Protein binding NKG2D, CD16, and CEACAM5

Abstract

Multispecific binding proteins that bind to NKG2D, CD16, and CEACAM5, as well as pharmaceutical compositions and methods of treatment useful in the treatment of cancer, are described.

Description

[Technical Field]

[0001] The present invention relates to multispecific binding proteins that bind to NKG2D, CD16, and CEACAM5. [Background technology]

[0002] Despite considerable research efforts, cancer remains a significant clinical and economic burden in countries around the world. According to the World Health Organization (WHO), cancer is the second leading cause of death. Surgery, radiation therapy, chemotherapy, biological therapy, immunotherapy, hormonal therapy, stem cell transplantation, and precision medicine are among the existing treatment modalities. Despite extensive research in these fields, highly effective therapeutic solutions, especially for the most aggressive cancers, have yet to be identified. Furthermore, many of the existing anti-cancer treatments have substantial adverse side effects.

[0003] Cancer immunotherapy is desirable because it is highly specific and can use a patient's own immune system to promote the destruction of cancer cells. Fusion proteins, such as bispecific T cell engagers, are cancer immunotherapies described in the literature that bind to tumor cells and T cells to promote tumor cell destruction. Antibodies that bind to specific tumor-associated antigens have been described in the literature. See, for example, WO 2016 / 134371 and WO 2015 / 095412.

[0004] Natural killer (NK) cells are components of the innate immune system and comprise approximately 15% of circulating lymphocytes. NK cells infiltrate virtually all tissues and were initially characterized by their ability to effectively kill tumor cells without the need for prior sensitization. Activated NK cells kill target cells by means similar to cytotoxic T cells, namely, via cytolytic granules containing perforin and granzymes, as well as via death receptor pathways. Activated NK cells also secrete proinflammatory cytokines, such as IFN-γ and chemokines, which promote the recruitment of other leukocytes to target tissues.

[0005] NK cells respond to signals through various activating and inhibitory receptors on their surface. For example, when NK cells encounter healthy autologous cells, their activity is inhibited through activation of killer cell immunoglobulin-like receptors (KIRs). Alternatively, when NK cells encounter foreign or cancer cells, they are activated through their activating receptors (e.g., NKG2D, NCR, DNAM1). NK cells are also activated by the constant regions of several immunoglobulins through CD16, an Fc receptor (Fcγ receptor III) present on the surface of NK cells. The overall sensitivity of NK cells to activation depends on the sum of stimulatory and inhibitory signals. NKG2D is a type II transmembrane protein expressed by essentially all natural killer cells, where it serves as an activating receptor. NKG2D is also found on T cells, where it acts as a costimulatory receptor. The ability to modulate NK cell function through NKG2D is useful in various therapeutic settings, including malignancies.

[0006] Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), also known as meconium antigen 100, CEA, carcinoembryonic antigen, CD66e, or CD66e antigen, is a member of the immunoglobulin superfamily. It is a large cell surface glycoprotein that primarily functions as a cell adhesion molecule mediating cell-cell contact. In addition to its function in cell adhesion and migration, CEACAM5 has been found to be overexpressed in a high percentage of human cancers, including 90% of gastrointestinal, colorectal, and pancreatic cancers, 70% of non-small cell lung cancers, and 50% of breast cancers. Overexpression of CEACAM5 has been shown to positively correlate with enhanced tumorigenicity and tumor invasiveness.

[0007] Proteins (e.g., antibodies) that bind to CEACAM5 are being developed as potential anti-cancer therapies but face significant challenges. Some of these challenges, such as the high level of homology with other CEACAM family members, the low percentage of homology with cynomolgus monkey (cyno) CEACAM5, and the highly glycosylated nature of the protein, make it difficult to achieve both monospecificity for human CEACAM5 and cross-reactivity with cynomolgus monkey CEACAM5. These challenges highlight the need in the field for novel and useful antibodies for use in treating CEACAM5-associated cancers. [Prior art documents] [Patent documents]

[0008] [Patent Document 1] International Publication No. 2016 / 134371 [Patent Document 2] International Publication No. 2015 / 095412 Summary of the Invention

[0009] The present invention provides multispecific binding proteins that bind to the NKG2D receptor and CD16 on natural killer cells and the tumor-associated antigen CEACAM5 (carcinoembryonic antigen-related cell adhesion molecule 5). Such proteins can engage more than one NK activating receptor and block the binding of natural ligands to NKG2D. In certain embodiments, the proteins can agonize human NK cells. In some embodiments, the proteins can agonize NK cells of humans and other species, such as rodents and cynomolgus monkeys. Also provided are formulations containing any one of the proteins described herein; cells containing one or more nucleic acids expressing the proteins; and methods of enhancing tumor cell death using the proteins.

[0010] Thus, in one aspect, the present disclosure provides a protein comprising a first antigen-binding site that binds to NKG2D, a second antigen-binding site that binds to CEACAM5, and in each case (i.e., a third antigen-binding site, antibody Fc domain, or portion) a third antigen-binding site that binds to CD16, or an antibody Fc domain or portion thereof.

[0011] In some embodiments, the second antigen binding site that binds to CEACAM5 comprises a heavy chain variable domain (VH) comprising complementarity determining region (CDR) 1 (CDRH1), CDRH2, and CDRH3, wherein CDRH1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 3 and 102, CDRH2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 37, 104, and 718, and CDRH3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 38, and 105.

[0012] In some embodiments, the second antigen binding site that binds to CEACAM5 comprises a light chain variable domain (VL) comprising CDR1 (CDL1), CDRL2, and CDRL3, wherein CDRL1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 7, 40, and 107, CDRL2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 8, 41, and 108, and CDRL3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 42, and 109.

[0013] In some embodiments, CDRH1, CDRH2, and CDRH3 of the second antigen-binding site are (i) SEQ ID NOs: 3, 37, and 38, respectively; (ii) SEQ ID NOs: 3, 718, and 6, respectively; or (iii) SEQ ID NOs: 102, 104, and 105, respectively.

[0014] In some embodiments, CDRL1, CDRL2, and CDRL3 of the second antigen binding site are (i) SEQ ID NOs: 7, 8, and 9, respectively; (ii) SEQ ID NOs: 40, 41, and 42, respectively; or (iii) SEQ ID NOs: 107, 108, and 109, respectively.

[0015] In some embodiments, CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 are (i) SEQ ID NOs: 3, 37, 38, 40, 41, and 42, respectively; (ii) SEQ ID NOs: 3, 718, 6, 7, 8, and 9, respectively; or (iii) SEQ ID NOs: 102, 104, 105, 107, 108, and 109, respectively.

[0016] In some embodiments, the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 704, 708, 711, and 715, and the VL comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 591, 705, 712, and 716.

[0017] In some embodiments, the VH and VL are (i) SEQ ID NOs: 704 and 705, respectively; (ii) SEQ ID NOs: 708 and 591, respectively; (iii) SEQ ID NOs: 711 and 712, respectively; or (iv) SEQ ID NOs: 715 and 716, respectively.

[0018] In some embodiments, the second antigen-binding site is a single-chain variable fragment (scFv), and the scFv comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 703, 707, 710, and 714.

[0019] In some embodiments, the second antigen-binding site binds to a human CEACAM5 variant comprising the amino acid sequence of SEQ ID NO:391.

[0020] In some embodiments, the protein comprises an antibody Fc domain or portion thereof that binds to CD16.

[0021] In some embodiments, the first antigen-binding site that binds to NKG2D is a Fab fragment and the second antigen-binding site that binds to CEACAM5 is an scFv. In some embodiments, the first antigen-binding site that binds to NKG2D is an scFv and the second antigen-binding site that binds to CEACAM5 is a Fab fragment.

[0022] In some embodiments, the protein comprises (i) a first antigen-binding site that binds to NKG2D, (ii) a second antigen-binding site that binds to CEACAM5, and (iii) a third antigen-binding site that binds to CD16, in either case, or an antibody Fc domain or portion thereof, and the protein further comprises an additional antigen-binding site that binds to CEACAM5. In some embodiments, the first antigen-binding site that binds to NKG2D is an scFv, and the second and additional antigen-binding sites that bind to CEACAM5 are each Fab fragments. In some embodiments, the first antigen-binding site that binds to NKG2D is an scFv, and the second and additional antigen-binding sites that bind to CEACAM5 are each scFv.

[0023] In some embodiments, the scFv that binds CEACAM5 and / or the scFv that binds NKG2D comprises a heavy chain variable domain and a light chain variable domain.

[0024] In some embodiments, the scFv is linked to an antibody Fc domain, or portion thereof, that binds CD16, via a hinge comprising Ala-Ser or Gly-Ser. In some embodiments, the hinge further comprises the amino acid sequence Thr-Lys-Gly. In certain embodiments, Thr-Lys-Gly is N-terminal or C-terminal to the Ala-Ser or Gly-Ser.

[0025] In some embodiments, the heavy chain variable domain of the scFv forms a disulfide bridge with the light chain variable domain of the scFv, hi some embodiments, the disulfide bridge is formed between C44 of the heavy chain variable domain and C100 of the light chain variable domain, numbered according to the Kabat numbering scheme.

[0026] In some embodiments, the heavy chain variable domain of the scFv is linked to the light chain variable domain of the scFv via a flexible linker. In some embodiments, the flexible linker comprises (G4S)4 (SEQ ID NO: 532).

[0027] In some embodiments, the heavy chain variable domain of the scFv is positioned C-terminal to the light chain variable domain. In some embodiments, the heavy chain variable domain of the scFv is positioned N-terminal to the light chain variable domain. In some embodiments, the Fab is not located between the antigen-binding site and the antibody Fc domain or portion thereof.

[0028] In some embodiments, a first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% identical to a VH sequence selected from Table 1, and a VL comprising an amino acid sequence at least 90% identical to a VL sequence selected from Table 1, wherein the VH sequence and VL sequence selected from Table 1 are derived from the same clone. In some embodiments, a first antigen-binding site that binds to NKG2D comprises a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 524 or 525, respectively, and a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively.

[0029] In some embodiments, a first antigen-binding site that binds to NKG2D comprises (i) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 509 or 510, respectively, and a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively. In some embodiments, a first antigen-binding site that binds to NKG2D comprises a VH comprising CDRH1, CDRH2, and CDRH3 comprising the amino acid sequences of SEQ ID NOs: 495, 496, and 510, respectively, and a VL comprising CDRL1, CDRL2, and CDRL3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively. In some embodiments, the VH of the first antigen-binding site comprises an amino acid sequence at least 90% identical to SEQ ID NO: 508, and the VL of the first antigen-binding site comprises an amino acid sequence at least 90% identical to SEQ ID NO: 493.

[0030] In some embodiments, the VH of the first antigen-binding site comprises the amino acid sequence of SEQ ID NO:508 and the VL of the first antigen-binding site comprises the amino acid sequence of SEQ ID NO:493.

