existence of specific and immunogenic tumor antigens corresponding to this TCR. This methodology provides important avenue for the development of new immunotherapies for liver cancer, utilizing the identified HCC-specific TCR sequences.
[0085] Disclosed are T-cell receptors (TCRs) that can specifically target liver cancer cells. Exemplary T-cell receptors (TCRs) contain TCR β chain variable domain and α chain variable domain. The TCR β chain variable domain has the sequence:
[0086] NAGVIQTPRHKVTGKGQEATLWCEPISGHSAVFWYRQTIVQGLEFLTYFRNQAPID DSGMPKERFSAQMPNQSHSTLKIQSTQPQDSAVYLCASSLDRGQDTQYFGPGTRLL VL (SEQ ID NO: 51) . TRB-CDR1is Bold; TRB-CDR2 is Italic; TRB-CDR3 is Bold Italic. The α chain variable domain has the sequence:
[0087] DAKTTQPDSMESTEGETVHLPCSHATISGNEYIYWYRQVPLQGPEYVTHGLQQNTT NSMAFLAIASDRKSSTLILPHVSLRDAAVYHCILRGTGGNNKLTFGQGTVLSVIP (SEQ ID NO: 52) . TRA-CDR1is Bold; TRA-CDR2 is Italic; TRA-CDR3 is Bold Italic. The three Complementarity Determining Regions (CDRs) of the β chain variable domain comprise: CDR1: SGHSA (SEQ ID NO: 53) , CDR2: FRNQAP (SEQ ID NO: 54) , CDR3: ASSLDRGQDTQY (SEQ ID NO: 55) , and wherein the three CDRs of the α chain variable domain comprise: CDR1: TISGNEY (SEQ ID NO: 56) , CDR2: GLQQN (SEQ ID NO: 57) and CDR3: ILRGTGGNNKLT (SEQ ID NO: 58) .
[0088] “T cell receptor” or “TCR” , as used herein, refers to a polypeptide expressed on the membrane surface of CD4+ and CD8+ T lymphocytes. TCRs are antigen receptors that function as a component of the immune system for recognition of peptides bound to self major histocompatibility complex (MHC) molecules on the surface of antigen presenting cells. The TCR may be a heterodimer of two disulfide-linked transmembrane polypeptide chains, α and β, or γ and δ. Each of these four TCR polypeptide chains is encoded by a distinct genetic locus containing multiple discontinuous gene segments. These include variable (V) region gene segments, joining (J) region gene segments and constant (C) region gene segments. Beta and delta chains contain an additional element termed the diversity (D) gene segment. The variable region contributes to the determination of the particular antigen and MHC molecule to which the TCR has binding specificity. The term TCR, as used herein, includes each of the four polypeptide chain individually, as well as biologically active fragments thereof, including fragments soluble in aqueous solutions, of either chain alone or both chains joined. Biologically active fragments may maintain the ability to bind with specificity to a specific antigen.
[0089] A TCR “subtype, ” as used herein, refers to a group of TCR polypeptide chains that belongs to α, β, γ or δ chains. Thus in some instances, TCR polypeptides belonging to the same subtype may have different variable regions but may have the same constant region.
[0090] In some forms, TCRα and TCRβ variable domains disclosed herein can be fused with any TCR constant regions.
[0091] In some forms, the CDRs of TCRα and TCRβ disclosed herein can be fused to variable regions of an antibody to form antigen-binding domains. The term antibody herein refers to natural or synthetic polypeptides that bind a target antigen. The term includes polyclonal and monoclonal antibodies, including intact antibodies and functional (e.g., antigen-binding) antibody fragments, including Fab fragments, F (ab') 2 fragments, Fab' fragments, Fv fragments, recombinant IgG (rlgG) fragments, single chain antibody fragments, including single chain variable fragments (scFv) , and single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments. The term encompasses genetically engineered and / or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multispecific, e.g., bispecific, antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv, tandem tri scFv. The term also encompasses intact or full-length antibodies, including antibodies of any class or subclass, including IgG and sub classes thereof, IgM, IgE, IgA, and IgD. Thus, although typically discussed in the context of IgG, the target antibody of the Ig-Fc-specific immunoglobulin variable domain can be another IgG subtype, or isotype such as IgM, IgE, IgA, or IgD.
[0092] In some forms, TCRα and TCRβ variable domains and the CDRs disclosed herein can form part of the antigen-binding domains of CAR-T cells.
[0093] 3. Human Cells
[0094] In some forms, cells are obtained from a human subject. For example, in some forms, the cells are autologous cells, i.e., cells obtained from a subject prior to introduction of the TCR polypeptides, and / or nucleic acids, or vectors encoding TCR polypeptides, and re-introduction to the same subject following modification. In other forms, the cells are heterologous cells, i.e., cells obtained from a different subject than the intended recipient. In some forms, the cells are frozen prior to or after introduction of the TCR polypeptides, and / or nucleic acids, or vectors encoding TCR polypeptides. Methods and compositions for freezing and thawing viable eukaryotic cells are known in the art. In some forms, the cells are autologous immune cells, such as T cells or progenitor cells / stem cells.
[0095] In some forms, cells are obtained from a healthy subject. In other forms, cells are obtained from a subject identified as having or at risk of having a disease or disorder, such as cancer and / or an auto-immune disease.
[0096] In some forms, the introduction of the TCR polypeptides to the cells occurs through genetic modification of the cells. In some forms, genetic modification of the cell includes introduction of nucleic acids, or vectors encoding TCR polypeptides to the cell for expression of the TCR polypeptides within the cell and presentation at the cell surface. In some forms, genetic modification of the cell includes transduction with a transposon encoding a TCR polypeptide. In some form, a TCR peptide is introduced into a cell in vitro by transduction of the cell with a nucleic acid encoding a transposon including the TCR.
[0097] i. T Cells
[0098] In some forms, the cells are human immune cells, such as T cells. Therefore, in some forms, prior to expansion and genetic modification, T cells are obtained from a diseased or healthy subject. In some forms, the T cells are autologous T cells obtained from a subject prior to ex vivo genetic modification (i.e., to express TCRs of interest) and re-introduction to the same subject in vivo as genetically modified T Cells that expresses TCRs of interest such as the ones identified herein.
[0099] T cells can be obtained from a number of samples, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In some forms, T cells are obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FICOLLTM separation. In one preferred form, cells from the circulating blood of an individual are obtained by apheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. The cells collected by apheresis can be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In some forms, the cells are washed with phosphate buffered saline (PBS) . In some forms, the wash solution lacks calcium and can lack magnesium or can lack many if not all divalent cations. After washing, the cells can be resuspended in a variety of biocompatible buffers, such as, for example, Ca2+ free, Mg2+free PBS, PLASMALYTE A, or other saline solution with or without buffer. Alternatively, the undesirable components of the apheresis sample are removed and the cells directly resuspended in culture media.
[0100] In some forms, T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient or by counterflow centrifugal elutriation. In specific forms, a specific subpopulation of T cells, such as CD3+, CD28+, CD4+, CD8+, CD45RA+, and CD45RO+T cells, is further isolated by positive or negative selection techniques. For example, in some forms, T cells are isolated by incubation with anti CD3 / anti CD28 (i.e., 3×28) conjugated beads, such as M 450 CD3 / CD28 T, for a time period sufficient for positive selection of the desired T cells. Therefore, T cells expressing heterologous TCRs identified herein at the surface of the T cells are provided.
[0101] In certain forms, the T cells are genetically modified T cells. For example, in some forms, the T cells are genetically modified to reduce, prevent or otherwise alter the expression of one or more genes within the “wild-type” T cell, in addition to the inclusion and expression of the TCRs within the same T cell. In some forms, the T cell is modified to reduce or prevent expression of one or more surface receptors that may interfere with the function or structure of the TCRs disclosed herein.
[0102] ii. Delivery Vehicle
[0103] Any of the disclosed compositions including, but not limited to disclosed TCR proteins, and / or nucleic acids, can be delivered to target cells using a delivery vehicle. The delivery vehicles can be, for example, polymeric particles, inorganic particles, silica particles, liposomes, micelles, multilamellar vesicles, etc.
[0104] Delivery vehicles may be microparticles or nanoparticles. Nanoparticles are often utilized for inter-tissue application, penetration of cells, and certain routes of administration. The nanoparticles may have any desired size for the intended use. The nanoparticles may have any diameter from 10 nm up to about 1,000 nm. The nanoparticle can have a diameter from 10 nm to 900 nm, from 10 nm to 800 nm, from 10 nm to 700 nm, from 10 nm to 600 nm, from 10 nm to 500 nm, from 20 nm from 500 nm, from 30 nm to 500 nm, from 40 nm to 500 nm, from 50 nm to 500 nm, from 50 nm to 400 nm, from 50 nm to 350 nm, from 50 nm to 300 nm, or from 50 nm to 200 nm. In some forms the nanoparticles can have a diameter less than 400 nm, less than 300 nm, or less than 200 nm. The range can be between 50 nm and 300 nm.
[0105] Thus, in some forms, the delivery vehicles are nanoscale compositions, for example, 10 nm up to, but not including, about 1 micron. However, it will be appreciated that in some forms, and for some uses, the particles can be smaller, or larger (e.g., microparticles, etc. ) . Although many of the compositions can be referred to as nanoparticle or nanocarrier compositions, it will be appreciated that in some forms and for some uses the carrier can be somewhat larger than nanoparticles. Such compositions can be referred to as microparticulate compositions. Microparticles can have a diameter between, for example, 0.1 and 100 μm in size.
[0106] 4. Pharmaceutical Compositions
[0107] In some forms, pharmaceutical compositions containing a genetically modified cell, or a population of genetically modified cells expressing dislosed TCR proteins can be administered to a subject.
[0108] In some forms, the pharmaceutical compositions include one or more of a pharmaceutically acceptable buffer, carrier, diluent or excipients. In some forms, the pharmaceutical compositions include a specific number or population of cells, for example, expanded by culturing and expanding an isolated genetically modified cell (e.g., T cells expressing disclosed TCRs) , e.g., a homogenous population. Therefore, in some forms, pharmaceutical compositions include a homogenous population of modified cells including and / or expressing a disclosed TCR peptide. In other forms, the pharmaceutical compositions include populations of cells that contain variable or different genetically modified cells, e.g., a heterogeneous population. In some forms, the pharmaceutical compositions include cells that are bispecific or multi-specific. Any of the compositions can include one or more species of human monoclonal antibodies, for example, targeting a specific antigen to which the T cells expressing disclosed TCRs are intended to be targeted against.
[0109] In some forms, the cells have been isolated from a diseased or healthy subject prior to genetic modification to express a disclosed TCR peptide.
[0110] The term “pharmaceutically acceptable carrier” describes a pharmaceutically acceptable material, composition, or vehicle that is involved in carrying or transporting a compound of interest from one tissue, organ, or portion of the body to another tissue, organ, or portion of the body. For example, in some forms the carrier is a liquid or solid filler, diluent, excipient, solvent, or encapsulating material, or a combination thereof. Each component of the carrier must be “pharmaceutically acceptable” in that it must be compatible with the other ingredients of the formulation. It must also be suitable for use in contact with any tissues or organs with which it may come in contact, meaning that it must not carry a risk of toxicity, irritation, allergic response, immunogenicity, or any other complication that excessively outweighs its therapeutic benefits.
[0111] In some forms, pharmaceutical compositions include buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide) ; and preservatives. The pharmaceutical compositions can be formulated for delivery via any route of administration. The term “Route of administration” can refer to any administration pathway known in the art, including but not limited to aerosol, nasal, oral, intravenous, intramuscular, intraperitoneal, inhalation, transmucosal, transdermal, parenteral, implantable pump, continuous infusion, topical application, capsules and / or injections. The pharmaceutical compositions are preferably formulated for intravenous administration.
[0112] Typically, the disclosed pharmaceutical compositions are administered in a manner appropriate to a disease to be treated (or prevented) . The quantity and frequency of administration is typically determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages can be determined by clinical trials.
[0113] The disclosed pharmaceutical compositions can be delivered in a therapeutically effective amount. The precise therapeutically effective amount is that amount of the composition that will yield the most effective results in terms of efficacy of treatment in a given subject. This amount will vary depending upon a variety of factors, including but not limited to the characteristics of the therapeutic compound (including activity, pharmacokinetics, pharmacodynamics, and bioavailability) , the physiological condition of the subject (including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage, and type of medication) , the nature of the pharmaceutically acceptable carrier or carriers in the formulation, and the route of administration. One skilled in the clinical and pharmacological arts will be able to determine a therapeutically effective amount through routine experimentation, for instance, by monitoring a subject's response to administration of a compound and adjusting the dosage accordingly. For additional guidance, see Remington: The Science and Practice of Pharmacy (Gennaro ed. 20th edition, Williams &Wilkins PA, USA) (2000) .
[0114] C. METHODS OF USE
[0115] Methods of using compositions including disclosed TCR proteins and / or T-cells expressing disclosed TCRs are provided.
[0116] In particular forms, the methods provide enhanced anti-tumor activity through administration of T-cells expressing disclosed TCRs. Methods of treatment of a subject for a disease include administering cells expressing disclosed TCRs to the subject.
[0117] 1. Methods of Treatment
[0118] Methods of treatment including cells and other therapeutic agents including disclosed TCR polypeptides are described. In preferred forms, the methods include Adoptive Cell Therapy (ACT) employing T cells expressing TCR proteins disclosed herein.
[0119] An exemplary method involves treating a subject (e.g., a human) having a disease, disorder, or condition associated with the presence or proliferation of undesired cells by administering to the subject an effective amount of a pharmaceutical composition including genetically-modified cells including TCR polypeptides for the undesired cell (i.e., target cell) . In some forms, the methods administer genetically manipulated T cells engineered to express recombinant TCR proteins to a subject (e.g., a human) having a disease, disorder, or condition in an amount effective to treat the disease, disorder, or condition. For example, in some forms, the methods treat a disease or disorder associated with an elevated expression or specific expression of an antigen by administering to the subject an effective amount of a pharmaceutical composition including cells modified to express TCR proteins disclosed herein.
[0120] In some forms, the methods treat a subject having a disease, disorder, or condition associated with an elevated expression or specific expression of an antigen by administering to the subject an effective amount of a pharmaceutical composition including T cells modified to contain the disclosed TCRs that targets the antigen. In some forms, the disease, disorder, or condition associated with an elevated expression or specific expression of an antigen is cancer, and the antigen is a cancer antigen.
[0121] Typically the methods include ACT, for example, by providing the disclosed TCR-bearing T cells for therapeutic efficacy in vivo. In some forms, the methods of ACT including administering the disclosed TCR-bearing T cells have enhanced efficacy in vivo relative to ACT using conventional CAR-T cells.
[0122] Methods of treating a subject having a disease, disorder, or condition including administering to the subject an effective amount of a pharmaceutical composition including live, viable cells engineered to express the disclosed TCR proteins are provided. In some forms, when the methods treat a subject having a disease, disorder, or condition associated with an elevated expression or specific expression of an antigen, the methods include administering to the subject an effective amount of a T cell modified to express a disclosed TCR proteins that targets the antigen. For example, in some forms, the methods to treat a subject having a disease, disorder, or condition associated with an elevated expression or specific expression of an antigen by administering to the subject an effective amount of a pharmaceutical composition having a genetically modified cell, where the cell is modified by introducing to the cell:
[0123] (i) nucleic acid, e.g., a DNA or RNA such as viral RNA or mRNA, optionally, but preferably a vector, optionally including a transposon encoding a TCR proteins; and
[0124] (ii) causing the TCR protein to be expressed by the cell.
[0125] The cell can have been isolated from the subject having the disease, disorder, or condition, or from a healthy donor, prior to genetic modification. In some forms, the methods also include administering to the subject an effective amount of a antibody, e.g., human monoclonal antibody, that targets the antigen. The hmAb can target an antigen selected from a cancer antigen, an inflammatory disease antigen, a neuronal disorder antigen, HIV / AIDS, a diabetes antigen, a cardiovascular disease antigen, an infectious disease antigen (including a viral antigen, a protozoan antigen, a bacterial antigen, and an allergen) , an autoimmune disease antigen and an autoimmune disease antigen, or combinations thereof.
[0126] 2. Diseases to be treated
[0127] Methods of treating diseases and / or disorders in a subject in need thereof are provided. The subject to be treated can have a disease, disorder, or condition such as but not limited to, cancer, an immune system disorder such autoimmune disease, an inflammatory disease, a neuronal disorder, HIV / AIDS, diabetes, a cardiovascular disease, an infectious disease, or combinations thereof. The disease, disorder, or condition can be associated with an elevated expression or specific expression of an antigen.
[0128] i. Cancer
[0129] In some forms, the methods treat or prevent cancer. In some forms, the methods treat or prevent cancer or other proliferative disease or disorder in a subject identified as having, or at risk of having cancer or other proliferative disease or disorder. Cancer is a disease of genetic instability, allowing a cancer cell to acquire the hallmarks proposed by Hanahan and Weinberg, including (i) self-sufficiency in growth signals; (ii) insensitivity to anti-growth signals; (iii) evading apoptosis; (iv) sustained angiogenesis; (v) tissue invasion and metastasis; (vi) limitless replicative potential; (vii) reprogramming of energy metabolism; and (viii) evading immune destruction (Cell., 144: 646–674, (2011) ) .
[0130] Tumors, which can be treated in accordance with the disclosed methods, are classified according to the embryonic origin of the tissue from which the tumor is derived. Carcinomas are tumors arising from endodermal or ectodermal tissues such as skin or the epithelial lining of internal organs and glands. Sarcomas, which arise less frequently, are derived from mesodermal connective tissues such as bone, fat, and cartilage. The leukemias and lymphomas are malignant tumors of hematopoietic cells of the bone marrow. Leukemias proliferate as single cells, whereas lymphomas tend to grow as tumor masses. Malignant tumors may show up at numerous organs or tissues of the body to establish a cancer.
[0131] Table 1: Exemplary cancers for which the disclosed TCRs targeting a cancer antigen of the disclosed methods and compositions can target a specific or an associated antigen.
[0132] The disclosed compositions and methods can be used in the treatment of one or more cancers provided in Table 1.
[0133] The disclosed compositions and methods of treatment thereof are generally suited for treatment of carcinomas, sarcomas, lymphomas and leukemias. The described compositions and methods are useful for treating, or alleviating subjects having benign or malignant tumors by delaying or inhibiting the growth / proliferation or viability of tumor cells in a subject, reducing the number, growth or size of tumors, inhibiting or reducing metastasis of the tumor, and / or inhibiting or reducing symptoms associated with tumor development or growth.
[0134] The types of cancer that can be treated with the provided compositions and methods include, but are not limited to, cancers such as vascular cancer such as multiple myeloma, adenocarcinomas and sarcomas, of bone, bladder, brain, breast, cervical, colorectal, esophageal, kidney, liver, lung, nasopharangeal, pancreatic, prostate, skin, stomach, and uterine. The experiments below support the conclusion that the disclosure approach is effective for treating solid tumors. Thus, in some forms, the target cancer is a solid tumor. In some forms, the compositions are used to treat multiple cancer types concurrently. The compositions can also be used to treat metastases or tumors at multiple locations.
[0135] Exemplary tumor cells include, but are not limited to, tumor cells of cancers, including leukemias including, but not limited to, acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemias such as myeloblastic, promyelocytic, myelomonocytic, monocytic, erythroleukemia leukemias and myelodysplastic syndrome, chronic leukemias such as, but not limited to, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, hairy cell leukemia; polycythemia vera; lymphomas such as, but not limited to, Hodgkin’s disease, non-Hodgkin’s disease; multiple myelomas such as, but not limited to, smoldering multiple myeloma, nonsecretory myeloma, osteosclerotic myeloma, plasma cell leukemia, solitary plasmacytoma and extramedullary plasmacytoma; macroglobulinemia; monoclonal gammopathy of undetermined significance; benign monoclonal gammopathy; heavy chain disease; bone and connective tissue sarcomas such as, but not limited to, bone sarcoma, osteosarcoma, chondrosarcoma, Ewing’s sarcoma, malignant giant cell tumor, fibrosarcoma of bone, chordoma, periosteal sarcoma, soft-tissue sarcomas, angiosarcoma (hemangiosarcoma) , fibrosarcoma, Kaposi’s sarcoma, leiomyosarcoma, liposarcoma, lymphangiosarcoma, neurilemmoma, rhabdomyosarcoma, synovial sarcoma; brain tumors including, but not limited to, glioma, astrocytoma, brain stem glioma, ependymoma, oligodendroglioma, nonglial tumor, acoustic neurinoma, craniopharyngioma, medulloblastoma, meningioma, pineocytoma, pineoblastoma, primary brain lymphoma; breast cancer including, but not limited to, adenocarcinoma, lobular (small cell) carcinoma, intraductal carcinoma, medullary breast cancer, mucinous breast cancer, tubular breast cancer, papillary breast cancer, Paget’s disease, and inflammatory breast cancer; adrenal cancer, including, but not limited to, pheochromocytom and adrenocortical carcinoma; thyroid cancer such as but not limited to papillary or follicular thyroid cancer, medullary thyroid cancer and anaplastic thyroid cancer; pancreatic cancer, including, but not limited to, insulinoma, gastrinoma, glucagonoma, vipoma, somatostatin-secreting tumor, and carcinoid or islet cell tumor; pituitary cancers including, but not limited to, Cushing’s disease, prolactin-secreting tumor, acromegaly, and diabetes insipius; eye cancers including, but not limited to, ocular melanoma such as iris melanoma, choroidal melanoma, and ciliary body melanoma, and retinoblastoma; vaginal cancers, including, but not limited to, squamous cell carcinoma, adenocarcinoma, and melanoma; vulvar cancer, including, but not limited to, squamous cell carcinoma, melanoma, adenocarcinoma, basal cell carcinoma, sarcoma, and Paget’s disease; cervical cancers including, but not limited to, squamous cell carcinoma, and adenocarcinoma; uterine cancers including, but not limited to, endometrial carcinoma and uterine sarcoma; ovarian cancers including, but not limited to, ovarian epithelial carcinoma, borderline tumor, germ cell tumor, and stromal tumor; esophageal cancers including, but not limited to, squamous cancer, adenocarcinoma, adenoid cyctic carcinoma, mucoepidermoid carcinoma, adenosquamous carcinoma, sarcoma, melanoma, plasmacytoma, verrucous carcinoma, and oat cell (small cell) carcinoma; stomach cancers including, but not limited to, adenocarcinoma, fungating (polypoid) , ulcerating, superficial spreading, diffusely spreading, malignant lymphoma, liposarcoma, fibrosarcoma, and carcinosarcoma; colon cancers; rectal cancers; liver cancers including, but not limited to, hepatocellular carcinoma and hepatoblastoma, gallbladder cancers including, but not limited to, adenocarcinoma; cholangiocarcinomas including, but not limited to, papillary, nodular, and diffuse; lung cancers including, but not limited to, non-small cell lung cancer, squamous cell carcinoma (epidermoid carcinoma) , adenocarcinoma, large-cell carcinoma and small-cell lung cancer; testicular cancers including, but not limited to, germinal tumor, seminoma, anaplastic, classic (typical) , spermatocytic, nonseminoma, embryonal carcinoma, teratoma carcinoma, choriocarcinoma (yolk-sac tumor) , prostate cancers including, but not limited to, adenocarcinoma, leiomyosarcoma, and rhabdomyosarcoma; penal cancers; oral cancers including, but not limited to, squamous cell carcinoma; basal cancers; salivary gland cancers including, but not limited to, adenocarcinoma, mucoepidermoid carcinoma, and adenoidcystic carcinoma; pharynx cancers including, but not limited to, squamous cell cancer, and verrucous; skin cancers including, but not limited to, basal cell carcinoma, squamous cell carcinoma and melanoma, superficial spreading melanoma, nodular melanoma, lentigo malignant melanoma, acral lentiginous melanoma; kidney cancers including, but not limited to, renal cell cancer, adenocarcinoma, hypernephroma, fibrosarcoma, transitional cell cancer (renal pelvis and / or uterer) ; Wilms’ tumor; bladder cancers including, but not limited to, transitional cell carcinoma, squamous cell cancer, adenocarcinoma, and carcinosarcoma. For a review of such disorders, see Fishman et al., 1985, Medicine, 2d Ed., J.B. Lippincott Co., Philadelphia and Murphy et al., 1997, Informed Decisions: The Complete Book of Cancer Diagnosis, Treatment, and Recovery, Viking Penguin, Penguin Books U.S.A., Inc., United States of America) .
[0136] ii. Immune system disorders
[0137] In some forms, the methods administer modified T cells including TCR-protein (s) to treat or prevent one or more immune system disorders, including autoimmune diseases.
[0138] Under certain circumstances, the ability of the immune system to distinguish self from foreign antigens can be misdirected against healthy tissues, resulting in the undesirable attack and destruction of normal host cells (i.e., autoimmune diseases) . Autoimmune diseases include over 100 types of diseases, with varied etiology and prognoses based on factors such as the affected region, the age of onset, response to the therapeutic agents and clinical manifestation may vary among different people (Muhammad, et al., Chimeric Antigen Receptor Based Therapy as a Potential Approach in Autoimmune Diseases: How Close Are We to the Treatment, Frontiers in Immunology, 11 (2020) ) .