[0031] In some embodiments, the antibody Fc domain is a human IgG1 antibody Fc domain. In some embodiments, the antibody Fc domain, or a portion thereof, comprises an amino acid sequence that is at least 90% identical to SEQ ID NO:531.

[0032] In some embodiments, at least one polypeptide chain of the antibody Fc domain or portion thereof comprises one or more mutations at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the EU numbering system, relative to SEQ ID NO: 531.

[0033] In some embodiments, at least one polypeptide chain of an antibody Fc domain, or portion thereof, has the following amino acids, numbered according to the EU numbering system, relative to SEQ ID NO: 531: Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366K ... 6L, T366M, T366K, T366W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K392D, K392E, T394F, D399R, D399K, D399V, S400K, S400R, D401K, F405A, F405T, Y407A, Y407I, Y407V, K409F, K409W, K409D, T411D, T411E, K439D, and K439E.

[0034] In some embodiments, one polypeptide chain of an antibody Fc domain, or portion thereof, consists of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the Kabat numbering system, relative to SEQ ID NO: 531. and the other polypeptide chain of the Fc domain or portion thereof comprises one or more mutations at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, S364, T366, L368, K370, N390, K392, T394, D399, D401, F405, Y407, K409, T411, and K439 relative to SEQ ID NO: 531.

[0035] In some embodiments, one polypeptide chain of the antibody Fc domain or portion thereof comprises a K360E and a K409W substitution relative to SEQ ID NO: 531, numbered according to the Kabat numbering system, and the other polypeptide chain of the antibody Fc domain or portion thereof comprises a Q347R, a D399V and a F405T substitution relative to SEQ ID NO: 531. In some embodiments, one polypeptide chain of the antibody Fc domain or portion thereof comprises a Y349C substitution relative to SEQ ID NO: 531, numbered according to the Kabat numbering system, and the other polypeptide chain of the antibody Fc domain or portion thereof comprises a S354C substitution relative to SEQ ID NO: 531.

[0036] Another aspect of the present disclosure provides a protein comprising: (a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 549; (b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 550; and (c) a third polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 702, 706, 709, and 713.

[0037] Another aspect of the present disclosure provides an isolated nucleic acid molecule or a plurality of isolated nucleic acid molecules encoding any of the disclosed proteins.

[0038] Another aspect of the present disclosure provides an expression vector comprising an isolated nucleic acid molecule, or a plurality of isolated nucleic acid molecules, encoding any of the disclosed proteins.

[0039] Another aspect of the present disclosure provides a plurality of expression vectors comprising a plurality of isolated nucleic acid molecules.

[0040] Another aspect of the present disclosure provides a host cell comprising one or more expression vectors. In some embodiments, the host cell comprises multiple expression vectors. In some embodiments, the host cell is a Chinese hamster ovary (CHO) cell.

[0041] Another aspect of the present disclosure provides a method for producing a protein comprising (a) a first antigen-binding site that binds to NKG2D, (b) a second antigen-binding site that binds to CEACAM5, and (c) a third antigen-binding site that binds to CD16, or an antibody Fc domain or portion thereof, the method comprising: (i) providing a host cell of the present disclosure; (ii) culturing the host cell in a medium under conditions suitable for expression of the protein; and (iii) isolating the protein from the medium.

[0042] Another aspect of the present disclosure provides a method for producing a protein comprising first, second, and third polypeptides, the method comprising: (a) providing one or more host cells, wherein the one or more host cells contain an expression vector or a plurality of expression vectors comprising: (i) a first isolated nucleic acid molecule encoding a first polypeptide comprising the amino acid sequence of SEQ ID NO: 549; (ii) a second isolated nucleic acid molecule encoding a second polypeptide comprising the amino acid sequence of SEQ ID NO: 550; and (iii) a third nucleic acid molecule encoding a third polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 702, 706, 709, and 713; (b) culturing the one or more cells in a medium under conditions suitable for expression of the first, second, and third polypeptides; (c) recovering the polypeptides from the host cells and / or culture medium; and (d) purifying the recovered polypeptides under conditions to thereby produce the protein.

[0043] Another aspect of the present disclosure provides a pharmaceutical composition comprising a protein described herein and a pharmaceutically acceptable carrier.

[0044] Another aspect of the present disclosure provides a method of enhancing tumor cell death, comprising exposing tumor cells and natural killer cells to an effective amount of a protein described herein or a pharmaceutical composition described herein.

[0045] Another aspect of the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof an effective amount of a protein described herein or a pharmaceutical composition described herein.

[0046] Another aspect of the present disclosure provides use of a protein in the manufacture of a medicament for treating cancer in a human subject, wherein the protein comprises: (a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 549; (b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 550; and (c) a third polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 702, 706, 709, and 713.

[0047] In some embodiments, the cancer is selected from the group consisting of gastrointestinal cancer, colorectal cancer, pancreatic cancer, non-small cell lung cancer, and esophageal cancer. In some embodiments, the cancer expresses CEACAM5.

[0048] The present invention also provides binding proteins that bind to CEACAM5. The binding proteins comprise an antigen-binding site disclosed herein. In some embodiments, the binding protein is an antibody or antigen-binding fragment thereof having an antigen-binding site disclosed herein. In other embodiments, the antigen-binding site is an antigen-binding fragment of an antibody. The present invention also relates to nucleic acids encoding the binding proteins, methods of making the binding proteins, and uses of the binding proteins in treating diseases.

[0049] In some embodiments, the antigen-binding site comprises a VH comprising CDRH1, CDRH2, and CDRH3, and a VL comprising CDRL1, CDRL2, and CDRL3, wherein (i) CDRH1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 3 and 102, (ii) CDRH2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 37, 104, and 718, (iii) CDRH3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 38, and 105, (iv) CDRL1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 7, 40, and 107, (v) CDRL2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 8, 41, and 108, and (vi) CDRL3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 42, and 109.

[0050] In some embodiments, CDRH1, CDRH2, and CDRH3 are (i) SEQ ID NOs: 3, 37, and 38, respectively; (ii) SEQ ID NOs: 3, 718, and 6, respectively; or (iii) SEQ ID NOs: 102, 104, and 105, respectively, and CDRL1, CDRL2, and CDRL3 of the second antigen binding site are (iv) SEQ ID NOs: 7, 8, and 9, respectively; (v) SEQ ID NOs: 40, 41, and 42, respectively; or (vi) SEQ ID NOs: 107, 108, and 109, respectively.

[0051] In some embodiments, CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 are (i) SEQ ID NOs: 3, 37, 38, 40, 41, and 42, respectively; (ii) SEQ ID NOs: 3, 718, 6, 7, 8, and 9, respectively; or (iii) SEQ ID NOs: 102, 104, 105, 107, 108, and 109, respectively.

[0052] In some embodiments, the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 704, 708, 711, and 715, and the VL comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 591, 705, 712, and 716.

[0053] In some embodiments, the VH and VL are (i) SEQ ID NOs: 704 and 705, respectively; (ii) SEQ ID NOs: 708 and 591, respectively; (iii) SEQ ID NOs: 711 and 712, respectively; or (iv) SEQ ID NOs: 715 and 716, respectively.

[0054] In some embodiments, the antigen-binding site is a Fab fragment or an scFv. In some embodiments, the antigen-binding site is an scFv comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 703, 707, 710, and 714.

[0055] In some embodiments, the antigen-binding site binds to a human CEACAM5 variant comprising the amino acid sequence of SEQ ID NO:391.

[0056] In some embodiments, the protein comprises an antibody Fc domain or portion thereof that binds to CD16. In some embodiments, the antibody Fc domain or portion thereof that binds to CD16 is linked to the antigen-binding site via a hinge comprising Ala-Ser or Gly-Ser. In some embodiments, the hinge further comprises the amino acid sequence Thr-Lys-Gly.

[0057] In some embodiments, the VH domain of the scFv forms a disulfide bridge with the VL domain of the scFv, hi some embodiments, the disulfide bridge is formed between C44 of the VH and C100 of the VL, numbered according to the Kabat numbering scheme.

[0058] In some embodiments, the VH of the scFv is linked to the VL of the scFv via a flexible linker. In some embodiments, the flexible linker comprises (G4S)4 (SEQ ID NO: 532).

[0059] In some embodiments, the VH of the scFv is located at the C-terminus of the VL. In some embodiments, the VH of the scFv is located at the N-terminus of the VL.

[0060] In some embodiments, the antibody Fc domain is a human IgG1 antibody Fc domain. In some embodiments, the antibody Fc domain, or a portion thereof, comprises an amino acid sequence that is at least 90% identical to SEQ ID NO:531.

[0061] In some embodiments, at least one polypeptide chain of the antibody Fc domain or portion thereof comprises one or more mutations at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the EU numbering system, relative to SEQ ID NO: 531.

[0062] In some embodiments, at least one polypeptide chain of an antibody Fc domain, or portion thereof, has the following amino acids, numbered according to the EU numbering system, relative to SEQ ID NO: 531: Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366K ... 6L, T366M, T366K, T366W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K392D, K392E, T394F, D399R, D399K, D399V, S400K, S400R, D401K, F405A, F405T, Y407A, Y407I, Y407V, K409F, K409W, K409D, T411D, T411E, K439D, and K439E.

[0063] In some embodiments, one polypeptide chain of an antibody Fc domain, or portion thereof, consists of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the Kabat numbering system, relative to SEQ ID NO: 531. The other polypeptide chain of the antibody Fc domain or portion thereof comprises one or more mutations at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, S364, T366, L368, K370, N390, K392, T394, D399, D401, F405, Y407, K409, T411, and K439 relative to SEQ ID NO: 531.

[0064] In some embodiments, one polypeptide chain of the antibody Fc domain or portion thereof comprises K360E and K409W substitutions relative to SEQ ID NO:531, numbered according to the Kabat numbering system, and the other polypeptide chain of the antibody Fc domain or portion thereof comprises Q347R, D399V and F405T substitutions relative to SEQ ID NO:531.

[0065] In some embodiments, one polypeptide chain of the antibody heavy chain constant region comprises a Y349C substitution relative to SEQ ID NO:531, numbered according to the Kabat numbering system, and the other polypeptide chain of the antibody heavy chain constant region comprises a S354C substitution relative to SEQ ID NO:531.

[0066] In some embodiments, the protein further comprises a second antigen binding site that binds to CEACAM5.

[0067] Another aspect of the present disclosure provides isolated nucleic acid molecules encoding any of the disclosed proteins, including but not limited to, binding proteins, antibodies, antigen-binding fragments, or antigen-binding sites.

[0068] Another aspect of the present disclosure provides an expression vector comprising an isolated nucleic acid molecule encoding any of the disclosed proteins.