[0139] Auto-antibody-secreting B lymphocytes and self-reactive T-lymphocytes play a key role in the development of autoimmune diseases. Based on the extent of tissue damage, autoimmunity is classified into two general categories, including organ-specific and systemic autoimmune. The former involves a specific area of the body such as type I diabetes (T1D) , multiple sclerosis (MS) , rheumatoid arthritis (RA) , inflammatory bowel diseases (IBDs) , and myasthenia gravis (MG) , while the latter affects multiple regions of the body, causing systemic lupus erythematosus (SLE) and syndrome (SS) . Therefore, in some forms, the methods treat or prevent one or more organ-specific autoimmune diseases in a subject. In other forms, the methods treat or prevent one or more systemic autoimmune diseases in a subject.
[0140] In some forms, the methods reduce or prevent one or more physiological processes associated with the development or progression of autoimmune disease in a subject. For example, in some forms, the methods reduce or prevent one or more of epitope spreading, for example, where infections alter the primary epitope into the secondary epitope or form several neoepitopes on antigen-presenting cells; bystander activation or pre-primed autoreactive T cell activation in a T cell receptor (TCR) -independent manner; persistent virus infection, or the constant presence of viral antigens that prompt immune responses; or immunological cross-reactivity between a host and pathogen, for example, due to shared immunologic epitopes or sequence similarities.
[0141] In some forms, the methods administer a T-cell expressing disclosed TCRs responsible for or otherwise developing or maintaining an immune system disease or disorder. Non-limiting examples of immune system disorders that can be treated or prevented by the methods include 22q11.2 deletion syndrome, Achondroplasia and severe combined immunodeficiency, Adenosine Deaminase 2 deficiency, Adenosine deaminase deficiency, Adult-onset immunodeficiency with anti-interferon-gamma autoantibodies, Agammaglobulinemia, non-Bruton type, Aicardi-Goutieres syndrome, Aicardi-Goutieres syndrome type 5, Allergic bronchopulmonary aspergillosis, Alopecia, Alopecia totalis, Alopecia universalis, Amyloidosis AA, Amyloidosis familial visceral, Ataxia telangiectasia, Autoimmune lymphoproliferative syndrome, Autoimmune lymphoproliferative syndrome due to CTLA4 haploinsuffiency, Autoimmune polyglandular syndrome type 1, Autosomal dominant hyper IgE syndrome, Autosomal recessive early-onset inflammatory bowel disease, Autosomal recessive hyper IgE syndrome, Bare lymphocyte syndrome 2, Barth syndrome, Blau syndrome, Bloom syndrome, Bronchiolitis obliterans, C1q deficiency, Candidiasis familial chronic mucocutaneous, autosomal recessive, Cartilage-hair hypoplasia, CHARGE syndrome, Chediak-Higashi syndrome, Cherubism, Chronic atypical neutrophilic dermatosis with lipodystrophy and elevated temperature, Chronic graft versus host disease, Chronic granulomatous disease, Chronic Infantile Neurological Cutaneous Articular syndrome, Chronic mucocutaneous candidiasis (CMC) , Cohen syndrome, Combined immunodeficiency with skin granulomas, Common variable immunodeficiency, Complement component 2 deficiency, Complement component 8 deficiency type 1, Complement component 8 deficiency type 2, Congenital pulmonary alveolar proteinosis, Cryoglobulinemia, Cutaneous mastocytoma, Cyclic neutropenia, Deficiency of interleukin-1 receptor antagonist, Dendritic cell, monocyte, B lymphocyte, and natural killer lymphocyte deficiency, Dyskeratosis congenital, Dyskeratosis congenita autosomal dominant, Dyskeratosis congenita autosomal recessive, Dyskeratosis congenita X-linked, Epidermodysplasia verruciformis, Familial amyloidosis, Finnish type, Familial cold autoinflammatory syndrome, Familial Mediterranean fever, Familial mixed cryoglobulinemia, Felty's syndrome, Glycogen storage disease type 1B, Griscelli syndrome type 2, Hashimoto encephalopathy, Hashimoto's syndrome, Hemophagocytic lymphohistiocytosis, Hennekam syndrome, Hepatic venoocclusive disease with immunodeficiency, Hereditary folate malabsorption, Hermansky Pudlak syndrome 2, Herpes simplex encephalitis, Hoyeraal Hreidarsson syndrome, Hyper IgE syndrome, Hyper-IgD syndrome, ICF syndrome, Idiopathic acute eosinophilic pneumonia, Idiopathic CD4 positive T-lymphocytopenia, IL12RB1 deficiency, Immune defect due to absence of thymus, Immune dysfunction with T-cell inactivation due to calcium entry defect 1, Immune dysfunction with T-cell inactivation due to calcium entry defect 2, Immunodeficiency with hyper IgM type 1, Immunodeficiency with hyper IgM type 2, Immunodeficiency with hyper IgM type 3, Immunodeficiency with hyper IgM type 4, Immunodeficiency with hyper IgM type 5, Immunodeficiency with thymoma, Immunodeficiency without anhidrotic ectodermal dysplasia, Immunodysregulation, polyendocrinopathy and enteropathy X-linked, Immunoglobulin A deficiency 2, Intestinal atresia multiple, IRAK-4 deficiency, Isolated growth hormone deficiency type 3, Kawasaki disease, Large granular lymphocyte leukemia, Leukocyte adhesion deficiency type 1, LRBA deficiency, Lupus, Lymphocytic hypophysitis, Majeed syndrome, Melkersson-Rosenthal syndrome, MHC class 1 deficiency, Muckle-Wells syndrome, Multifocal fibrosclerosis, Multiple sclerosis, MYD88 deficiency, Neonatal systemic lupus erythematosus, Netherton syndrome, Neutrophil-specific granule deficiency, Nijmegen breakage syndrome, Omenn syndrome, Osteopetrosis autosomal recessive 7, Palindromic rheumatism, Papillon Lefevre syndrome, Partial androgen insensitivity syndrome, PASLI disease, Pearson syndrome, Pediatric multiple sclerosis, Periodic fever, aphthous stomatitis, pharyngitis and adenitis, PGM3-CDG, Poikiloderma with neutropenia, Pruritic urticarial papules plaques of pregnancy, Purine nucleoside phosphorylase deficiency, Pyogenic arthritis, pyoderma gangrenosum and acne, Relapsing polychondritis, Reticular dysgenesis, Sarcoidosis, Say Barber Miller syndrome, Schimke immunoosseous dysplasia, Schnitzler syndrome, Selective IgA deficiency, Selective IgM deficiency, Severe combined immunodeficiency, Severe combined immunodeficiency due to complete RAG1 / 2 deficiency, Severe combined immunodeficiency with sensitivity to ionizing radiation, Severe combined immunodeficiency, Severe congenital neutropenia autosomal recessive 3, Severe congenital neutropenia X-linked, Shwachman-Diamond syndrome, Singleton-Merten syndrome, SLC35C1-CDG (CDG-IIc) , Specific antibody deficiency, Spondyloenchondrodysplasia, Stevens-Johnson syndrome, T-cell immunodeficiency, congenital alopecia and nail dystrophy, TARP syndrome, Trichohepatoenteric syndrome, Tumor necrosis factor receptor-associated periodic syndrome, Twin to twin transfusion syndrome, Vici syndrome, WHIM syndrome, Wiskott Aldrich syndrome, Woods Black Norbury syndrome, X-linked agammaglobulinemia, X-linked lymphoproliferative syndrome, X-linked lymphoproliferative syndrome 1, X-linked lymphoproliferative syndrome 2, X-linked magnesium deficiency with Epstein-Barr virus infection and neoplasia, X-linked severe combined immunodeficiency, and ZAP-70 deficiency.
[0142] The disclosed compositions and methods can also be used to treat autoimmune diseases or disorders. Exemplary autoimmune diseases or disorders, which are not mutually exclusive with the immune system disorders described above, include Achalasia, Addison’s disease, Adult Still's disease, Agammaglobulinemia, Alopecia areata, Amyloidosis, Ankylosing spondylitis, Anti-GBM / Anti-TBM nephritis, Antiphospholipid syndrome, Autoimmune angioedema, Autoimmune dysautonomia, Autoimmune encephalomyelitis, Autoimmune hepatitis, Autoimmune inner ear disease (AIED) , Autoimmune myocarditis, Autoimmune oophoritis, Autoimmune orchitis, Autoimmune pancreatitis, Autoimmune retinopathy, Autoimmune urticarial, Axonal &neuronal neuropathy (AMAN) , Baló disease, Behcet’s disease, Benign mucosal pemphigoid, Bullous pemphigoid, Castleman disease (CD) , Celiac disease, Chagas disease, Chronic inflammatory demyelinating polyneuropathy (CIDP) , Chronic recurrent multifocal osteomyelitis (CRMO) , Churg-Strauss Syndrome (CSS) or Eosinophilic Granulomatosis (EGPA) , Cicatricial pemphigoid, Cogan’s syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis, CREST syndrome, Crohn’s disease, Dermatitis herpetiformis, Dermatomyositis, Devic’s disease (neuromyelitis optica) , Discoid lupus, Dressler’s syndrome, Endometriosis, Eosinophilic esophagitis (EoE) , Eosinophilic fasciitis, Erythema nodosum, Essential mixed cryoglobulinemia, Evans syndrome, Fibromyalgia, Fibrosing alveolitis, Giant cell arteritis (temporal arteritis) , Giant cell myocarditis, Glomerulonephritis, Goodpasture’s syndrome, Granulomatosis with Polyangiitis, Graves’ disease, Guillain-Barre syndrome, Hashimoto’s thyroiditis, Hemolytic anemia, Henoch-Schonlein purpura (HSP) , Herpes gestationis or pemphigoid gestationis (PG) , Hidradenitis Suppurativa (HS) (Acne Inversa) , Hypogammalglobulinemia, IgA Nephropathy, IgG4-related sclerosing disease, Immune thrombocytopenic purpura (ITP) , Inclusion body myositis (IBM) , Interstitial cystitis (IC) , Juvenile arthritis, Juvenile diabetes (Type 1 diabetes) , Juvenile myositis (JM) , Kawasaki disease, Lambert-Eaton syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, Linear IgA disease (LAD) , Lupus, Lyme disease chronic, Meniere’s disease, Microscopic polyangiitis (MPA) , Mixed connective tissue disease (MCTD) , Mooren’s ulcer, Mucha-Habermann disease, Multifocal Motor Neuropathy (MMN) or MMNCB, Multiple sclerosis, Myasthenia gravis, Myositis, Narcolepsy, Neonatal Lupus, Neuromyelitis optica, Neutropenia, Ocular cicatricial pemphigoid, Optic neuritis, Palindromic rheumatism (PR) , PANDAS, Paraneoplastic cerebellar degeneration (PCD) , Paroxysmal nocturnal hemoglobinuria (PNH) , Parry Romberg syndrome, Pars planitis (peripheral uveitis) , Parsonnage-Turner syndrome, Pemphigus, Peripheral neuropathy, Perivenous encephalomyelitis, Pernicious anemia (PA) , POEMS syndrome, Polyarteritis nodosa, Polyglandular syndromes type I, II, III, Polymyalgia rheumatic, Polymyositis, Postmyocardial infarction syndrome, Postpericardiotomy syndrome, Primary biliary cirrhosis, Primary sclerosing cholangitis, Progesterone dermatitis, Psoriasis, Psoriatic arthritis, Pure red cell aplasia (PRCA) , Pyoderma gangrenosum, Raynaud’s phenomenon, Reactive Arthritis, Reflex sympathetic dystrophy, Relapsing polychondritis, Restless legs syndrome (RLS) , Retroperitoneal fibrosis, Rheumatic fever, Rheumatoid arthritis, Sarcoidosis, Schmidt syndrome, Scleritis, Scleroderma, syndrome, Sperm &testicular autoimmunity, Stiff person syndrome (SPS) , Subacute bacterial endocarditis (SBE) , Susac’s syndrome, Sympathetic ophthalmia (SO) , Takayasu’s arteritis, Temporal arteritis / Giant cell arteritis, Thrombocytopenic purpura (TTP) , Tolosa-Hunt syndrome (THS) , Transverse myelitis, Type 1 diabetes, Ulcerative colitis (UC) , Undifferentiated connective tissue disease (UCTD) , Uveitis, Vasculitis, Vitiligo, Vogt-Koyanagi-Harada Disease, and Wegener’s granulomatosis (or Granulomatosis with Polyangiitis (GPA) ) .
[0143] iii. Other Disease or Disorders
[0144] In some forms the methods administer modified T cells including disclosed TCR protein (s) in a subject in need thereof. For example, in some forms the methods treat one or more genetic disease or disorders in a subject, such as a hereditary genetic disease or disorder, or a somatic genetic disease or disorder in a subject.
[0145] Any of the methods can include treating a subject having an underlying disease or disorder. For example, in some forms, the methods treat a disease or disorder, such as a cancer or auto-immune disease in a patient having another disease or disorder, such as diabetes, a bacterial infection (e.g., Tuberculosis) , viral infection (e.g., Hepatitis, HIV, HPV infection, etc. ) , or a drug-associated disease or disorder. In some forms, the methods treat an immunocompromised subject. In some forms, the methods treat a subject having a disease of the kidney, liver, heart, lung, brain, bladder, reproductive system, bowel / intestines, stomach, bones or skin.
[0146] D. ADMINISTRATION
[0147] In some forms the methods administer modified T cells including the disclosed TCR protein (s) in an amount effective to treat or prevent one or more disease or disorder in the subject.
[0148] The effective amount or therapeutically effective amount of a pharmaceutical compositions including modified cells, such as therapeutic T cells expressing disclosed TCRs, that can be a dosage sufficient to treat, inhibit, or alleviate one or more symptoms of a disease or disorder, such as a cancer or autoimmune disease, or to otherwise provide a desired pharmacologic and / or physiologic effect, for example, reducing, inhibiting, or reversing one or more of the underlying pathophysiological mechanisms underlying a disease or disorder, such as cancer or autoimmune disease.
[0149] In some forms, when administration of the pharmaceutical compositions including modified cells, such as therapeutic T cells, including T cells expressing disclosed TCRs, elicits an anti-cancer response, the amount administered can be expressed as the amount effective to achieve a desired anti-cancer effect in the recipient. For example, in some forms, the amount of the pharmaceutical compositions including modified cells, such as therapeutic T cells expressing disclosed TCRs is effective to inhibit the viability or proliferation of cancer cells in the recipient. In some forms, the amount of the pharmaceutical composition including modified cells, such as therapeutic T cells expressing disclosed TCRs, is effective to reduce the tumor burden in the recipient, or reduce the total number of cancer cells, and combinations thereof.
[0150] In other forms, the amount of the pharmaceutical compositions including modified cells, such as T cells expressing disclosed TCRs is effective to reduce one or more symptoms or signs of cancer in a cancer patient, or signs of an autoimmune disease in a patient having an autoimmune disease or disorder. Signs of cancer can include cancer markers, such as PSMA levels in the blood of a patient.
[0151] The effective amount of the pharmaceutical compositions including modified cells, such as T cells expressing disclosed TCRs that is required will vary from subject to subject, depending on the species, age, weight and general condition of the subject, the severity of the disorder being treated, and its mode of administration. Thus, it is not possible to specify an exact amount for every pharmaceutical composition. However, an appropriate amount can be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein. For example, effective dosages and schedules for administering the pharmaceutical compositions including T cells expressing disclosed TCRs can each be determined empirically, and making such determinations is within the skill in the art. In some forms, the dosage ranges for the administration of the compositions including T cells expressing disclosed TCRs are those large enough to effect reduction in cancer cell proliferation or viability, or to reduce tumor burden for example.
[0152] The dosage should not be so large as to cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. Generally, the dosage will vary with the age, condition, and sex of the patient, route of administration, whether other drugs are included in the regimen, and the type, stage, and location of the disease to be treated. The dosage can be adjusted by the individual physician in the event of any counter-indications. It will also be appreciated that the effective dosage of the composition including T cells expressing disclosed TCRs used for treatment can increase or decrease over the course of a particular treatment. Changes in dosage can result and become apparent from the results of diagnostic assays.
[0153] Dosage can vary, and can be administered in one or more dose administrations daily, for one or several days. Guidance can be found in the literature for appropriate dosages for given classes of pharmaceutical products. Optimal dosing schedules can be calculated from measurements of drug accumulation in the body of the subject or patient. Persons of ordinary skill can easily determine optimum dosages, dosing methodologies and repetition rates. Optimum dosages can vary depending on the relative potency of individual pharmaceutical compositions, and can generally be estimated based on EC50s found to be effective in in vitro and in vivo animal models.
[0154] It can generally be stated that a pharmaceutical composition containing T cells expressing disclosed TCRs described herein can be administered at a dosage of 104 to 109 cells / kg body weight, preferably 105 to 107 cells / kg body weight, including all integer values within those ranges. In some forms, patients can be treated by infusing a disclosed pharmaceutical composition containing T cells expressing disclosed TCRs (e.g., T cells) in the range of about 104 to 1012 or more cells per square meter of body surface (cells / m) .
[0155] The infusion can be repeated as often and as many times as the patient can tolerate until the desired response is achieved. The T cells expressing disclosed TCRs compositions can also be administered once or multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988) . The optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly. In some forms, the unit dosage of T cells expressing disclosed TCRs is in a unit dosage form for intravenous injection. In some forms, the unit dosage is in a unit dosage form for oral administration. In some forms, the unit dosage is in a unit dosage form for inhalation. In some forms, the unit dosage is in a unit dosage form for intra-tumoral injection.
[0156] Treatment can be continued for an amount of time sufficient to achieve one or more desired therapeutic goals, for example, a reduction of the amount of cancer cells relative to the start of treatment, or complete absence of cancer cells in the recipient. Treatment can be continued for a desired period of time, and the progression of treatment can be monitored using any means known for monitoring the progression of anti-cancer treatment in a patient. In some forms, administration is carried out every day of treatment, or every week, or every fraction of a week. In some forms, treatment regimens are carried out over the course of up to two, three, four or five days, weeks, or months, or for up to 6 months, or for more than 6 months, for example, up to one year, two years, three years, or up to five years.
[0157] The efficacy of administration of a particular dose of the pharmaceutical compositions including modified cells, such as therapeutic T cells, according to the methods described herein can be determined by evaluating the aspects of the medical history, signs, symptoms, and objective laboratory tests that are known to be useful in evaluating the status of a subject in need for the treatment of cancer or other diseases and / or conditions. These signs, symptoms, and objective laboratory tests will vary, depending upon the particular disease or condition being treated or prevented, as will be known to any clinician who treats such patients or a researcher conducting experimentation in this field. For example, if, based on a comparison with an appropriate control group and / or knowledge of the normal progression of the disease in the general population or the particular individual: (1) a subject’s physical condition is shown to be improved (e.g., a tumor has partially or fully regressed) , (2) the progression of the disease or condition is shown to be stabilized, or slowed, or reversed, or (3) the need for other medications for treating the disease or condition is lessened or obviated, then a particular treatment regimen will be considered efficacious. In some forms, efficacy is assessed as a measure of the reduction in tumor volume and / or tumor mass at a specific time point (e.g., 1-5 days, weeks, or months) following treatment.
[0158] In some forms the methods administer modified T cells expressing disclosed TCR protein (s) in a combination with a pharmaceutically acceptable carrier. The compositions described herein can be conveniently formulated into pharmaceutical compositions composed of one or more of the compounds in association with a pharmaceutically acceptable carrier. See, e.g., Remington's Pharmaceutical Sciences, latest edition, by E.W. Martin Mack Pub. Co., Easton, PA, which discloses typical carriers and conventional methods of preparing pharmaceutical compositions that can be used in conjunction with the preparation of formulations of the therapeutics described herein and which is incorporated by reference herein. These most typically would be standard carriers for administration of compositions to humans. In one aspect, for humans and non-humans, these include solutions such as sterile water, saline, and buffered solutions at physiological pH. Other therapeutics can be administered according to standard procedures used by those skilled in the art.
[0159] The pharmaceutical compositions including modified cells, such as therapeutic T cells, described herein can include, but are not limited to, carriers, thickeners, diluents, buffers, preservatives, surface active agents and the like in addition to the therapeutic (s) of choice.
[0160] Pharmaceutical compositions containing one or more modified cells, such as therapeutic T cells expressing disclosed TCRs and optionally one or more additional therapeutic agents can be administered to the subject in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated. Thus, for example, a pharmaceutical composition including modified cells, such as therapeutic T cells expressing disclosed TCRs, can be administered as an intravenous infusion, or directly injected into a specific site, for example, into or surrounding a tumor. Moreover, a pharmaceutical composition can be administered to a subject as an ophthalmic solution and / or ointment to the surface of the eye, vaginally, rectally, intranasally, orally, by inhalation, or parenterally, for example, by intradermal, subcutaneous, intramuscular, intraperitoneal, intrarectal, intraarterial, intralymphatic, intravenous, intrathecal and intratracheal routes. In some forms, the compositions are administered directly into a tumor or tissue, e.g., stereotactically.
[0161] Parenteral administration, if used, is generally characterized by injection. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions. A more recently revised approach for parenteral administration involves use of a slow release or sustained release system such that a constant dosage is maintained. See, e.g., U.S. Patent No. 3,610,795, which is incorporated by reference herein. Suitable parenteral administration routes include intravascular administration (e.g., intravenous bolus injection, intravenous infusion, intra-arterial bolus injection, intra-arterial infusion and catheter instillation into the vasculature) ; peri-and intra-tissue injection (e.g., intraocular injection, intra-retinal injection, or sub-retinal injection) ; subcutaneous injection or deposition including subcutaneous infusion (such as by osmotic pumps) ; direct application by a catheter or other placement device (e.g., an implant including a porous, non-porous, or gelatinous material) .
[0162] Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions which can also contain buffers, diluents and other suitable additives. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic / aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose) , and the like. Preservatives and other additives can also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
[0163] Administration of the pharmaceutical compositions containing one or more genetically modified cells (e.g., T cells expressing disclosed TCRs) can be localized (i.e., to a particular region, physiological system, tissue, organ, or cell type) or systemic.
[0164] It is to be understood that the disclosed method and compositions are not limited to specific synthetic methods, specific analytical techniques, or to particular reagents unless otherwise specified, and, as such, can vary. It is also to be understood that the terminology used herein is for the purpose of describing particular forms only and is not intended to be limiting.
[0165] E. COMBINATION THERAPY
[0166] In some forms the methods administer modified T cells expressing disclosed TCR protein (s) in combination with other therapeutic agents or treatment modalities. Any of the disclosed pharmaceutical compositions including modified cells, such as therapeutic T cells (e.g., containing a population of T cells expressing disclosed TCRs) , can be used alone, or in combination with other therapeutic agents or treatment modalities, for example, chemotherapy or stem-cell transplantation. As used herein, “combination” or “combined” refer to either concomitant, simultaneous, or sequential administration of the therapeutics.
[0167] In some forms, the pharmaceutical compositions and other therapeutic agents are administered separately through the same route of administration. In other forms, the pharmaceutical compositions and other therapeutic agents are administered separately through different routes of administration. The combinations can be administered either concomitantly (e.g., as an admixture) , separately but simultaneously (e.g., via separate intravenous lines into the same subject; one agent is given orally while the other agent is given by infusion or injection, etc., ) , or sequentially (e.g., one agent is given first followed by the second) .
[0168] Examples of preferred additional therapeutic agents include other conventional therapies known in the art for treating the desired disease, disorder or condition. In some forms, the therapeutic agent is one or more other targeted therapies (e.g., a targeted cancer therapy) and / or immune-checkpoint blockage agents (e.g., anti CTLA 4, anti PD1, and / or anti PDL1 agents such as antibodies) .
[0169] The compositions and methods described herein may be used as a first therapy, second therapy, third therapy, or combination therapy with other types of therapies known in the art, such as chemotherapy, surgery, radiation, gene therapy, immunotherapy, bone marrow transplantation, stem cell transplantation, targeted therapy, cryotherapy, ultrasound therapy, photodynamic therapy, radio-frequency ablation or the like, in an adjuvant setting or a neoadjuvant setting.
[0170] The disclosed pharmaceutical compositions and / or other therapeutic agents, procedures or modalities can be administered during periods of active disease, or during a period of remission or less active disease. The pharmaceutical compositions can be administered before the additional treatment, concurrently with the treatment, post-treatment, or during remission of the disease or disorder. When administered in combination, the disclosed pharmaceutical compositions and the additional therapeutic agents (e.g., second or third agent) , or all, can be administered in an amount or dose that is higher, lower or the same than the amount or dosage of each agent used individually, e.g., as a monotherapy. In certain forms, the administered amount or dosage of the disclosed pharmaceutical composition, the additional therapeutic agent (e.g., second or third agent) , or all, is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50%) than the amount or dosage of each agent used individually, e.g., as a monotherapy (e.g., required to achieve the same therapeutic effect) .