[0069] Another aspect of the present disclosure provides a host cell comprising an expression vector comprising an isolated nucleic acid molecule encoding any of the disclosed proteins. In some embodiments, the host cell is a Chinese hamster ovary (CHO) cell.

[0070] Another aspect of the present disclosure provides a method of producing a protein, the method comprising: (a) providing a host cell containing an expression vector comprising an isolated nucleic acid molecule encoding any of the disclosed proteins; (b) culturing the host cell in a medium under conditions suitable for expression of the protein; and (c) isolating the protein from the medium.

[0071] Another aspect of the present disclosure provides a method of enhancing tumor cell death, comprising exposing tumor cells and natural killer cells to an effective amount of a protein described herein or a pharmaceutical composition described herein.

[0072] Another aspect of the present disclosure provides a method of treating cancer, comprising administering to a patient in need thereof an effective amount of a protein described herein or a pharmaceutical composition described herein.

[0073] Another aspect of the present disclosure provides use of a protein described herein in the manufacture of a medicament for treating cancer in a human subject, wherein the protein comprises: (a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 549; (b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 550; and (c) a third polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 702, 706, 709, and 713.

[0074] In some embodiments, the cancer is selected from the group consisting of gastrointestinal cancer, colorectal cancer, pancreatic cancer, non-small cell lung cancer, and esophageal cancer. In some embodiments, the cancer expresses CEACAM5.

[0075] Various aspects and embodiments of the invention are described in further detail below. [Brief explanation of the drawings]

[0076] [Figure 1]

[0023] Figure 1 is a diagram of a heterodimeric multispecific antibody, e.g., a trispecific binding protein (TriNKET). Each arm can represent either an NKG2D-binding domain or a CEACAM5-binding domain. In some embodiments, the NKG2D-binding domain and the CEACAM5-binding domain can share a common light chain. [Figure 2A] FIG. 1 shows an exemplary format of a multispecific binding protein, such as TriNKET. [Figure 2B] FIG. 1 shows an exemplary format of a multispecific binding protein, such as TriNKET. [Figure 2C] FIG. 1 shows an exemplary format of a multispecific binding protein, such as TriNKET. [Figure 2D] FIG. 1 shows an exemplary format of a multispecific binding protein, such as TriNKET. [Figure 2E]Figures 2A-2D show exemplary formats of multispecific binding proteins, such as TriNKET. As shown in Figure 2A, either the NKG2D-binding domain or the CEACAM5-binding domain can be in scFv format (left arm). An antibody comprising an NKG2D-targeting scFv, a CEACAM5-targeting Fab fragment, and a CD16-targeting heterodimerized antibody Fc domain or a portion thereof is referred to herein as F3-TriNKET. An antibody comprising a CEACAM5-targeting scFv, an NKG2D-targeting Fab fragment, and a CD16-binding heterodimerized antibody Fc domain or a portion thereof is referred to herein as F3'-TriNKET (Figure 2E). As shown in Figure 2B, both the NKG2D-binding domain and the CEACAM5-binding domain can be in scFv format. Figures 2C-2D are diagrams of an antibody with three antigen-binding sites, including two antigen-binding sites that bind CEACAM5 and an NKG2D-binding site fused to a CD16-binding heterodimerized antibody Fc domain or a portion thereof. These antibody formats are referred to herein as F4-TriNKET. Figure 2C shows that the two CEACAM5-binding sites are in Fab fragment format and the NKG2D-binding site is in scFv format. Figure 2D shows that the CEACAM5-binding site is in scFv format and the NKG2D-binding site is in scFv format. Figure 2E depicts a TriNKET that includes a tumor-targeting scFv, an NKG2D-targeting Fab fragment, and a heterodimerized antibody Fc domain, or portion thereof, that binds to CD16, also referred to herein as the constant region / domain ("CD domain"). The antibody format is referred to herein as F3'-TriNKET. In certain exemplary multispecific binding proteins, heterodimerization mutations on an antibody Fc domain or portion thereof include K360E and K409W on one polypeptide chain of the Fc domain or portion thereof, and Q347R, D399V, and F405T on the opposite polypeptide chain of the Fc domain or portion thereof (shown as a triangular lock-and-key shape in the Fc domain). The thick bar between the heavy and light chain variable domains of the Fab fragment represents a disulfide bond. [Figure 3] Figure 1 shows the triomab form of TriNKET, a trifunctional bispecific antibody that maintains an IgG-like shape. This chimera consists of two half antibodies, each with one light chain and one heavy chain, derived from two corresponding antibodies. The triomab form can be a heterodimeric construct containing one-half rat antibody and one-half mouse antibody. [Figure 4] This diagram shows a KiH common light chain format TriNKET, which incorporates knobs-into-holes (KIH) technology. KiH is a heterodimer containing two Fab fragments that bind to targets 1 and 2 and an Fc stabilized by heterodimerization mutations. TriNKET in KiH format can be a heterodimeric construct with two Fab fragments that bind to targets 1 and 2, containing two different heavy chains and a common light chain paired with both heavy chains. [Figure 5] Diagram of TriNKET in the form of a dual variable domain immunoglobulin (DVD-Ig™) that combines the target binding domains of two monoclonal antibodies via a flexible, naturally occurring linker, resulting in a tetravalent IgG-like molecule. DVD-Ig™ is a homodimeric construct in which the variable domain targeting antigen 2 is fused to the N-terminus of the variable domain of an antigen 1-targeting Fab fragment. The DVD-Ig™ form contains a normal Fc. [Figure 6] Diagram of TriNKET in orthogonal Fab fragment interface (Ortho-Fab) form, a heterodimeric construct containing two Fab fragments that bind target 1 and target 2 fused to an Fc. Light chain (LC)-heavy chain (HC) pairing is ensured by the orthogonal interface. Heterodimerization is ensured by mutations in the Fc. [Figure 7] FIG. 1 is a diagram of TriNKET in 2-in-1 Ig format. [Figure 8] Schematic of the ES form of TriNKET, a heterodimeric construct containing two different Fab fragments that bind target 1 and target 2 fused to an Fc. Heterodimerization is ensured by electrostatic steering mutations in the Fc. [Figure 9]Fab arm swapped form: Diagram of TriNKET in antibodies where Fab fragment arms are exchanged by swapping the heavy chain and binding light chain (half molecule) with a heavy-light chain pair from another molecule, resulting in a bispecific antibody. The Fab arm swapped form (cFae) is a heterodimer containing two Fab fragments that bind to targets 1 and 2 and an Fc stabilized by a heterodimerization mutation. [Figure 10] FIG. 1 is a diagram of the SEED body form of TriNKET, a heterodimer containing two Fab fragments that bind to targets 1 and 2 and an Fc stabilized by a heterodimerization mutation. [Figure 11] Diagram of the LuZ-Y form of TriNKET, which uses a leucine zipper to induce heterodimerization of two different HCs. The LuZ-Y form is a heterodimer containing two different scFabs that bind to targets 1 and 2 fused to an Fc. Heterodimerization is ensured by the leucine zipper motif fused to the C-terminus of the Fc. [Figure 12] FIG. 10: Diagram of TriNKET in Cov-X-body form. [Figure 13A] FIG. 1 shows the κλ-body form of TriNKET, a heterodimeric construct with two different Fab fragments fused to an Fc stabilized by heterodimerization mutations, where one Fab fragment targeting antigen 1 contains a kappa LC and the second Fab fragment targeting antigen 2 contains a lambda LC. [Figure 13B] 13A-13B show a κλ-body form of TriNKET, which is a heterodimeric construct with two different Fab fragments fused to an Fc stabilized by heterodimerization mutations, where one Fab fragment targeting antigen 1 contains a kappa LC and the second Fab fragment targeting antigen 2 contains a lambda LC. Figure 13A is an exemplary representation of one form of κλ-body, and Figure 13B is an exemplary diagram of another κλ-body. [Figure 14]FIG. 1 shows an Oasc-Fab heterodimer construct containing a Fab fragment that binds to target 1 and an scFab that binds to target 2, both fused to an Fc domain. Heterodimerization is ensured by mutations in the Fc domain. [Figure 15]