[0171] F. METHODS OF IDENTIFYING TCRS
[0172] 1. Generating Tumor Model
[0173] Disclosed herein is the hydrodynamic injection method that is utilized to introduce vectors into hepatocytes that can induce tumor formation in mice. These vectors consist of a Sleeping Beauty transposon vector, which expresses a cancer-causing oncogene, and CRISPR vectors with guide RNAs that delete tumor suppressor genes. The combined effect of oncogene expression and the deletion of tumor suppressor genes leads to the development of hepatocellular carcinoma (HCC) in mice. This method offers convenient, efficient, liver-specific, and non-viral approach that can be applied to both wild-type and gene-modified mice without the need to generate transgenic mice or perform complicated crossbreeding.
[0174] In some forms, the transposon vector can be used to overexpress oncogenes such as c-myc.
[0175] In some forms, CRISPR vectors can be used for deletion or mutation of the second exon of Trp53 and first exon of Pten.
[0176] Hepatocellular carcinoma (HCC) is developed due to a combined effect of Myc expression and Trp53 and Pten ablation. The ablation of Trp53 and Pten, and the overexpression of Myc in mice to develop HCC mimics the multi-stage and multi-hit process of human liver carcinogenesis.
[0177] The non-human animal model is suitable for research purposes such as investigating the molecular and genetic mechanisms underlying recurrent HCC tumor development, identifying potential therapeutic targets, and testing potential compounds for the treatment of recurrent HCC.
[0178] Thus, the non-human animal model is a genetically modified non-human animal. As used herein, the term “genetically modified non-human animal” refers to a non-human animal having exogenous DNA in at least one chromosome of the animal's genome. In some forms, at least one or more cells, e.g., at least 1%, 2%, 3%, 4%, 5%, 10%, 20%, 30%, 40%, 50%of cells of the genetically modified non-human animal have the exogenous DNA in its genome. The cell having exogenous DNA, i.e., the target cells, can be various kinds of cells, e.g., an endogenous cell, a somatic cell, an immune cell, a T cell, a B cell, or an endogenous tumor cell. In some forms, genetically modified non-human animals contain a modified endogenous locus that contains an exogenous sequence (e.g., a human sequence) , e.g., a replacement of one or more non-human sequences with one or more human sequences. The non-human animals are generally not able to pass the modification to progeny, i.e., through germline transmission.
[0179] In some forms, the target cells are liver cells. Exemplary target liver cells include but are not limited to hepatocytes, Kupffer cells, stellate (Ito) cells, sinusoidal endothelial cells (SECs) , cholangiocytes, biliary epithelial cells (BECs) , liver progenitor cells (LPCs) , pit cells or liver-associated natural killer (NK) cells, dendritic cells, and liver sinusoidal endothelial cell (LSEC) fenestrations. In preferred forms, the target liver cells are hepatocytes.
[0180] The non-human animal model develops a focal HCC tumor after a period of time following integration of the model generating system. In some forms, the period of time for developing the focal HCC tumor is about 3 weeks to about 5 weeks, more preferably about 4 weeks following integration of the model generating system. Generally, the non-human animal model develops one or more recurrent HCC liver tumors after a period of time following surgical resection of the focal tumors. In some forms, the period of time for development of the recurrent HCC tumors is about six weeks to about 11 weeks following surgical resection of the focal tumors. In some forms, the period of time for development of the recurrent HCC tumors is about six weeks to about seven months following surgical resection of the focal tumors. In some forms, the period of time for development of the recurrent HCC tumors is about six weeks, about two months, about three months, about four months, about 5 months, about six months, about seven months following surgical resection of the focal tumors.
[0181] Recurrent HCC tumor cells and tissues are defined structurally and functionally as described herein; using methods and assays similar to those described below. Because recurrent HCC tumor cells and tissues are known to evolve phenotypically and functionally over time as additional genetic mutations occur, the recurrent HCC tumor cells and tissues may change phenotypically and functionally over time in the non-human animal model. Nevertheless, one can use the methods as described herein and employ the markers as disclosed herein, to consistently isolate and / or identify recurrent HCC tumor cells and tissues. In some forms, the HCC tumor cells and tissues express cell surface markers including but not limited to Alpha-fetoprotein and glypican 3.
[0182] Generally, the non-human animal model is an immune-competent animal. An “immune-competent” animal, as used herein, is one in which the native or natural innate and adaptive immune system has been retained (i.e., not artificially altered) , such that the animal retains its normal capacity to develop an immune response against a foreign antigen. One advantage is that the animal models have been tolerized specifically to certain xenogenic cells and / or tissues e.g., cells and / or tissues produced by the model generating system, such that they do not recognize such xenogenic cells and / or tissues as foreign cells and / or tissues. Therefore, cells and / or tissues produced by the model-generating system can be achieved without the need to resort to germline genetic modification of the recipient animal's native immune system or the use of immunosuppressive agents to prevent the animal from rejecting the xenogenic cells and / or tissues. A further advantage is that the animal remains capable of mounting a normal immune response against the cells and / or tissues produced by the model generating system. Thus, such immune-competent animals would usually have T, B, and / or NK cells that are normal and / or unaltered (insofar as being not artificially altered or engineered, it being appreciated that a natural mutation may arise, which otherwise does not significantly impair the animal's normal immune response) . The non-human animal model is immunologically tolerant to the HCC tumor cells, while maintaining a competent immune system. The animal models are “tolerogenic” to the HCC tumor cells, which means they are immunologically tolerant such that they maintain a state of tolerance to the HCC tumor cells, instead of mounting an immune response to, or rejection of, the HCC tumor cells. The term “tolerogenic, ” as referred to herein, generally means that the animals tolerate the HCC tumors, without being immunocompromised or immunodeficient, either through the use of germline genetic modifications or immunosuppressive agents. This is in contrast with an immunodeficient or immunocompromised animal where the natural or native immune response is attenuated, weakened, or decreased, such that the animal has an altered immunocompetence to fight a foreign antigen. Such animals usually have atypical T, B, and / or NK cells. In preferred forms, the tumors are derived from the immune competent mice; therefore, the tumors are not rejected by the immune system of the mice.
[0183] The target animal for harboring the model-generating system is preferably a mammal. In some forms, the mammal is a rodent such as mice, rats, squirrels, prairie dogs, porcupines, beavers, guinea pigs, and hamsters. In some forms, the target animal is a rabbit. In some forms, the target animal is zebra fish. In preferred forms, target animal is a rodent, preferably mice or rats. The target animal chosen will various uses for modeling and studying human disease and evaluation of treatments. In one or more forms, the target animals are useful as models for recurrent HCC, and / or methods of modeling recurrent HCC using the model-generating system described above. For example, HCC tumors could be established in the recipient animal via the model generating system for testing of pharmaceuticals, cytotherapy, photodynamic therapy, magnetic hyperthermic therapy, gene therapy, and the like. The model generating system can be used to promote the development of the HCC tumor cells and / or tissue specifically in liver. For this reason, it is desirable to restrict movement by the tumor cells to facilitate tumor formation in the liver.
[0184] In some forms, the non-human animal is a mouse of a C57BL strain selected from C57BL / A, C57BL / An, C57BL / GrFa, C57BL / KaLwN, C57BL / 6, C57BL / 6J, C57BL / 6ByJ, C57BL / 6NJ, C57BL / 10, C57BL / 10ScSn, C57BL / 10Cr, and C57BL / Ola. In some forms, the mouse is a 129 strain selected from the group consisting of a strain that is 129P1, 129P2, 129P3, 129X1, 129S1 (e.g., 129S1 / SV, 129S1 / SvIm) , 129S2, 129S4, 129S5, 129S9 / SvEvH, 129S6 (129 / SvEvTac) , 129S7, 129S8, 129T1, 129T2. These mice are described, e.g., in Festing et al., Revised nomenclature for strain 129 mice, Mammalian Genome 10: 836 (1999) ; Auerbach et al., Establishment and Chimera Analysis of 129 / SvEv-and C57BL / 6-Derived Mouse Embryonic Stem Cell Lines (2000) , both of which are incorporated herein by reference in the entirety. In some forms, the mouse is a mix of the 129 strain and the C57BL / 6 strain. In some forms, the mouse is a mix of the 129 strains, or a mix of the BL / 6 strains. In some forms, the mouse is a BALB strain, e.g., BALB / c strain. In some forms, the mouse is a mix of a BALB strain and another strain. In some forms, the mouse is from a hybrid line (e.g., 50%BALB / c-50%12954 / Sv; or 50%C57BL / 6-50%129) .
[0185] In some forms, the non-human animal is a rat. The rat can be selected from a Wistar rat, an LEA strain, a Sprague Dawley strain, a Fischer strain, F344, F6, and Dark Agouti. In some forms, the rat strain is a mix of two or more strains selected from the group consisting of Wistar, LEA, Sprague Dawley, Fischer, F344, F6, and Dark Agouti.
[0186] In some forms, CRISPR-mediated somatic knockout of tumor suppressor genes has been used to induce Hepatocellular Carcinoma (HCC) in mice.
[0187] In some forms, CRISPR-mediated gene knockout includes deletion of one or both of tumor suppressor genes, Trp53 and Pten.
[0188] The term “CRISPR” (Clustered Regularly Interspaced Short Palindromic Repeats) is an acronym for DNA loci that contain multiple, short, direct repetitions of base sequences. The prokaryotic CRISPR / Cas system has been adapted for use as gene editing (silencing, enhancing or changing specific genes) for use in eukaryotes (see, for example, Cong, Science, 15: 339 (6121) : 819–823 (2013) and Jinek, et al., Science, 337 (6096) : 816-21 (2012) ) . Methods of preparing compositions for use in genome editing using the CRISPR / Cas systems are described in detail in WO 2013 / 176772 and WO 2014 / 018423, which are specifically incorporated by reference herein in their entireties.
[0189] In general, the term “CRISPR system” refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated ( “Cas” ) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g., tracrRNA or an active partial tracrRNA) , a tracr-mate sequence (encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system) , a guide sequence (also referred to as a “spacer” in the context of an endogenous CRISPR system) , or other sequences and transcripts from a CRISPR locus. One or more tracr mate sequences operably linked to a guide sequence (e.g., direct repeat-spacer-direct repeat) can also be referred to as pre-crRNA (pre-CRISPR RNA) before processing or crRNA after processing by a nuclease. Typically, a CRISPR-Cas9 system includes a guide RNA (gRNA) and Cas9 nuclease, which together form a ribonucleoprotein (RNP) complex. The presence of a specific protospacer adjacent motif (PAM) in the genomic DNA is required for the gRNA to bind to the target sequence. The Cas9 nuclease then makes a double-strand break in the DNA. Endogenous repair mechanisms triggered by the double-strand break may result in gene knockout via a frameshift mutation or knock-in of a desired sequence if a DNA template is present.
[0190] In some forms, a tracrRNA and crRNA are linked and form a chimeric crRNA-tracrRNA hybrid where a mature crRNA is fused to a partial tracrRNA via a synthetic stem loop to mimic the natural crRNA: tracrRNA duplex as described in Cong, Science, 15: 339 (6121) : 819–823 (2013) and Jinek, et al., Science, 337 (6096) : 816-21 (2012) ) . A single fused crRNA-tracrRNA construct can also be referred to as a guide RNA or gRNA (or single-guide RNA (sgRNA) ) . Within an sgRNA, the crRNA portion can be identified as the ‘target sequence’ and the tracrRNA is often referred to as the ‘scaffold’ .
[0191] CRSIPR systems having enhanced editing activity and high genome-wide targeting specificity typically include two components: (1) a single guide RNA configured for enhanced editing activity; and (2) a Cas enzyme.
[0192] In some forms, TALEN-mediated knockout of tumor suppressor genes can be used to induce Hepatocellular Carcinoma (HCC) in mice.
[0193] In some forms, the element that induces a single or a double strand break in the target cell’s genome is a nucleic acid construct or constructs encoding a transcription activator-like effector nuclease (TALEN) . TALENs have an overall architecture similar to that of ZFNs, with the main difference that the DNA-binding domain comes from TAL effector proteins, transcription factors from plant pathogenic bacteria. The DNA-binding domain of a TALEN is a tandem array of amino acid repeats, each about 34 residues long. The repeats are very similar to each other; typically they differ principally at two positions (amino acids 12 and 13, called the repeat variable diresidue, or RVD) . Each RVD specifies preferential binding to one of the four possible nucleotides, meaning that each TALEN repeat binds to a single base pair, though the NN RVD is known to bind adenines in addition to guanine. TAL effector DNA binding is mechanistically less well understood than that of zinc-finger proteins, but their seemingly simpler code could prove very beneficial for engineered-nuclease design. TALENs also cleave as dimers, have relatively long target sequences (the shortest reported so far binds 13 nucleotides per monomer) and appear to have less stringent requirements than ZFNs for the length of the spacer between binding sites. Monomeric and dimeric TALENs can include more than 10, more than 14, more than 20, or more than 24 repeats.
[0194] Methods of engineering TAL to bind to specific nucleic acids are described in Cermak, et al, Nucl. Acids Res. 1-11 (2011) . US Published Application No. 2011 / 0145940, which discloses TAL effectors and methods of using them to modify DNA. Miller et al. Nature Biotechnol 29: 143 (2011) reported making TALENs for site-specific nuclease architecture by linking TAL truncation variants to the catalytic domain of Fokl nuclease. The resulting TALENs were shown to induce gene modification in immortalized human cells. General design principles for TALE binding domains can be found in, for example, WO 2011 / 072246.
[0195] In some forms, ZFN-mediated knockout of tumor suppressor genes can be used to induce Hepatocellular Carcinoma (HCC) in mice.
[0196] In some forms, the element that induces a single or a double strand break in the target cell’s genome is a nucleic acid construct or constructs encoding a zinc finger nucleases (ZFNs) . ZFNs are typically fusion proteins that include a DNA-binding domain derived from a zinc-finger protein linked to a cleavage domain.
[0197] The most common cleavage domain is the Type IIS enzyme Fokl. Fok1 catalyzes double-stranded cleavage of DNA, at 9 nucleotides from its recognition site on one strand and 13 nucleotides from its recognition site on the other. See, for example, U.S. Pat. Nos. 5,356,802; 5,436,150 and 5,487,994; as well as Li et al. Proc., Natl. Acad. Sci. USA 89 (1992) : 4275-4279; Li et al. Proc. Natl. Acad. Sci. USA, 90: 2764-2768 (1993) ; Kim et al. Proc. Natl. Acad. Sci. USA. 91: 883-887 (1994a) ; Kim et al. J. Biol. Chem. 269: 31, 978-31, 982 (1994b) . One or more of these enzymes (or enzymatically functional fragments thereof) can be used as a source of cleavage domains.
[0198] The DNA-binding domain, which can, in principle, be designed to target any genomic location of interest, can be a tandem array of Cys2His2 zinc fingers, each of which generally recognizes three to four nucleotides in the target DNA sequence. The Cys2His2 domain has a general structure: Phe (sometimes Tyr) -Cys- (2 to 4 amino acids) -Cys- (3 amino acids) -Phe(sometimes Tyr) - (5 amino acids) -Leu- (2 amino acids) -His- (3 amino acids) -His. By linking together multiple fingers (the number varies: three to six fingers have been used per monomer in published studies) , ZFN pairs can be designed to bind to genomic sequences 18-36 nucleotides long.
[0199] Engineering methods include, but are not limited to, rational design and various types of empirical selection methods. Rational design includes, for example, using databases including triplet (or quadruplet) nucleotide sequences and individual zinc finger amino acid sequences, in which each triplet or quadruplet nucleotide sequence is associated with one or more amino acid sequences of zinc fingers which bind the particular triplet or quadruplet sequence. See, for example, U.S. Pat. Nos. 6,140,081; 6,453,242; 6,534,261; 6,610,512; 6,746,838; 6,866,997; 7,067,617; U.S. Published Application Nos. 2002 / 0165356; 2004 / 0197892; 2007 / 0154989; 2007 / 0213269; and International Patent Application Publication Nos. WO 98 / 53059 and WO 2003 / 016496.
[0200] In some forms, the genome editing composition optionally includes a donor polynucleotide. The modifications of the target DNA due to NHEJ and / or homology-directed repair can be used to induce gene correction, gene replacement, gene tagging, transgene insertion, nucleotide deletion, gene disruption, gene mutation, etc.
[0201] Accordingly, cleavage of DNA by the genome editing composition can be used to delete nucleic acid material from a target DNA sequence by cleaving the target DNA sequence and allowing the cell to repair the sequence in the absence of an exogenously provided donor polynucleotide. Thus, the subject methods can be used to knock out a gene (resulting in complete lack of transcription or altered transcription) or to knock in genetic material into a locus of choice in the target DNA.
[0202] Alternatively, if the genome editing composition includes a donor polynucleotide sequence that includes at least a segment with homology to the target DNA sequence, the methods can be used to add, i.e., insert or replace, nucleic acid material to a target DNA sequence (e.g., to “knock in” a nucleic acid that encodes for a protein, an siRNA, an miRNA, etc. ) , to add a tag (e.g., 6xHis, a fluorescent protein (e.g., a green fluorescent protein; a yellow fluorescent protein, etc. ) , hemagglutinin (HA) , FLAG, etc. ) , to add a regulatory sequence to a gene (e.g., promoter, polyadenylation signal, internal ribosome entry sequence (IRES) , 2A peptide, start codon, stop codon, splice signal, localization signal, etc. ) , to modify a nucleic acid sequence (e.g., introduce a mutation) , and the like. As such, the compositions can be used to modify DNA in a site-specific, i.e., “targeted” , way, for example gene knock-out, gene knock-in, gene editing, gene tagging, etc. as used in, for example, gene therapy.
[0203] In applications in which it is desirable to insert a polynucleotide sequence into a target DNA sequence, a polynucleotide including a donor sequence to be inserted is also provided to the cell. By a “donor sequence” or “donor polynucleotide” or “donor oligonucleotide” it is meant a nucleic acid sequence to be inserted at the cleavage site. The donor polynucleotide typically contains sufficient homology to a genomic sequence at the cleavage site, e.g., 70%, 80%, 85%, 90%, 95%, or 100%homology with the nucleotide sequences flanking the cleavage site, e.g., within about 50 bases or less of the cleavage site, e.g., within about 30 bases, within about 15 bases, within about 10 bases, within about 5 bases, or immediately flanking the cleavage site, to support homology-directed repair between it and the genomic sequence to which it bears homology. The donor sequence is typically not identical to the genomic sequence that it replaces. Rather, the donor sequence may contain at least one or more single base changes, insertions, deletions, inversions or rearrangements with respect to the genomic sequence, so long as sufficient homology is present to support homology-directed repair. In some forms, the donor sequence includes a non-homologous sequence flanked by two regions of homology, such that homology-directed repair between the target DNA region and the two flanking sequences results in insertion of the non-homologous sequence at the target region.
[0204] Donor sequences can also include a vector backbone containing sequences that are not homologous to the DNA region of interest and that are not intended for insertion into the DNA region of interest. Generally, the homologous region (s) of a donor sequence will have at least 50%sequence identity to a genomic sequence with which recombination is desired. In certain forms, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 99.9%sequence identity is present. Any value between 1%and 100%sequence identity can be present, depending upon the length of the donor polynucleotide.
[0205] The donor sequence can include certain sequence differences as compared to the genomic sequence, e.g., restriction sites, nucleotide polymorphisms, selectable markers (e.g., drug resistance genes, fluorescent proteins, enzymes etc. ) , etc., which can be used to assess for successful insertion of the donor sequence at the cleavage site or in some cases may be used for other purposes (e.g., to signify expression at the targeted genomic locus) . In some cases, if located in a coding region, such nucleotide sequence differences will not change the amino acid sequence, or will make silent amino acid changes (i.e., changes which do not affect the structure or function of the protein) . Alternatively, these sequences differences may include flanking recombination sequences such as FLPs, loxP sequences, or the like, that can be activated at a later time for removal of the marker sequence.
[0206] The donor sequence can be a single-stranded DNA, single-stranded RNA, double-stranded DNA, or double-stranded RNA. It can be introduced into a cell in linear or circular form. If introduced in linear form, the ends of the donor sequence can be protected (e.g., from exonucleolytic degradation) by methods known to those of skill in the art. For example, one or more dideoxynucleotide residues are added to the 3' terminus of a linear molecule and / or self-complementary oligonucleotides are ligated to one or both ends. See, for example, Chang et al. Proc. Natl. Acad. Sci. USA 84: 4959-4963 (1987) ; Nehls et al. Science 272: 886-889 (1996) . Additional methods for protecting exogenous polynucleotides from degradation include, but are not limited to, addition of terminal amino group (s) and the use of modified internucleotide linkages such as, for example, phosphorothioates, phosphor amidates, and O-methyl ribose or deoxyribose residues.
[0207] As an alternative to protecting the termini of a linear donor sequence, additional lengths of sequence can be included outside of the regions of homology that can be degraded without impacting recombination. A donor sequence can be introduced into a cell as part of a vector molecule having additional sequences such as, for example, replication origins, promoters and genes encoding antibiotic resistance.
[0208] 2. Single cell Sequencing to Identify TCRs
[0209] The activated TCRs in response to tumor antigens in HCC-bearing livers but not in the normal livers can be identified using sequencing methodologies, such as single-cell TCR-seq, as disclosed herein.
[0210] In some forms, individual T cells are analyzed by high-throughput multiplex amplification and sequencing of nucleic acids encoding T cell receptors (TCRs) and various other T cell phenotypic markers. The methods generally involve sorting of single T cells into separate locations (e.g., separate wells of a multi-well titer plate) followed by nested polymerase chain reaction (PCR) amplification of nucleic acids encoding TCRs and T cell phenotypic markers. The amplicons are barcoded to identify their cell of origin, combined, and analyzed by deep sequencing. The methods also involve reconstituting TCRs from individual T cells for functional studies, ligand discovery, or screening therapeutics.
[0211] In some forms, different methods of single sequencing are better suited for sequencing certain samples (e.g. rare samples may be more optimally sequenced with a plate based method or single nuclei sequencing) . In certain forms, plate based single cell RNA sequencing can be used (see, e.g., Picelli, S. et al., 2014, “Full-length RNA-seq from single cells using Smart-seq2” Nature protocols 9, 171-181, doi: 10.1038 / nprot. 2014.006) .
[0212] In some forms, high-throughput single-cell RNA-seq and / or targeted nucleic acid profiling can be used (for example, sequencing, quantitative reverse transcription polymerase chain reaction, and the like) where the RNAs from different cells are tagged individually, allowing a single library to be created while retaining the cell identity of each read. In this regard reference is made to Macosko et al., 2015, “Highly Parallel Genome-wide Expression Profiling of Individual Cells Using Nanoliter Droplets” Cell 161, 1202-1214; International patent application number PCT / US2015 / 049178, published as WO2016 / 040476 on Mar. 17, 2016; Klein et al., 2015, “Droplet Barcoding for Single-Cell Transcriptomics Applied to Embryonic Stem Cells” Cell 161, 1187-1201; International patent application number PCT / US2016 / 027734, published as WO2016168584A1 on Oct. 20, 2016; Zheng, et al., 2016, “Haplotyping germline and cancer genomes with high-throughput linked-read sequencing” Nature Biotechnology 34, 303-311; Zheng, et al., 2017, “Massively parallel digital transcriptional profiling of single cells” Nat. Commun. 8, 14049 doi: 10.1038 / ncomms14049; International patent publication number WO 2014210353 A2; Zilionis, et al., 2017, “Single-cell barcoding and sequencing using droplet microfluidics” Nat Protoc. January; 12 (1) : 44-73; Cao et al., 2017, “Comprehensive single cell transcriptional profiling of a multicellular organism by combinatorial indexing” bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi. org / 10.1101 / 104844; Rosenberg et al., 2017, “Scaling single cell transcriptomics through split pool barcoding” bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi. org / 10.1101 / 105163; Vitak, et al., “Sequencing thousands of single-cell genomes with combinatorial indexing” Nature Methods, 14 (3) : 302-308, 2017; Cao, et al., Comprehensive single-cell transcriptional profiling of a multicellular organism. Science, 357 (6352) : 661-667, 2017; and Gierahn et al., “Seq-Well: portable, low-cost RNA sequencing of single cells at high throughput” Nature Methods 14, 395-398 (2017) , all the contents and disclosure of each of which are herein incorporated by reference in their entirety.
[0213] In some forms, assessing the cell (sub) types and states present in the in vivo system may comprise analysis of expression matrices from the scRNA-seq data, performing dimensionality reduction, graph-based clustering and deriving list of cluster-specific genes in order to identify cell types and / or states present in the in vivo system. These marker genes may then be used throughout to relate the ex vivo system cell (sub) types and states to the in vivo system. The same analysis may then be applied to the source material for the ex vivo cell-based system. From both sets of sc-RNAseq analysis an initial distribution of gene expression data is obtained. In certain forms, the distribution may be a count-based metric for the number of transcripts of each gene present in a cell. Further the clustering and gene expression matrix analysis allow for the identification of key genes in the initial ex vivo system and the target in vivo system, such as differences in the expression of key transcription factors. In certain example forms, this may be done conducting differential expression analysis.