[0023] Figure 1 shows DuetMab, a heterodimeric construct containing two different Fab fragments that bind antigens 1 and 2 and an Fc stabilized by heterodimerization mutations. Fab fragments 1 and 2 contain differential S-S bridges that ensure correct light and heavy chain pairing. [Figure 16] CrossmAb is a heterodimeric construct with two different Fab fragments that bind to targets 1 and 2 and an Fc stabilized by heterodimerization mutations. The CL and CH1 domains, as well as the VH and VL domains, are switched, e.g., CH1 is fused in-line with VL and CL is fused in-line with VH. [Figure 17] Figure 1 shows Fit-Ig, a homodimeric construct in which a Fab fragment that binds antigen 2 is fused to the N-terminus of the HC of a Fab fragment that binds antigen 1. The construct contains wild-type Fc. [Figure 18] 1 is a line graph showing the binding affinity of NKG2D binding domains (listed as clones) to human recombinant NKG2D in an ELISA assay. [Figure 19] 1 is a line graph showing the binding affinity of NKG2D binding domains (listed as clones) to cynomolgus monkey recombinant NKG2D in an ELISA assay. [Figure 20] 1 is a line graph showing the binding affinity of NKG2D binding domains (listed as clones) to mouse recombinant NKG2D in an ELISA assay. [Figure 21] 1 is a bar graph showing binding of NKG2D binding domains (listed as clones) to EL4 cells expressing human NKG2D by flow cytometry showing mean fluorescence intensity (MFI) fold over background (FOB). [Figure 22]1 is a bar graph showing binding of NKG2D binding domains (listed as clones) to EL4 cells expressing murine NKG2D by flow cytometry showing mean fluorescence intensity (MFI) fold over background (FOB). [Figure 23] 1 is a line graph showing the specific binding affinity of NKG2D binding domains (listed as clones) to recombinant human NKG2D-Fc by competing with the natural ligand ULBP-6. [Figure 24] 1 is a line graph showing the specific binding affinity of NKG2D binding domains (listed as clones) to recombinant human NKG2D-Fc by competing with the natural ligand MICA. [Figure 25] 1 is a line graph showing the specific binding affinity of NKG2D binding domains (listed as clones) to recombinant murine NKG2D-Fc by competing with the natural ligand Rae-1 delta. [Figure 26] 1 is a bar graph showing activation of human NKG2D by NKG2D binding domains (listed as clones) by quantifying the percentage of TNF-α positive cells expressing human NKG2D-CD3ζ fusion protein. [Figure 27] 1 is a bar graph showing activation of murine NKG2D by NKG2D binding domains (listed as clones) by quantifying the percentage of TNF-α positive cells expressing murine NKG2D-CD3ζ fusion protein. [Figure 28] 1 is a bar graph showing activation of human NK cells by NKG2D binding domains (listed as clones). [Figure 29] 1 is a bar graph showing activation of human NK cells by NKG2D binding domains (listed as clones). [Figure 30] 1 is a bar graph showing activation of mouse NK cells by NKG2D binding domains (listed as clones). [Figure 31] 1 is a bar graph showing activation of mouse NK cells by NKG2D binding domains (listed as clones). [Figure 32]1 is a bar graph showing the cytotoxic effect of NKG2D binding domains (listed as clones) on tumor cells. [Figure 33] 1 is a bar graph showing melting temperatures of NKG2D binding domains (listed as clones) measured by differential scanning fluorimetry. [Figure 34A] 1 is a bar graph of synergistic activation of NK cells using CD16 and NKG2D binding. [Figure 34B] 1 is a bar graph of synergistic activation of NK cells using CD16 and NKG2D binding. [Figure 34C] 34A and 34B are bar graphs of synergistic activation of NK cells using CD16 and NKG2D binding. Figure 34A shows the levels of CD107a, Figure 34B shows the levels of IFN-γ, and Figure 34C shows the levels of CD107a and IFN-γ. Graphs show the mean (n=2) ± SD. Data are representative of five independent experiments using five different healthy donors. [Figure 35A] 1 is a Biacore sensogram showing simultaneous binding of CEACAM5, NKG2D, and CD16 target proteins to CEACAM5 TriNKET. [Figure 35B] Figure 35B is a Biacore sensogram showing simultaneous binding of CEACAM5, NKG2D, and CD16 target proteins to CEACAM5 TriNKET. Figure 35B is an expanded view of Figure 35A, both demonstrating heterotetrameric complex formation. [Figure 36A] 1 is a line graph of a flow cytometry experiment demonstrating binding of CEACAM5 TriNKET to various human and cynomolgus CEACAM family member proteins. [Figure 36B] 1 is a line graph of a flow cytometry experiment demonstrating binding of CEACAM5 TriNKET to various human and cynomolgus CEACAM family member proteins. [Figure 36C] 1 is a line graph of a flow cytometry experiment demonstrating binding of CEACAM5 TriNKET to various human and cynomolgus CEACAM family member proteins. [Figure 36D] 1 is a line graph of a flow cytometry experiment demonstrating binding of CEACAM5 TriNKET to various human and cynomolgus CEACAM family member proteins. [Figure 36E] Figure 36 shows line graphs of flow cytometry experiments demonstrating the binding of CEACAM5 TriNKET to various human and cynomolgus monkey CEACAM family member proteins. Figure 36A demonstrates that AB0411 and AB0466 bound to human CEACAM1. Figure 36B demonstrates that AB0411 bound to human CEACAM6. Figure 36C demonstrates that CEACAM5 TriNKET did not bind to human CEACAM8. Figure 36D demonstrates that AB0264 and AB0621 bound to cynomolgus monkey CEACAM5, but AB0466 and AB0411 did not. Figure 36E demonstrates that CEACAM5 TriNKET did not bind to cells lacking expression of CEACAM protein. Data represent the average of duplicate wells, and error bars represent SD. [Figure 37A] 1 is a line graph from a DELFIA assay showing that CEACAM5 TriNKET promoted lysis of the target cancer line SK-CO-1. [Figure 37B] 1 is a line graph from a DELFIA assay showing that CEACAM5 TriNKET promoted lysis of the target cancer line LS-147T. [Figure 37C] 1 is a line graph from a DELFIA assay showing that CEACAM5 TriNKET promoted lysis of the target cancer line ZR-75-30. [Figure 37D] 1 is a line graph from a DELFIA assay showing that CEACAM5 TriNKET promoted lysis of the target cancer line HPAF-II. [Figure 38A] 1 is a line graph from a DELFIA assay showing that AB0264 promoted lysis of the target cancer line ZR-75-30 better than its corresponding mAb, AB0755. [Figure 38B]38A-38C are line graphs from a DELFIA assay showing that AB0264 promoted lysis of the target cancer line ZR-75-30 better than its corresponding mAb, AB0755. IL-2-activated NK cells (FIG. 38B) showed more potent killing of ZR-75-30 cancer cells compared to resting NK cells (FIG. 38A). Data points represent the mean ± SD. [Figure 39A] 1 is a line graph from a DELFIA assay showing that AB0264 promoted lysis of the target cancer line MKN-45 better than its corresponding mAb. [Figure 39B] 1 is a line graph from a DELFIA assay showing that AB0264 promoted lysis of the target cancer line SK-CO-1 better than its corresponding mAb. [Figure 39C] 1 is a line graph from a DELFIA assay showing that AB0264 promoted lysis of the target cancer line LS-147T better than its corresponding mAb. [Figure 39D] 1 is a line graph from a DELFIA assay showing that AB0264 promoted lysis of the target cancer line ZR-75-30 better than its corresponding mAb. [Figure 39E]

[0023] Figure 1 is a line graph from a DELFIA assay showing that AB0264 promoted lysis of the target cancer line HPAF-II better than its corresponding mAb. Data points represent the mean ± SD. [Figure 40A] 1 is a line graph from a DELFIA assay showing that AB0411 promoted lysis of the target cancer line MKN-45 better than its corresponding mAb. [Figure 40B] 1 is a line graph from a DELFIA assay showing that AB0411 promoted lysis of the target cancer line SK-CO-1 better than its corresponding mAb. [Figure 40C] 1 is a line graph from a DELFIA assay showing that AB0411 promoted lysis of the target cancer line LS-147T better than its corresponding mAb. [Figure 40D]1 is a line graph from a DELFIA assay showing that AB0411 promoted lysis of the target cancer line ZR-75-30 better than its corresponding mAb. [Figure 40E] 1 is a line graph from a DELFIA assay showing that AB0411 promoted lysis of the target cancer line HPAF-II better than its corresponding mAb. Data points represent the mean±SD. [Figure 41] 1 is a line graph from a DELFIA assay showing that NK-mediated killing of target cells is dependent on TriNKET binding to CD16, NKG2D, and CEACAM5. Data points represent the mean±SD. [Figure 42A] 1 is a line graph from an IFNγ and CD107a activation assay. [Figure 42B] 1 is a line graph from an IFNγ and CD107a activation assay. [Figure 42C] 1 is a line graph from an IFNγ and CD107a activation assay. [Figure 42D] Figure 42A shows line graphs from IFNγ and CD107a activation assays. Figure 42A demonstrates the induction of IFNγ secretion by primary NK cells after co-engagement with CEACAM5 TriNKET and SK-CO-1 target cells, and Figure 42B demonstrates the induction of IFNγ production and CD107a degranulation by primary NK cells after co-engagement with CEACAM5 TriNKET and MKN-45 target cells. TriNKET enhanced the degranulation of CD8+ NK cells in cynomolgus monkey PBMCs after co-engagement with CEACAM5 TriNKET and MKN-45 (Figure 42C) or SK-CO-1 (Figure 42D) cells. Data are representative of the results of experiments using PBMCs from three animals. Data represent the mean ± SD. [Figure 43A] Graph of flow cytometry experiment demonstrating expression of CEACAM5 protein on cancer cell line SK-CO-1 and patient-derived primary non-small cell lung cancer tumor organoid lines 10910 and 3222. [Figure 43B]FIG. 10 demonstrates by DELFIA assay that CEACAM5 TriNKET promotes lysis of patient-derived primary non-small lung cancer tumor organoid line 3222. [Figure 43C] FIG. 10 demonstrates by DELFIA assay that CEACAM5 TriNKET promotes lysis of patient-derived primary non-small lung cancer tumor organoid line 10910. [Figure 44A] FIG. 1 is a schematic diagram illustrating a method for producing activated CD8+ T cells. [Figure 44B] 1 is a line graph from a DELFIA assay showing that the enhancement of pre-activated CD8+ T cell-mediated lysis of target cells is dependent on TriNKET binding to NKG2D and CEACAM5. Maximum lysis values ​​represent the mean ± SD of three donors. [Figure 45] 1 is a Kaplan-Meier curve showing the percentage of hCEACAM5 transgenic mice that survived subcutaneous B16F10-hCEACAM5 tumors over time in each mouse IgG2a surrogate for the AB0621 (mAB0621) treatment group. [Figure 46A] Individual curves of tumor volume in B16F10-hCEACAM5 tumor-bearing mice in the hCEACAM5 transgenic model after administration of 15 mg / kg isotype control up to day 26. [Figure 46B] 10 shows individual curves of tumor volume in B16F10-hCEACAM5 tumor-bearing mice in the hCEACAM5 transgenic model after administration of 15 mg / kg mAB0621 up to day 26. [Figure 46C] Individual curves of tumor volume in B16F10-hCEACAM5 tumor-bearing mice in the hCEACAM5 transgenic model after administration of 5 mg / kg mAB0621 up to day 26. [Figure 46D] Individual curves of tumor volume in B16F10-hCEACAM5 tumor-bearing mice in the hCEACAM5 transgenic model after administration of 1.5 mg / kg mAB0621 up to day 26. [Figure 46E]10 shows individual curves of tumor volume in B16F10-hCEACAM5 tumor-bearing mice in the hCEACAM5 transgenic model after administration of 0.5 mg / kg mAB0621 up to day 26. [Figure 47] 10 is a Kaplan-Meier curve showing the proportion of animals surviving over time in each group treated singly or dually with mAB0621 and / or anti-PD1 antibody. [Figure 48A] Individual B16F10-hCEACAM5 tumor volumes measured for each animal in the isotype control treatment group. [Figure 48B] Individual B16F10-hCEACAM5 tumor volumes measured for each animal in the anti-PD1 treatment group. [Figure 48C] Individual B16F10-hCEACAM5 tumor volumes measured for each animal in the mAB0621 treatment group. [Figure 48D] Individual B16F10-hCEACAM5 tumor volumes measured for each animal in the mAB0621+anti-PD-1 treatment group. [Figure 49A] 1 is a line graph showing the mean serum concentrations over time for free and total AB0264 in cynomolgus monkeys. [Figure 49B] 1 is a line graph showing the mean serum concentrations over time for free and total AB0411 in cynomolgus monkeys. [Figure 50A] 50A is a line graph showing the mean serum concentrations over time for free and total AB0621 in B6.Cg-Tg(hCEACAM5)2682Wzm / Ieg transgenic mice (FIG. 50A). [Figure 50B] 1 is a line graph showing the mean serum concentrations over time for free and total AB0411 in B6.Cg-Tg(hCEACAM5)2682Wzm / Ieg transgenic mice. [Figure 50C] 1 is a line graph showing the mean serum concentrations over time for free and total AB0466 in B6.Cg-Tg(hCEACAM5)2682Wzm / Ieg transgenic mice. DETAILED DESCRIPTION OF THE INVENTION

[0077] The present invention provides multispecific binding proteins that bind to the NKG2D receptor and CD16 on natural killer cells, and the tumor-associated antigen CEACAM5. In some embodiments, the multispecific proteins further comprise an additional antigen-binding site that binds to CEACAM5. The present invention also provides pharmaceutical compositions comprising such multispecific binding proteins, as well as therapeutic methods using such multispecific proteins and pharmaceutical compositions, such as for treating autoimmune diseases and cancer. Various aspects of the invention are described in the following sections. However, aspects of the invention described in one particular section are not limited to any particular section.