[0214] Examples
[0215] Methods
[0216] Mice. Mice in C57BL / 6J background were purchased from the Jackson Laboratory and bred in the animal facility at the Princess Margaret Cancer Centre. All animal experiments were approved by the University Health Network Animal Care Committee.
[0217] CRISPR and transposon vectors. sgRNAs targeting Trp53 and Pten were as previously described. The following guide oligos were designed to express (1) mouse Pten sgRNA: forward primer 5’-CACCGCTAACGATCTCTTTGATGA -3’ (SEQ ID NO: 62) and reverse primer 5’-AAACTCATCAAAGAGATCGTTAGC -3’ (SEQ ID NO: 63) ; and (2) mouse p53 sgRNA: forward primer 5’-CACCGCCTCGAGCTCCCTCTGAGCC -3’ (SEQ ID NO: 64) and reverse primer 5’-AAACGGCTCAGAGGGAGCTCGAGGC -3’ (SEQ ID NO: 65) . The annealed double-stranded guide oligos were cloned into the BbsI cut sites of pX330 vector. The p53 sgRNA cassette in pX330-p53 was amplified by PCR with primers 5’-GCTTCTAGACATGTGAGGGCCTATTTC -3’ (SEQ ID NO: 66) and 5’-TACAGCTAGCGCCATTTGTCTGCAGAATTGG-3’ (SEQ ID NO: 67) . This additional sgRNA cassette was then cut with NheI and XbaI and subcloned into NheI site of pX330-Pten to obtain the duplex CRISPR vector pX330-p53-Pten.
[0218] The transposon system with SB100X and pT2 / BH was described previously. The mouse c-Myc CDS was cloned into pT2 / BH with EcoR1 and NotI restriction enzymes to obtain the pT2-Myc plasmid.
[0219] Hydrodynamic injections to induce HCC. For delivery of transposon and CRISPR vectors, mice (8-20 weeks old) were injected with a volume of 100 ml / kg body weight containing 25 μg pX330-p53-Pten plus 0.66 μg SB100X and 5 μg pT2-Myc. The molar ratio of SB100X to pT2-Myc was 1: 5. Hydrodynamic injection into the lateral tail vein took 5-7 seconds. Blinding was achieved during injection by putting littermates of different genotypes into new cages lacking mouse information.
[0220] To evaluate and quantify HCC development, mice were monitored daily for the appearance of palpable tumors, which were defined as a discernable enlargement of the abdomen. Humane endpoints were defined as mortality or liver weight above 5 grams. The exact dates of when mice reached humane endpoints were determined after euthanizing mice bearing significant HCC. Livers collected at this stage were 3-7g in weight, and the exact endpoints were adjusted by one day per gram live weight. Early mortalities (< 5 days) were considered to be due to injection-associated death and removed from the analysis. The number of liver tumors was quantified by counting tumor nodules on the surface of liver or by normalizing the number of tumor clones to the area of liver sections. Blinding was performed in quantification of liver sections but not surface tumor nodules.
[0221] Hepatic mononuclear cell isolation. Mice were euthanized by CO2 asphyxiation and immediately subjected to whole-body perfusion with ice cold PBS containing 10 mM EDTA. Liver tissues were collected, disrupted, and passed through 70-μm sieves to obtain single-cell suspensions. Mononuclear cells (MNCs) were enriched by centrifugation through a 40 / 80%Percoll gradient for 20 min at 2000 rpm.
[0222] Flow cytometry. Antibodies and tetramers used to stain hepatic MNCs included anti-mouse CD4 BUV737, anti-mouse CD8 PerCP-Cy5.5, anti-mouse CD45 Alexa Fluor 700, anti-mouse CD19 BUV395, anti-mouse NK1.1 BV605, anti-mouse CD11b BV510 (all from BioLegend) ; and mouse CD1d PBS-57 BV421-labeled tetramer from the NIH Tetramer Facility.
[0223] Flow cytometric analyses were carried out using BD LSRFortessa cell analyzers.
[0224] Single-cell RNA-seq and data analysis. HCC was induced in Chat-GFP mice using pX330-p53-Pten plus SB100X and pT2-Myc. HCC livers (from two male and two female mice) and control livers (from sex-matched littermates) were collected for hepatic MNC isolation on day 26 of HCC induction. Hepatic MNC were stained with antibodies for CD4, CD8, CD19, TCR-β, NK1.1, CD45 and CD1d tetramer, as well as with barcode antibodies (TotalSeq-C0304, C0305, C0306, or C0307) to hashtag cells from individual mice of the HCC or control group. CD45+DAPI-NK1.1-CD1dTetramer-CD19-TCR-β+CD4+CD8-GFP+(Chat-GFP+ CD4+ T cells) and CD45+DAPI-NK1.1-CD1dTetramer-CD19-TCR-β+CD4+CD8-GFP- (Chat-GFP-CD4+ T cells) populations were sorted on a FACSAriaTM Fusion cell sorter (BD) , with the two CD4+ T cell compartments individually sorted from each mouse. The same CD4+ T cell compartments from mice receiving the same treatment were pooled into 4 samples: control Chat-GFP+, control Chat-GFP-, HCC Chat-GFP+ and HCC Chat-GFP-. After sorting and pooling, the samples were immediately submitted to the Princess Margaret Genomics Centre for downstream processing. The 4 samples were loaded on to a 10x Chromium Controller and libraries were prepared using a Chromium Next GEM Single Cell 5' HT Reagent Kits v2 (Dual Index) (10x Genomics) . The libraries were sequenced on an Illumina NovaSeq 6000 instrument. The sequencing depths were GEX ~50,000 reads / cell, TCR ~5000 reads per cell, and cell hashing TotalSeq C ~2000 reads / cell.
[0225] For single-cell RNA-seq data analysis, sequencing data were processed using Cell Ranger (version 7.0.0) and aligned to the annotated mouse genome (mm10) . The Cell Ranger VDJ pipeline was used to call TCR sequences. The clonotype analysis was performed on the merged contig annotations of four samples. The junctions of the V, D, and J segments were determined with the IMGT database. The filtered feature barcode matrices in the Hierarchical Data Format (. h5 files) and . csv files of filtered contig annotations from the 4 samples were analyzed with Partek Flow software (version 10.0.23.0214, license from CPOS Bioinformatics Core) and analyzed together. With the Split by feature type tool, the single cell counts were split into two data nodes: Gene Expression and Antibody Capture. After excluding low-quality cells (counts < 30,000; %mitochondrial counts < 30) , Gene Expression was normalized using the recommended CPM (counts per million) method. Antibody Capture was normalized with the recommended method (add 1.0, divide by geometric-mean, add 1.0, and Log 2.0) , and then the multiplets and cells with ambiguous hashing were filtered out. These two sets of data were then merged with the Merge matrices tool to obtain the filtered, uniquely hashtagged, and normalized counts. This counts data node was re-split to generate new Gene Expression and Antibody Capture nodes. Dimensionality reduction and visualization were performed on the new Gene Expression data node using PCA (Number of principal components: 100, Features contribute: by variance, and Split by sample: No) , Graph-based clusters (with default parameters except the Resolution was set to 1.0) , and UMAP (with default parameters) tools. Compute biomarkers was performed on graph-based clustering result to identify marker genes of each cell cluster. Differential analyses were performed using GSA and visualized with heatmap and volcano plot.
[0226] Immunohistological analyses. Sections cut from formalin-fixed, paraffin-embedded (FFPE) blocks of mouse livers were used for immunohistochemistry (IHC) . After dewaxing and rehydration, endogenous peroxidase was deactivated in 3%H2O2 (20 ml 30%H2O2 +180 ml PBS) for 15 min at RT. Antigen retrieval with 10 mM sodium citrate buffer (pH 6.0) was performed prior to immunostaining. Primary antibodies used for IHC included rabbit anti-CD3 (Abcam, ab5690) and rabbit anti-c-Myc (Cell Signaling, #5605) . Polymer-conjugated secondary antibody was HRP horse anti-rabbit IgG (MP-7405) from Vector Laboratories. ImmPACT Vector DAB peroxidase substrate (Vector Laboratories, SK-4100) were used for chromogenic detection. Immunostained histological sections were scanned using a NanoZoomer 2.0-HT slide scanner from Hamamatsu.
[0227] Statistical analyses. Pair-wise comparisons were assessed using the two-tailed unpaired Student’s t-test unless otherwise denoted in the Figure Legends. p values <0.05 were considered statistically significant. Data are shown as the mean ± SEM unless otherwise indicated.
[0228] Data availability. The single-cell RNA sequencing data of mouse HCC reported in this paper were deposit in the Gene Expression Omnibus (GEO) database under the accession code: GSE231322.
[0229] Results
[0230] Induction of HCC using CRISPR and transposon technology.
[0231] HCC was modeled in mice to identify the TCRs specific to HCC but not normal live tissue. This was accomplished by combining genetic alterations recurrently observed in the human disease. These changes included mutation of the TP53 and PTEN tumor suppressor genes and overexpression of the MYC oncogene. TP53 is commonly altered in human liver cancer, whereas PTEN protein is reduced or absent in about 40%of HCC patients. Hepatocyte-specific deletion of Pten in mice similarly leads to HCC development. Chromosomal amplifications involving MYC are among the most frequent DNA copy number changes in human HCC, and activation of MYC transcription is a central signature associated with the conversion of preneoplastic lesions to HCC.
[0232] With respect to the engineering of the above mutations, CRISPR-mediated somatic knockout of tumor suppressor genes, as well as transposon-based expression of oncogenes, have been shown to induce HCC in mice. To mimic the multi-stage and multi-hit process of human liver carcinogenesis, these two approaches were combined by ablating Trp53 and Pten using CRISPR, and over-expressing Myc using a transposon vector. To this end, a duplex CRISPR vector was generated with guide RNAs targeting the second exon of Trp53 and first exon of Pten, and a Sleeping Beauty transposon vector in which the Myc coding sequence was driven by a CAG promoter (Fig. 1A) . A combination of these vectors was delivered to mice via hydrodynamic injection, allowing for specific plasmid delivery to hepatocytes. Due to a combined effect between Myc expression and combined Trp53 and Pten ablation, rapid development of HCC was observed in injected mice. Neoplasms were visible on the liver surface by 15 days post-injection, and by day 25, significant tumor nodules were present (Fig. 1B) . Immunostaining confirmed that the majority of these tumor clones were negative for p53 and PTEN and positive for MYC (Figs. 1C-1D) .
[0233] Immunosurveillance is elicited in the HCC model
[0234] The immune microenvironment imposes selective pressure on the clonal expansion of tumor cells. To investigate whether immune responses were evoked during tumorigenesis in the model, tumor-infiltrating immune cells were investigated during HCC development. It was found that hepatic CD4+ T cells and CD8+ T cells expanded as HCC development progressed, whereas the percentage of NKT cells was reduced (Figs. 1E-1F) . Immunohistochemistry analysis revealed that the infiltrating immune cells were positioned around MYC+ preneoplastic cells as well as in established HCCs (Fig. 1G) . Therefore, immune responses, particularly those mediated by T cells, are activated in the HCC model. To determine if the immune system actively shaped tumorigenesis in the model, HCC was induced in severely immunodeficient NSG mice. Compared with immunocompetent animals, NSG mice developed a more severe disease, with a shorter survival (Fig. 1H) . These results show that immune cells participate in protection against liver cancer development in this setting.
[0235] The transcriptional landscape of CD4+ T cells in HCC
[0236] To delineate the heterogeneity and complexity of CD4+ T cells and elucidate the induction of these cells in HCC, single-cell RNA sequencing (scRNAseq) was conducted on sorted CD4+ T cells from 4 control and 4 HCC-bearing livers. The cells from individual mice were labeled with distinct antibody barcodes to facilitate sample de-convolution, pooled, and processed for CITE-seq coupled with TCR-seq. In total, eleven clusters of CD4+ T cells were identified: clusters C1 and C8 are two T cell clusters; C2 comprised Th17 cells and cells expressing IL18 receptor genes; C3 cells co-expressed Cxcr6 and Pdcd1; C4 contained follicular T helper cells (Tfh) and follicular regulatory T cells (Tfr) ; C5 cells were actively cycling; C6 cells expressed Ccl5 and Nkg7 but few other markers; C7 cells expressed Cxcr6 but were negative for Pdcd1; C9 cells were canonical Tregs; C10 cells showed strong expression of Eomes, Prf1, Gzmk, Fasl, Gzmb and other cytotoxic genes; and C11 was a minor cluster exhibiting high expression of interferon-stimulated genes (Figs. 2A-2C) . When these clusters were compared between control and HCC-bearing livers, a marked shift was observed from T cells to effector T cells in the presence of HCC, and particularly induction of the C3 cluster.