[0078] To facilitate the understanding of this invention, a number of terms and phrases are defined below.

[0079] As used herein, the terms "a" and "an" mean "one or more" and include plurals unless the context is inappropriate.

[0080] As used herein, the term "plurality" means two or more.

[0081] As used herein, the term "antigen-binding site" refers to the portion of an immunoglobulin molecule involved in antigen binding. In human antibodies, the antigen-binding site is formed by amino acid residues from the N-terminal variable ("V") regions of the heavy ("H") and light ("L") chains. Three highly divergent stretches within the V regions of the heavy and light chains are called "hypervariable regions," which are interposed between more conserved adjacent stretches known as "framework regions" or "FRs." Thus, the term "FR" refers to the amino acid sequences naturally found adjacent to the hypervariable regions of immunoglobulins. In human antibody molecules, the three hypervariable regions of the light chain and the three hypervariable regions of the heavy chain are arranged relative to each other in three-dimensional space to form an antigen-binding surface. The antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are called "complementarity-determining regions" or "CDRs." In certain animals, such as camels and cartilaginous fish, the antigen-binding site is formed by a single antibody chain, providing a "single-domain antibody." The antigen-binding site may be present in an intact antibody, in an antigen-binding fragment of an antibody which retains the antigen-binding surface, or in a recombinant polypeptide such as an scFv in which a peptide linker is used to link the heavy chain variable domain to the light chain variable domain in a single polypeptide.

[0082] As used herein, the term "Fc domain" or "Fc region" refers to the C-terminal region of an immunoglobulin heavy chain derived from the second and third constant domains. This term includes native-sequence Fc regions and variant Fc regions. In some embodiments, a variant Fc region comprises an amino acid sequence at least 90% identical (i.e., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) to a human native-sequence Fc region, e.g., a human IgG1, IgG2, IgG3, or IgG4 Fc region. Although the boundaries of the Fc region of an IgG heavy chain can vary slightly, the human IgG heavy chain Fc region is usually defined to stretch from Cys226 or Pro230 to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, the numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also known as the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991. As used herein, an Fc domain refers to two polypeptide chains that together form a dimeric Fc domain, i.e., each polypeptide comprises the C-terminal constant region of an immunoglobulin heavy chain and is capable of self-association. In a specific embodiment, a subunit of an IgG Fc domain comprises an IgG CH2 and an IgG CH3 constant domain.

[0083] As used herein, the term "tumor-associated antigen" refers to any antigen, including but not limited to, a protein, glycoprotein, ganglioside, carbohydrate, or lipid associated with cancer. Such antigens may be expressed on malignant cells or in the tumor microenvironment, such as tumor-associated blood vessels, extracellular matrix, mesenchymal stroma, or immune infiltrate.

[0084] As used herein, the terms "subject" and "patient" refer to an organism treated by the methods and compositions described herein. Such organisms preferably include, but are not limited to, mammals (e.g., murines, simians, equines, bovines, porcines, canines, felines, etc.), and more preferably include, but are not limited to, humans.

[0085] As used herein, the term "effective amount" refers to an amount of a compound (e.g., a protein, binding protein, antibody, or antigen-binding fragment of the invention) sufficient to produce a beneficial or desired result. An effective amount can be administered in one or more administrations, applications, or dosages, and is not intended to be limited to a particular formulation or route of administration. As used herein, the term "treating" includes any effect, e.g., alleviating, reducing, modulating, ameliorating, or eliminating, that results in an improvement in a condition, disease, disorder, etc., or an improvement in the symptoms thereof.

[0086] As used herein, the term "pharmaceutical composition" refers to a combination of an active agent with an inert or active pharmaceutically acceptable carrier, making the composition particularly suitable for in vivo or ex vivo diagnostic or therapeutic use.

[0087] As used herein, the term "pharmaceutically acceptable carrier" refers to any of the standard pharmaceutical carriers, such as phosphate buffered saline, water, emulsions (e.g., oil / water or water / oil emulsions), and various types of wetting agents. The composition may also contain stabilizers and preservatives. For examples of carriers, stabilizers, and adjuvants, see, for example, Martin, Remington's Pharmaceutical Sciences, 15th Ed., Mack Publ. Co., Easton, PA

[1975] .

[0088] As used herein, the term "pharmaceutically acceptable salt" refers to any pharmaceutically acceptable salt (e.g., acid or base) of a compound of the present invention that, upon administration to a subject, can provide a compound of the present invention or an active metabolite or residue thereof. As known to those skilled in the art, "salts" of compounds of the present invention can be derived from inorganic or organic acids and bases. Exemplary acids include, but are not limited to, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, perchloric acid, fumaric acid, maleic acid, phosphoric acid, glycolic acid, lactic acid, salicylic acid, succinic acid, toluene-p-sulfonic acid, tartaric acid, acetic acid, citric acid, methanesulfonic acid, ethanesulfonic acid, formic acid, benzoic acid, malonic acid, naphthalene-2-sulfonic acid, benzenesulfonic acid, and the like. Other acids, such as oxalic acid, while not themselves pharmaceutically acceptable, can be used in the preparation of salts useful as intermediates in obtaining compounds of the present invention and their pharmaceutically acceptable acid addition salts.

[0089] Exemplary bases include alkali metal (e.g., sodium) hydroxides, alkaline earth metal (e.g., magnesium) hydroxides, ammonia, and bases where W is C 1~4 Alkyl group of formula NW4 + Compounds of the formula (I) and the like are included, but are not limited to these.

[0090] Exemplary salts include, but are not limited to, acetate, adipate, alginate, aspartate, benzoate, benzenesulfonate, bisulfate, butyrate, citrate, camphorate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, fumarate, flucoheptanoate, glycerophosphate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, 2-hydroxyethanesulfonate, lactate, maleate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, oxalate, palmoate, pectinate, persulfate, phenylpropionate, picrate, pivalate, propionate, succinate, tartrate, thiocyanate, tosylate, undecanoate, and the like. + , NH4+ , and NW4 + (Wherein, W is C 1~4 Examples of suitable cations include the anions of the compounds of the present invention combined with suitable cations such as alkyl groups.

[0091] For therapeutic use, the salts of compounds of the invention are considered to be pharmaceutically acceptable. However, salts of acids and bases that are non-pharmaceutically acceptable may also find use, for example, in the preparation or purification of a pharmaceutically acceptable compound.

[0092] As used herein, "CEACAM5" (carcinoembryonic antigen-related cell adhesion molecule 5, also known as meconium antigen 100, CEA, carcinoembryonic antigen, CD66e or CD66e antigen) refers to the protein with Uniprot accession number P06731 and related isoforms.

[0093] Throughout this specification, when compositions are described as having, including, or comprising particular components, or when processes and methods are described as having, including, or comprising particular steps, it is further intended that there are compositions of the invention that consist essentially of, or consist of, the recited components, and there are processes and methods of the invention that consist essentially of, or consist of, the recited processing steps.

[0094] As a general matter, compositions specifying percentages are by weight unless otherwise specified. Furthermore, if a variable is not accompanied by a definition, the previous definition of the variable takes precedence.

[0095] I. Protein The present invention provides multispecific binding proteins that bind to the NKG2D receptor and CD16 on natural killer cells, as well as the tumor-associated antigen CEACAM5. The multispecific binding proteins are useful in the pharmaceutical compositions and treatment methods described herein. Binding of the multispecific binding proteins to the NKG2D receptor and CD16 on natural killer cells enhances the activity of natural killer cells in destroying tumor cells that express CEACAM5. Binding of the multispecific binding proteins to CEACAM5-expressing tumor cells brings these cells into close proximity with natural killer cells, facilitating the direct and indirect destruction of tumor cells by natural killer cells. Multispecific binding proteins that bind to NKG2D, CD16, and other targets are disclosed in International Publication Nos. 2018148445 and 2019157366, which are not incorporated by reference herein. Further description of some exemplary multispecific binding proteins is provided below.

[0096] The first component of the multispecific binding protein is an antigen-binding site that binds to NKG2D receptor-expressing cells, including NK cells, γδ T cells, and CD8 + These may include, but are not limited to, αβ T cells. Upon binding to NKG2D, the multispecific binding protein may block natural ligands such as ULBP6 and MICA from binding to NKG2D and activating NK cells.

[0097] The second component of the multispecific binding protein is an antigen-binding site that binds to CEACAM5. CEACAM5-expressing cells can be found in, for example, gastrointestinal cancer, colorectal cancer, pancreatic cancer, non-small cell lung cancer, and esophageal cancer.

[0098] The third component of the multispecific binding protein is an antibody Fc domain or portion thereof or antigen-binding site that binds to cells expressing CD16, such as Fc receptors on the surface of leukocytes, including natural killer cells, macrophages, neutrophils, eosinophils, mast cells, and follicular dendritic cells.

[0099] The additional antigen-binding sites of the multispecific binding protein may bind to CEACAM5. In certain embodiments, the first antigen-binding site that binds to NKG2D is an scFv, and the second and additional antigen-binding sites each bind to CEACAM5 that is a Fab fragment. In certain embodiments, the first antigen-binding site that binds to NKG2D is an scFv, and the second and additional antigen-binding sites each bind to CEACAM5 that is an scFv. In certain embodiments, the first antigen-binding site that binds to NKG2D is a Fab fragment, and the second and additional antigen-binding sites each bind to CEACAM5 that is an scFv. In certain embodiments, the first antigen-binding site that binds to NKG2D is a Fab, and the second and additional antigen-binding sites each bind to CEACAM5 that is a Fab fragment.

[0100] The antigen-binding sites may each incorporate an antibody heavy chain variable domain and an antibody light chain variable domain (e.g. arranged like an antibody or fused together to form an scFv), or one or more of the antigen-binding sites may be a single domain antibody, e.g. a V such as a camelid antibody. H H antibodies or V antibodies as seen in cartilaginous fish NAR It may be an antibody.

[0101] The multispecific binding proteins described herein can take a variety of formats. For example, one format is a heterodimeric multispecific antibody comprising a first immunoglobulin heavy chain, a first immunoglobulin light chain, a second immunoglobulin heavy chain, and a second immunoglobulin light chain (FIG. 1). The first immunoglobulin heavy chain comprises a first Fc (hinge-CH2-CH3) domain, a first heavy chain variable domain, and optionally a first CH1 heavy chain domain. The first immunoglobulin light chain comprises a first light chain variable domain and optionally a first light chain antibody Fc domain. The first immunoglobulin light chain, together with the first immunoglobulin heavy chain, forms an antigen-binding site that binds to NKG2D. The second immunoglobulin heavy chain comprises a second Fc (hinge-CH2-CH3) domain, a second heavy chain variable domain, and optionally a second CH1 heavy chain domain. The second immunoglobulin light chain comprises a second light chain variable domain and, optionally, a second light chain constant domain. The second immunoglobulin light chain, together with the second immunoglobulin heavy chain, forms an antigen-binding site that binds to CEACAM5. Both the first Fc domain and the second Fc domain can bind to CD16 (Figure 1).

[0102] Another exemplary format includes a heterodimeric multispecific antibody comprising a first immunoglobulin heavy chain, a second immunoglobulin heavy chain, and an immunoglobulin light chain (FIG. 2A). The first immunoglobulin heavy chain comprises a first Fc (hinge-CH2-CH3) domain fused via either a linker or an antibody hinge to an scFv comprised of a heavy chain variable domain and a light chain variable domain that pairs with and binds to NKG2D or binds to CEACAM5. The second immunoglobulin heavy chain comprises a second Fc (hinge-CH2-CH3) domain, a second heavy chain variable domain, and a CH1 heavy chain domain. The immunoglobulin light chain comprises a light chain variable domain and a light chain constant domain. The second immunoglobulin heavy chain pairs with the immunoglobulin light chain and binds to NKG2D or binds to CEACAM5. Both the first Fc domain and the second Fc domain can bind to CD16 (FIG. 2A).

[0103] Another exemplary format includes a heterodimeric multispecific antibody comprising a first immunoglobulin heavy chain and a second immunoglobulin heavy chain (FIG. 2B). The first immunoglobulin heavy chain comprises a first Fc (hinge-CH2-CH3) domain fused via either a linker or an antibody hinge to an scFv comprised of a heavy chain variable domain and a light chain variable domain that pairs with and binds to NKG2D or binds to CEACAM5. The second immunoglobulin heavy chain comprises a second Fc (hinge-CH2-CH3) domain fused via either a linker or an antibody hinge to an scFv comprised of a heavy chain variable domain and a light chain variable domain that pairs with and binds to NKG2D or binds to CEACAM5. Both the first Fc domain and the second Fc domain are capable of binding to CD16 (FIG. 2B).

[0104] In some embodiments, the scFvs described above are linked to antibody constant domains via a hinge sequence. In some embodiments, the hinge comprises the amino acids Ala-Ser or Gly-Ser. In some embodiments, the hinge connects scFvs that bind to NKG2D, and the antibody heavy chain constant domain comprises the amino acids Ala-Ser. In some embodiments, the hinge connects scFvs that bind to CEACAM5, and the antibody heavy chain constant domain comprises the amino acids Gly-Ser. In some other embodiments, the hinge comprises the amino acids Ala-Ser and Thr-Lys-Gly. The hinge sequence provides flexibility in binding to the target antigen and can balance flexibility with optimal geometry.

[0105] In some embodiments, the scFv described above comprises a heavy chain variable domain and a light chain variable domain. In some embodiments, the heavy chain variable domain forms a disulfide bridge with the light chain variable domain to increase the stability of the scFv. For example, a disulfide bridge can be formed between the C44 residue of the heavy chain variable domain and the C100 residue of the light chain variable domain, where the amino acid positions are numbered according to Kabat. In some embodiments, the heavy chain variable domain is linked to the light chain variable domain via a flexible linker. Any suitable linker can be used, for example, a (G4S)4 linker (SEQ ID NO: 532). In some scFv embodiments, the heavy chain variable domain is located at the N-terminus of the light chain variable domain. In some scFv embodiments, the heavy chain variable domain is located at the C-terminus of the light chain variable domain.

[0106] The multispecific binding proteins described herein can further comprise one or more additional antigen-binding sites. The additional antigen-binding site(s) can be fused, optionally via a linker sequence, to the N-terminus of the constant region CH2 domain or the C-terminus of the constant region CH3 domain. In certain embodiments, the additional antigen-binding site(s) optionally take the form of a disulfide-stabilized single-chain variable region (scFv), resulting in a tetravalent or trivalent multispecific binding protein. For example, the multispecific binding protein comprises a first antigen-binding site that binds NKG2D, a second antigen-binding site that binds CEACAM5, an additional antigen-binding site that binds CEACAM5, and a sufficient antibody constant region or portion thereof to bind CD16, or a fourth antigen-binding site that binds CD16. Any one of these antigen-binding sites can take the form of a Fab fragment or an scFv, such as any of the scFvs described above.

[0107] In some embodiments, the additional antigen-binding site binds to a different epitope of CEACAM5 than the second antigen-binding site. In some embodiments, the additional antigen-binding site binds to the same epitope as the second antigen-binding site. In some embodiments, the additional antigen-binding site comprises the same heavy and light chain CDR sequences as the second antigen-binding site. In some embodiments, the additional antigen-binding site comprises the same heavy and light chain variable domain sequences as the second antigen-binding site. In some embodiments, the additional antigen-binding site has the same amino acid sequence(s) as the second antigen-binding site. Exemplary formats are shown in Figures 2C and 2D. Thus, multispecific binding proteins can provide bivalent engagement of CEACAM5. Bivalent engagement of CEACAM5 by multispecific proteins can stabilize CEACAM5 on the surface of tumor cells and enhance NK cell cytotoxicity against tumor cells. Bivalent engagement of CEACAM5 by multispecific proteins may confer stronger binding of the multispecific proteins to tumor cells, thereby promoting a stronger cytotoxic response of NK cells against tumor cells, particularly those expressing low levels of CEACAM5.

[0108] Multispecific binding proteins can take additional formats. In some embodiments, the multispecific binding protein is in the form of a Triomab, a trifunctional, bispecific antibody that maintains an IgG-like shape. This chimera consists of two half antibodies, each with one light chain and one heavy chain, derived from two corresponding antibodies.

[0109] In some embodiments, the multispecific binding protein is in the form of a KiH, which includes knobs-into-holes (kiH) technology. KiH is engineered to create either a "knob" or a "hole" on each heavy chain to promote heterodimerization. H The concept behind the "knobs-into-holes (KiH)" Fc technology involves engineering three domains to replace small residues with bulky residues (e.g., T366W in the EU numbering system). CH3AThe first step was to introduce a "knob" into one CH3 domain (CH3A) by replacing the adjacent residues closest to the knob with smaller residues (e.g., T366S / L368A / Y407V) to accommodate the "knob." CH3B A complementary "hole" surface was created on the other CH3 domain (CH3B) by replacing the nucleotide sequence with a nucleotide sequence. The "hole" mutation was optimized by structure-guided phage library screening (Atwell S, Ridgway JB, Wells JA, Carter P., Stable heterodimers from remodeling the domain interface of a homodimer using a phage display library, J. Mol. Biol. (1997) 270(1):26-35). The X-ray crystal structure of the KiHFc variant is (Elliott JM, Ultsch M, Lee J, Tong R, Takeda K, Spiess C, et al., Antiparallel conformation of knob and hole aglycosylated half-antibody homodimers is mediated by a CH2-CH3 hydrophobic interaction. J. Mol. Biol. (2014) 426(9):1947-57; Mimoto F, Kadono S, Katada H, Igawa T, Kamikawa T, Hattori K. Crystal structure of a novel asymmetrically engineered Fc variant with improved affinity for FcγRs. Mol. Immunol. (2014) 58(1):132-8), demonstrated that heterodimerization is thermodynamically favored by hydrophobic interactions driven by steric complementarity at the CH3-domain core interface, whereas the knob-knob and hole-hole interfaces disfavor homodimerization due to steric hindrance and disruption of favorable interactions, respectively.

[0110] In some embodiments, the multispecific binding protein is in the form of a dual variable domain immunoglobulin (DVD-Ig™) that combines the target binding domains of two monoclonal antibodies via a flexible, naturally occurring linker to generate a tetravalent IgG-like molecule.

[0111] In some embodiments, the multispecific binding protein is in the form of an orthogonal Fab interface (Ortho-Fab). In the Ortho-Fab IgG approach (Lewis SM, Wu X, Pustilnik A, Sereno A, Huang F, Rick HL, et al., Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface. Nat. Biotechnol. (2014) 32(2):191-8), structure-based domain design is used to create an LC and HC domain in only one Fab fragment. VH-CH1 Complementary mutations are introduced at the interface, while the other Fab fragment remains unchanged.

[0112] In some embodiments, the multispecific binding protein is a 2-in-1 Ig format. In some embodiments, the multispecific binding protein is an ES format, which is a heterodimeric construct comprising two different Fab fragments that bind target 1 and target 2 fused to an Fc. Heterodimerization is ensured by electrostatic steering mutations in the Fc.

[0113] In some embodiments, the multispecific binding protein is in the form of a κλ-body, which is a heterodimeric construct with two different Fab fragments fused to an Fc stabilized by heterodimerization mutations, where antigen 1-targeting Fab fragment 1 contains a kappa LC and antigen 2-targeting Fab fragment 2 contains a lambda LC. Figure 13A is an exemplary representation of one form of a κλ-body, and Figure 13B is an exemplary representation of another κλ-body.

[0114] In some embodiments, the multispecific binding protein is a Fab arm exchanged form (an antibody that exchanges a heavy chain and a binding light chain (half molecule) with a heavy chain-light chain pair from another molecule, thereby exchanging Fab fragment arms, resulting in a bispecific antibody).

[0115] In some embodiments, the multispecific binding protein is in the form of a SEED body. The strand-exchange engineered domain (SEED) platform has been designed to generate asymmetric and bispecific antibody-like molecules, a capability that expands the therapeutic applications of natural antibodies. This protein engineering platform is based on exchanging structurally related sequences of immunoglobulins within the conserved CH3 domain. The SEED design disfavors homodimerization of the AG and GA SEED CH3 domains, but allows for the efficient generation of AG / GA heterodimers (Muda M. et al., Protein Eng. Des. Sel. (2011, 24(5):447-54)).

[0116] In some embodiments, the multispecific binding protein is a LuZ-Y form that uses a leucine zipper to induce heterodimerization of two different HCs (Wranik, BJ. et al., J. Biol. Chem. (2012), 287:43331-9).

[0117] In some embodiments, the multispecific binding protein is in the form of a Cov-X-body. In bispecific CovX-bodies, two different peptides are linked together using a branched azetidinone linker and site-specifically fused to an antibody scaffold under mild conditions. The pharmacophore is responsible for functional activity, while the antibody scaffold confers long half-life and Ig-like distribution. The pharmacophore can be chemically optimized or replaced with another pharmacophore to generate optimized or unique bispecific antibodies. (Doppalapudi VR et al., PNAS (2010), 107(52); 22611-22616).