[0237] Cxcr6, a marker for resident T cells in the liver, was enriched primarily in the C3 and C7 clusters. In HCC livers, the CD4+ T cells contain a substantial number of C3 (Cxcr6+Pdcd1+) cells but is devoid of C7 (Cxcr6+Pdcd1-) cells (Fig. 2D) . These C3 cells showed high expression of inhibitory immunoreceptors and exhaustion marker genes such as Pdcd1, Havcr2, Ptpn11, Lag3, Tox, and Tigit. In contrast, the C7 cells strongly expressed differentiation, cytotoxicity-related, and other functional genes such as Il2ra, Il4, Il2, Fasl, Gzmb, and Csf2. These results indicate that Chat expression is associated with the appearance of dysfunctional Pdcd1+ T cells.
[0238] Tumor antigens drive clonal expansion of Chat-expressing CD4+ T cells in liver cancer
[0239] The proliferation characteristic of Chat-expressing T cells in HCC liver led us to investigate the driving force behind their expansion. Single-cell TCR-seq revealed repeated TCR types across all animals (as defined by shared amino acid sequences for both the TCR-α and TCR-β chains) (Figs. 3A-3B) . Among the top 30 most prevalent TCR types, only 5 were present in control mice, while the remaining 25 were observed in their HCC-bearing littermates (Figs. 3A-3B) . These results demonstrate a TCR-specific expansion of CD4+ T cells in liver cancer.
[0240] The most dominant TCR type in HCC was TCR #1, which was encoded by 25 clonotypes (as defined by shared mRNA sequences for both the TCR-α and TCR-β chains) . These clonotypes consisted of synonymous mRNA variants using the same combination of V, D, and J genes. The variations arose from distinct junctions of the V, D, and J segments occurring in different HCC-bearing mice, but the resulting amino acid sequence was identical due to codon redundancy (Fig. 3C) . This TCR convergence across HCC-bearing mice indicates that TCRs specific for HCC antigens elicit the expansion of CD4+ T cells, particularly within the Chat-GFP+CD4+ T cell compartment. The nature of the cells bearing this particular TCR type was then observed. T cells carrying TCR #1 were mainly from the C3 cluster that harbored Pdcd1+ Tconvs (Figs. 3D-3E) . These results support the clonal expansion of Chat-expressing PD-1+ Tconvs in mice.
[0241] Development of an engineered expression cassette for HCC-specific TCR
[0242] Among the 25 clonotypes, clone5 was detected in all the HCC mice analyzed. The VDJβ region of clone5 comprises Trbv16, Trbd1, and Trbj2-5 gene segments, while the VJαregion comprises Trav21-dv12 and Traj56 gene segments, with one N nucleotide addition (Fig. 4A-4D) .
[0243] To further elucidate the function of this HCC-specific TCR, TCR-expressing vectors were designed and built (Figs. 5A-5B) . The design and optimization include:
[0244] 1. Replaced endogenous signal sequences with FiBL signal sequence (Fibroin protein from Silk Moth) .
[0245] 2. Co-express alpha and beta TCRs using the T2A self-cleaving ribosome skipping peptide system.
[0246] 3. Insertion of a furin recognition site upstream of 2A allowed the removal of 2A residues that would otherwise be attached to the TCR beta.
[0247] 4. Codon Optimized all TCR sequences for mouse using GenSmart Algorithm (>8 fold increase in expression) .
[0248] 5. This TCR co-expression construct was cloned into different gene delivery and expression systems, including transposon, lentivirus, and retrovirus.
[0249] Discussion
[0250] TCRs are present on the surface of T-cells and recognize specific antigens presented by MHC. In cancer immunotherapy, TCRs can be modified to recognize specific cancer antigens, and these modified T-cells are then infused into the patient's bloodstream to target and destroy cancer cells. Several HCC tumor antigens have been identified, including alpha-fetoprotein (AFP) , glypican-3 (GPC3) , and melanoma-associated antigen-A (MAGE-A) . AFP is a marker of fetal liver development that is also expressed in some HCC cells. GPC3 is a glycoprotein that is overexpressed in HCC cells but not in normal liver cells. MAGE-Ais a cancer-testis antigen that is expressed in various tumor types, including HCC. In addition, antigens expressed by cancer cells derived from an oncogenic viral origin (VHB, VHC) are also targets for HCC immunotherapy. In 2015, TCR-engineered T cells were used against viral antigens (HBsAg) , resulting in modified T cells that survived and reduced HBsAg levels without toxicity, but without efficacy in end-stage metastatic disease. At LBO12, Sangro et al. presented data on AFPc332T-cells in HCC patients (NCT03132792) . One complete response and one stable disease were observed in four patients receiving ~5 billion or more transduced cells, with five patients in lower dose cohorts experiencing stable disease. Cytopenia occurred, but no T-cell related hepatic toxicity or DLTs. The first patient in Cohort 3 had a confirmed partial response with a rapid and sustained decrease in serum AFP levels.
[0251] TCR convergence is a phenomenon where T cells from different individuals recognize the same antigen with the same TCR amino acid sequence, despite having different TCR nucleotide sequences. This occurs due to the limited number of V, D, and J gene segments available for TCR gene rearrangement, which results in the stochastic generation of TCRs with the same amino acid sequence but different nucleotide sequences. Although the nucleotide sequences of the TCRs are different, the amino acid sequence remains the same, and this allows the T cells to recognize the same antigen. The TCR convergence observed in this study has important implications for the development of T cell-based cancer immunotherapies, as it facilitates the identification and isolation of T cells with specific antigen recognition capabilities.
[0252] In this study, based on the amino acid sequence of HCC-specific TCR, TCR-expressing vectors were designed and built, allowing for the expression of this specific TCR in cells, which can be used for various in vitro and in vivo applications such as:
[0253] 1. They can be used to identify the specific peptide sequence that the TCR recognizes. These TCR-expressing vectors can be used to generate T cell clones that recognize the specific tumor antigen. These T cell clones can then be used to screen libraries of peptides derived from the tumor antigen to identify the specific peptide epitope recognized by the TCR. This can help in the design of vaccines or immunotherapies that target the tumor antigen and stimulate an immune response against the cancer cells.
[0254] 2. Manufacturing TCR-engineered T cells: TCR-expressing vectors can be used to engineer T cells with specific TCRs for use in adoptive cell therapy.
[0255] 3. Studying T cell function: By expressing this specific TCR in cells, its function and activation in response to various stimuli can be studied. This can help us understand T cell biology and develop new immunotherapies for diseases.
[0256] 4. Screening potential immunotherapies: TCR-expressing vectors can be used to screen potential immunotherapies for their ability to activate or inhibit T cell responses. This can help identify new treatments for diseases such as cancer, autoimmune disorders, and infectious diseases.
[0257] It is understood that the disclosed method and compositions are not limited to the particular methodology, protocols, and reagents described as these can vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to limit the scope of the present invention which will be limited only by the appended claims.
[0258] Throughout the description and claims of this specification, the word “comprise” and variations of the word, such as “comprising” and “comprises, ” means “including but not limited to, ” and is not intended to exclude, for example, other additives, components, integers or steps.
[0259] “Optional” or “optionally” means that the subsequently described event, circumstance, or material may or may not occur or be present, and that the description includes instances where the event, circumstance, or material occurs or is present and instances where it does not occur or is not present.
[0260] Unless the context clearly indicates otherwise, use of the word “can” indicates an option or capability of the object or condition referred to. Generally, use of “can” in this way is meant to positively state the option or capability while also leaving open that the option or capability could be absent in other forms or embodiments of the object or condition referred to. Unless the context clearly indicates otherwise, use of the word “may” indicates an option or capability of the object or condition referred to. Generally, use of “may” in this way is meant to positively state the option or capability while also leaving open that the option or capability could be absent in other forms or embodiments of the object or condition referred to. Unless the context clearly indicates otherwise, use of “may” herein does not refer to an unknown or doubtful feature of an object or condition.
[0261] Ranges can be expressed herein as from “about” one particular value, and / or to “about” another particular value. When such a range is expressed, also specifically contemplated and considered disclosed is the range from the one particular value and / or to the other particular value unless the context specifically indicates otherwise. Similarly, when values are expressed as approximations, by use of the antecedent “about, ” it will be understood that the particular value forms another, specifically contemplated embodiment that should be considered disclosed unless the context specifically indicates otherwise. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint unless the context specifically indicates otherwise. It should be understood that all of the individual values and sub-ranges of values contained within an explicitly disclosed range are also specifically contemplated and should be considered disclosed unless the context specifically indicates otherwise. Finally, it should be understood that all ranges refer both to the recited range as a range and as a collection of individual numbers from and including the first endpoint to and including the second endpoint. In the latter case, it should be understood that any of the individual numbers can be selected as one form of the quantity, value, or feature to which the range refers. In this way, a range describes a set of numbers or values from and including the first endpoint to and including the second endpoint from which a single member of the set (i.e. a single number) can be selected as the quantity, value, or feature to which the range refers. The foregoing applies regardless of whether in particular cases some or all of these embodiments are explicitly disclosed.
[0262] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed method and compositions belong. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present method and compositions, the particularly useful methods, devices, and materials are as described. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such disclosure by virtue of prior invention. No admission is made that any reference constitutes prior art. The discussion of references states what their authors assert, and applicants reserve the right to challenge the accuracy and pertinency of the cited documents. It will be clearly understood that, although a number of publications are referred to herein, such reference does not constitute an admission that any of these documents forms part of the common general knowledge in the art.
[0263] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the method and compositions described herein. Such equivalents are intended to be encompassed by the following claims.
Claims
1.An immune protein comprising (a) a TCR β chain variable domain (TCR-β domain) comprising Complementarity Determining Regions (CDRs) having the sequences SGHSA (SEQ ID NO: 53) , FRNQAP (SEQ ID NO: 54) , and ASSLDRGQDTQY (SEQ ID NO: 55) , (b) a TCR α chain variable domain (TCR-α domain) comprising CDRs having the sequences TISGNEY (SEQ ID NO: 56) , GLQQN (SEQ ID NO: 57) , and ILRGTGGNNKLT (SEQ ID NO: 58) , or (c) both.2.The immune protein of claim 1, wherein the immune protein comprises a T-cell receptor (TCR) , wherein the TCR comprises the TCR-β domain, the TCR-α domain, or both.3.The immune protein of claim 1 or 2, wherein the TCR-β domain has a sequence identity of at least 75%to SEQ ID NO: 51, and wherein the TCR-α domain has a sequence identity of at least 75%to SEQ ID NO: 52.4.The immune protein of claim 3, wherein the TCR-β domain comprises the sequence SEQ ID NO: 51, and wherein the TCR-α domain comprises the sequence SEQ ID NO: 52.5.The immune protein of any one of claims 1-4, wherein the immune protein targets hepatocellular carcinoma (HCC) antigens.6.A pharmaceutical composition comprising the immune protein of any one of claims 1-5 and a pharmaceutically acceptable buffer, carrier, diluent or excipient.7.A nucleic acid encoding the immune protein of anyone of claims 1-5.8.A vector comprising the nucleic acid of claim 7.9.The vector of claim 8, wherein the nucleic acid comprises an expression segment comprising coding regions in the following order: a signal sequence (such as fibroin protein from silk moth (FiBL) ) , the TCR-β domain, a TCR β constant region, a furin cleavage site, a flexible linker, T2A, the TCR-α domain, and a TCR α constant region.10.A cell expressing the immune protein of any one of claims 1-5.11.The cell of claim 10, wherein the cell is a genetically modified T-cell.12.A population of cells derived by expanding the cell of claim 11.13.A pharmaceutical composition comprising the population of cells of claim 12 and a pharmaceutically acceptable buffer, carrier, diluent or excipient.14.A method of treating a subject having a disease, disorder, or condition, the method comprising administering to the subject an effective amount of the pharmaceutical composition of claim 6 or 13.15.The method of claim 14, wherein the subject has HCC or has been identified as being at increased risk of getting HCC.16.The method of claim 14 or 15, wherein the population of cells were isolated from or derived from the expansion of a cell obtained from the subject having the disease, disorder, or condition prior to the introduction to the cell.17.The method of claim 14 or 15, wherein the population of cells were isolated from, or derived from the expansion of a cell obtained from a healthy donor.