[0118] In some embodiments, the multispecific binding protein is an Oasc-Fab heterodimer comprising a Fab fragment that binds to target 1 and an scFab that binds to target 2 fused to an Fc. Heterodimerization is ensured by mutations in the Fc.

[0119] In some embodiments, the multispecific binding protein is in the form of a DuetMab, which is a heterodimeric construct comprising two different Fab fragments that bind antigens 1 and 2 and an Fc stabilized by heterodimerization mutations. Fab fragments 1 and 2 contain differential S-S bridges that ensure correct LC and HC pairing.

[0120] In some embodiments, the multispecific binding protein is in the form of a CrossmAb, a heterodimeric construct with two different Fab fragments that bind to targets 1 and 2 fused to an Fc stabilized by heterodimerization. The CL, and CH1 domains and the VH and VL domains are switched, e.g., CH1 is fused in frame with VL and CL is fused in frame with VH.

[0121] In some embodiments, the multispecific binding protein is in the Fit-Ig format, which is a homodimeric construct in which a Fab fragment that binds antigen 2 is fused to the N-terminus of the HC of a Fab fragment that binds antigen 1. The construct contains a wild-type Fc.

[0122] The individual components of the multispecific binding proteins are described in more detail below.

[0123] NKG2D binding site Upon binding to the NKG2D receptor and CD16 on natural killer cells and tumor-associated antigens on cancer cells, the multispecific binding protein can engage more than one NK-activating receptor and block the binding of natural ligands to NKG2D. In certain embodiments, the protein can agonize human NK cells. In some embodiments, the protein can agonize NK cells of humans and other species, such as rodents and cynomolgus monkeys. In some embodiments, the protein can agonize NK cells of humans and other species, such as cynomolgus monkeys.

[0124] Table 1 lists peptide sequences of heavy and light chain variable domains that can combine to bind to NKG2D. In some embodiments, the heavy and light chain variable domains are arranged in a Fab format. In some embodiments, the heavy and light chain variable domains are fused together to form an scFv.

[0125] The NKG2D binding sites listed in Table 1 may differ in their binding affinity for NKG2D, but nevertheless, they all activate human NK cells.

[0126] Unless otherwise indicated, the CDR sequences provided in Table 1 are determined by Kabat numbering.

[0127] [Table 1] TIFF2025527967000003.tif234153TIFF2025527967000004.tif233154TIFF2025527967000005.tif232154TIFF20255279670 00006.tif235153TIFF2025527967000007.tif233155TIFF2025527967000008.tif232154TIFF2025527967000009.tif137154

[0128] In certain embodiments, the first antigen-binding site that binds to NKG2D (e.g., human NKG2D) comprises an antibody heavy chain variable domain (VH) comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of an antibody disclosed in Table 1, and an antibody light chain variable domain (VL) comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL of the same antibody disclosed in Table 1. In certain embodiments, the first antigen-binding site comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 of the VH and VL sequences of the antibodies disclosed in Table 1, as determined by Kabat (see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NIH Publication No. 91-3242, Bethesda), Chothia (see, e.g., Chothia C & Lesk AM, (1987), J. Mol. Biol. 196:901-917), MacCallum (see MacCallum RM et al., (1996) J. Mol. Biol. 262:732-745), or any other CDR determination method known in the art. In certain embodiments, the first antigen-binding site comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3 of an antibody disclosed in Table 1.

[0129] In certain embodiments, a first antigen-binding site that binds to NKG2D comprises a heavy chain variable domain related to SEQ ID NO: 392, e.g., by having an amino acid sequence at least 90% (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 392 and / or by incorporating amino acid sequences identical to the CDR1 (SEQ ID NO: 394), CDR2 (SEQ ID NO: 395), and CDR3 (SEQ ID NO: 396) sequences of SEQ ID NO: 392. A heavy chain variable domain having at least 90% sequence identity to SEQ ID NO: 392 can be combined with a different light chain variable domain to form an NKG2D-binding site. For example, a first antigen binding site incorporating a heavy chain variable domain having at least 90% sequence identity to SEQ ID NO: 392 may further incorporate a light chain variable domain having at least 90% sequence identity to any one of the sequences selected from the group consisting of SEQ ID NOs: 393, 398, 400, 402, 404, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, and 434. For example, the first antigen-binding site may comprise a heavy chain variable domain having an amino acid sequence at least 90% (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 392, and a heavy chain variable domain having an amino acid sequence at least 90% (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 393, 398, 400, 402, 404, 408, 410, 412, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466 and a light chain variable domain having an amino acid sequence at least 90% (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to any one of the sequences selected from the group consisting of: 418, 420, 422, 424, 426, 428, 430, 432, and 434.

[0130] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 435, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 436. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 437 or 438, 439, and 442 or 443, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 440, 441, and 444, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 437 or 438, 439, and 442 or 443, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 440, 441, and 444, respectively.

[0131] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 445, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 454. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 446 or 447, 448, and 449 or 450, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 451, 452, and 453, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 446 or 447, 448, and 449 or 450, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 451, 452, and 453, respectively.

[0132] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 455, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 456.

[0133] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 457, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 458. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 437, 459, and 460, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 461, 441, and 462, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 437, 459, and 460, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 461, 441, and 462, respectively.

[0134] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 463, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 464. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 465 or 466, 467, and 468 or 469, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 470, 63, and 472, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 465 or 466, 467, and 468 or 469, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 470, 63, and 472, respectively.

[0135] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 473, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 474. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 475 or 476, 477, and 478 or 479, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 480, 63, and 481, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 475 or 476, 477, and 478 or 479, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 480, 63, and 481, respectively.

[0136] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 501, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 502. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 465 or 466, 503, and 504 or 505, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 506, 452, and 507, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 465 or 466, 503, and 504 or 505, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 506, 452, and 507, respectively.

[0137] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 482, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 483. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 484 or 3, 486, and 487 or 488, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 489, 490, and 491, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 484 or 3, 486, and 487 or 488, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 489, 490, and 491, respectively.

[0138] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 492, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 493. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 497 or 498, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 497 or 498, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively.

[0139] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 508, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 493. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 509 or 510, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 509 or 510, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively.

[0140] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 511, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 493. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 512 or 513, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 512 or 513, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively.

[0141] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 514, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 493. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 515 or 516, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 515 or 516, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively.

[0142] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 517, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 493. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 518 or 519, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 518 or 519, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively.

[0143] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 520, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 493. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 521 or 522, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 521 or 522, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively.

[0144] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 523, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 493. In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 524 or 525, respectively. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively. In certain embodiments, the first antigen-binding site comprises (a) a VH comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 494 or 495, 496, and 524 or 525, respectively, and (b) a VL comprising CDR1, CDR2, and CDR3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively.

[0145] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 526, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 527.

[0146] In certain embodiments, the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 528, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 529.

[0147] The multispecific binding protein binds to NK cells, γδ T cells, and CD8 + The multispecific binding proteins can bind to NKG2D-expressing cells, including, but not limited to, αβ T cells. Upon binding to NKG2D, the multispecific binding proteins can block natural ligands such as ULBP6 and MICA from binding to NKG2D and activating NK cells.

[0148] The multispecific binding protein binds to cells that express CD16, an Fc receptor on the surface of leukocytes, including natural killer cells, macrophages, neutrophils, eosinophils, mast cells, and follicular dendritic cells. The proteins of the present disclosure have a concentration of 2 nM to 120 nM, for example, 2 nM to 110 nM, 2 nM to 100 nM, 2 nM to 90 nM, 2 nM to 80 nM, 2 nM to 70 nM, 2 nM to 60 nM, 2 nM to 50 nM, 2 nM to 40 nM, 2 nM to 30 nM, 2 nM to 20 nM, 2 nM to 10 nM, about 15 nM, about 14 nM, about 13 nM, about 12 nM, about 11 nM, about 10 nM, about 9 nM, about 8 nM, about 7 nM, about 6 nM, about 5 nM, about 4.5 nM, about 4 nM, about 3.5 nM, about 3 nM, about 2 ... .5nM, about 2nM, about 1.5nM, about 1nM, about 0.5nM to about 1nM, about 1nM to about 2nM, about 2nM to about 3nM, about 3nM to 4nM, about 4nM to about 5nM, about 5nM to about 6nM, about 6nM to about 7nM, about 7nM to about 8nM, about 8nM K of about 9nM, about 9nM to about 10nM, about 1nM to about 10nM, about 2nM to about 10nM, about 3nM to about 10nM, about 4nM to about 10nM, about 5nM to about 10nM, about 6nM to about 10nM, about 7nM to about 10nM, or about 8nM to about 10nM D In some embodiments, the NKG2D binding site binds to NKG2D with an affinity of 10-62 nM. D binds to NKG2D.

[0149] CEACAM5 binding site The CEACAM5-binding site of the multispecific binding protein disclosed herein comprises a heavy chain variable domain and a light chain variable domain. Table 2 lists some exemplary sequences of heavy chain variable domains and light chain variable domains that can bind to CEACAM5 in combination. CDR sequences are identified by Chothia and Kabat numbering as indicated. Cysteine ​​mutations for disulfide bond formation are underlined. The scFv sequence contains a (G4S)4 linker (SEQ ID NO: 532) (italics) between the VH and VL.

[0150] [Table 2] TIFF2025527967000011.tif237155TIFF2025527967000012.tif236156TIFF2025527967000013.t if230154TIFF2025527967000014.tif236155TIFF2025527967000015.tif233155TIFF20255279670 00016.tif233156TIFF2025527967000017.tif236155TIFF2025527967000018.tif236156TIFF202 5527967000019.tif236156TIFF2025527967000020.tif234156TIFF2025527967000021.tif194155

[0151] Alternatively, novel antigen-binding sites capable of binding to CEACAM5 can be identified by screening for binding to the amino acid sequence represented by SEQ ID NO: 391, its mature extracellular fragment, or a fragment containing a domain of CEACAM5 (see, for example, U.S. Patent Nos. 9,771,431, 9,617,345, and 8,470,994, as well as U.S. Patent Application Nos. 15 / 683,087 and 14 / 515,765).

[0152] Exemplary sequences of human CEACAM5 isoforms are provided below and can be obtained from the GenBank database under accession number NP_004354.

[0153] (SEQ ID NO: 391)

[0154] In certain embodiments, the second antigen-binding site that binds to CEACAM5 (e.g., human CEACAM5, e.g., cynomolgus monkey CEACAM5) comprises a heavy chain variable domain (VH) comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of an antigen-binding site disclosed in Table 2, and a light chain variable domain (VL) comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL of the same antigen-binding site disclosed in Table 2. In certain embodiments, the second antigen-binding site comprises the heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 of the VH and VL sequences of the antigen-binding site disclosed in Table 2, as determined under the method of Kabat (see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NIH Publication No. 91-3242, Bethesda), Chothia (see, e.g., Chothia C & Lesk AM, (1987), J. Mol. Biol. 196:901-917), MacCallum (see MacCallum RM et al., (1996) J. Mol. Biol. 262:732-745), or any other CDR determination method known in the art. In certain embodiments, the second antigen-binding site comprises the heavy chain CDR1, CDR2, and CDR3 sequences and the light chain CDR1, CDR2, and CDR3 sequences of an antigen-binding site disclosed in Table 2.

[0155] In certain embodiments, the second antigen-binding site is associated with an scFv of Table 2. For example, in certain embodiments, the second antigen-binding site comprises a VH sequence comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VH of Table 2. In certain embodiments, the second antigen-binding site comprises a VL sequence comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VL of Table 2. In certain embodiments, the second antigen-binding site comprises a VH sequence comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VH of Table 2, and a VL sequence comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VL of Table 2, wherein the VH and VL of Table 2 are selected from cognate pairs of sequences.

[0156] In certain embodiments, the VH comprises a CDR1, CDR2, and CDR3 selected from a cognate pair of sequences listed in Table 2. In certain embodiments, the VL comprises a CDR1, CDR2, and CDR3 selected from a cognate pair of sequences listed in Table 2. In certain embodiments, the second antigen-binding site comprises (a) a VH that comprises the CDR1, CDR2, and CDR3 of a VH sequence listed in Table 2, and (b) a VL that comprises the CDR1, CDR2, and CDR3 of a VL sequence listed in Table 2, wherein the VH and VL sequences are selected from a cognate pair of sequences listed in Table 2.

[0157] As used herein, the term "cognate pair" refers to a VH and VL that form an antigen-binding site. In some embodiments, a "cognate pair" refers to a pairing of a VH and VL as shown in Table 2. In some embodiments, a "cognate pair" refers to a pairing of a VH and VL as shown in Table 3.

[0158] As used in Table 2, the term "derived from" when applied to a VH, VL, or CDR refers to an amino acid sequence that has additional mutations (e.g., substitutions, deletions, etc.) compared to the referenced sequence. For example, the VH of cognate pair A1 in Table 2 (SEQ ID NO: 567) was derived from the VH of PH_420-CEACAM5 (shown in Table 3). Compared to the VH of PH_420-CEACAM5, SEQ ID NO: 567 has a cysteine ​​mutation. The VL of cognate pair A1 in Table 2 (SEQ ID NO: 568) was derived from the VL of PH_420-CEACAM5 (shown in Table 3). Compared to the VL of PH_420-CEACAM5, SEQ ID NO: 568 has a cysteine ​​mutation.

[0159] As used in Table 2, the term "derived from" when applied to an scFv refers to an amino acid sequence with additional mutations and / or linker sequences. For example, the scFv against GB1 is derived from cognate pair A1 in Table 2 and includes the VH and VL sequences of cognate pair A1 in Table 2 and a linker sequence (e.g., the (G4S)4 linker sequence (SEQ ID NO: 532)).

[0160] Table 3 lists exemplary sequences of heavy and light chain variable domains that, in combination, e.g., as cognate pairs, can bind to CEACAM5. CDR sequences are identified by Chothia and Kabat numbering as indicated.

[0161] [Table 3] <h2 style=";text-align:left;direction:ltr">TIFF2025527967000023. tif236155TIFF2025527967000024. tif235154TIFF2025527967000025. tif236154TIFF2025527967000026. tif235154TIFF2025527967000027. tif234155TIFF2025527967000028. tif236153TIFF2025527967000029. tif235154TIFF2025527967000030. tif232154TIFF2 025527967000031.tif235154TIFF2025527967000032.tif234154TIFF2025527967000033.tif233154TIFF2025527967000034.tif232154TIFF2025527967000035.tif233154TIFF2025527967000036.tif234154TIFF2025527967000037.tif233155TIFF2025527967000038.tif234154TIFF202552 7967000039.tif236153TIFF2025527967000040.tif236154TIFF2025527967000041.tif236153TIFF2025527967000042.tif233154TIFF2025527967000043.tif236154TIFF2025527967000044.tif235154TIFF2025527967000045.tif235154TIFF2025527967000046.tif234153TIFF20255279670 00047.tif235154TIFF2025527967000048.tif235155TIFF2025527967000049.tif236153TIFF2025527967000050.tif235154TIFF2025527967000051.tif236155TIFF2025527967000052.tif236154TIFF2025527967000053.tif234154TIFF2025527967000054.tif235153TIFF2025527967000055.<h2 style=";text-align:left;direction:ltr">tif235154TIFF2025527967000056. tif234155TIFF2025527967000057. tif233154TIFF2025527967000058. tif236153TIFF2025527967000059. tif232153TIFF2025527967000060. tif236154TIFF2025527967000061. tif233153TIFF2025527967000062. tif235155TIFF2025527967000063. tif2341 53TIFF2025527967000064.tif234153TIFF2025527967000065.tif233154TIFF2025527967000066.tif234154TIFF2025527967000067.tif235154TIFF2025527967000068.tif235154TIFF2025527967000069.tif234154TIFF2025527967000070.tif234155TIFF2025527967000071.tif236154TIFF20 25527967000072.tif235154TIFF2025527967000073.tif234155TIFF2025527967000074.tif235153TIFF2025527967000075.tif234155TIFF2025527967000076.tif236154TIFF2025527967000077.tif235154TIFF2025527967000078.tif235155TIFF2025527967000079.tif235154TIFF202552796 7000080.tif231155TIFF2025527967000081.tif233153TIFF2025527967000082.tif235153TIFF2025527967000083.tif236152TIFF2025527967000084.tif235153TIFF2025527967000085.tif234153TIFF2025527967000086.tif234154TIFF2025527967000087.tif234153TIFF2025527967000088.tif234153TIFF2025527967000089.tif235154TIFF2025527967000090.tif235154TIFF2025527967000091.tif233155TIFF2025527967000092.tif25153.

[0162]

Table 4

[0163] <h2 style=";text-align:left;direction:ltr"> In certain embodiments, the second antigen-binding site that binds to CEACAM5 (e.g., human CEACAM5, e.g., cynomolgus monkey CEACAM5) comprises an antibody heavy chain variable domain (VH) comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of an antibody disclosed in Table 3, and an antibody light chain variable domain (VL) comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL of the same antibody disclosed in Table 3 or 4. In certain embodiments, the second antigen-binding site comprises the heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 of the VH and VL sequences of the antigen-binding site disclosed in Table 3 or 4, as determined under the method of Kabat (see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NIH Publication No. 91-3242, Bethesda), Chothia (see, e.g., Chothia C & Lesk AM, (1987), J. Mol. Biol. 196:901-917), MacCallum (see MacCallum RM et al., (1996) J. Mol. Biol. 262:732-745), or any other CDR determination method known in the art. In certain embodiments, the second antigen-binding site comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3 of an antigen-binding site disclosed in Table 3 or 4.

[0164] In certain embodiments, the second antigen-binding site is associated with an scFv having a VH and VL of Table 3. For example, in certain embodiments, the second antigen-binding site comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VH of Table 3. In certain embodiments, the second antigen-binding site comprises a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VL of Table 3. In certain embodiments, the second antigen-binding site comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VL in Table 3, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VL in Table 3, wherein the VH and VL sequences are selected from cognate pairs of sequences listed in Table 3.

[0165] In certain embodiments, the VH comprises a CDR1, CDR2, and CDR3 selected from a VH sequence listed in Table 3. In certain embodiments, the VL comprises a CDR1, CDR2, and CDR3 selected from a VL sequence listed in Table 3. In certain embodiments, the second antigen-binding site comprises (a) a VH comprising a CDR1, CDR2, and CDR3 selected from a VH sequence listed in Table 3, and (b) a VL comprising a CDR1, CDR2, and CDR3 selected from a VL sequence listed in Table 3, wherein the VH and VL sequences are selected from a cognate pair of sequences listed in Table 3.

[0166] In certain embodiments, the second antigen-binding site is associated with an scFv having a VH and VL of Table 4. For example, in certain embodiments, the second antigen-binding site comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VH of Table 4. In certain embodiments, the second antigen-binding site comprises a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VL of Table 4. In certain embodiments, the second antigen-binding site comprises a VH comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VH in Table 4, and a VL comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the amino acid sequence of a VL in Table 4, wherein the VH and VL in Table 4 are selected from the same clone listed in Table 4.

[0167] In certain embodiments, the VH comprises CDR1, CDR2, and CDR3 of a VH sequence selected from Table 4. In certain embodiments, the VL comprises CDR1, CDR2, and CDR3 of a VL sequence selected from Table 4. In certain embodiments, the second antigen-binding site comprises (a) a VH that comprises CDR1, CDR2, and CDR3 of a VH sequence selected from Table 4, and (b) a VL that comprises CDR1, CDR2, and CDR3 of a VL sequence selected from Table 4, wherein the VH and VL of Table 4 are selected from the same clone listed in Table 4.

[0168] In each of the above embodiments, it is contemplated herein that the VH and / or VL sequences that bind together to CEACAM5 may contain amino acid changes (e.g., substitutions, deletions, or additions of at least 1, 2, 3, 4, 5, or 10 amino acids) in the framework regions of the VH and / or VL without significantly affecting their ability to bind to CEACAM5.

[0169] In certain embodiments, antigen-binding sites of the invention derived from a Tier 1 cognate pair in Table 3 or derived from a Tier 1 clone in Table 4 bind to human CEACAM5 or a CEACAM5 variant or an extracellular domain thereof with a K of 25 nM or less (e.g., 24 nM, 23 nM, 22 nM, 21 nM, 20 nM, 19 nM, 18 nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM or less). D Combine by value. K D It is understood that a smaller value indicates a higher affinity. In certain embodiments, the antigen-binding site of the present invention derived from a cognate pair in Tier 2 of Table 3 or derived from a clone in Tier 2 of Table 4 binds to human CEACAM5 or a CEACAM5 variant or its extracellular domain with an affinity of 15 nM or more (e.g., 20 nM, 25 nM, 30 nM, 40 nM, 50 nM, 60 nM, 70 nM, 80 nM, 90 nM, 100 nM, 110 nM, 120 nM, 130 nM, 140 nM, 150 nM, 160 nM, 170 nM, 180 nM, 190 nM, 200 nM, 210 nM, 220 nM, 230 nM, 240 nM, 250 nM, 260 nM, 270 nM, 280 nM, 290 nM, 300 nM, 310 nM, 320 nM, 330 nM, 340 nM, 350 nM, 360 nM, 370 nM, 380 nM, 390 nM, 400 nM, 410 nM, 420 nM, 430 nM, 440 nM, 450 nM, 460 nM, 470 nM, 480 nM, 490 nM, 500 nM, 510 nM, 520 nM, 530 nM, 540 nM, 550 nM, 560 nM, 570 nM, 580 nM, 590 nM, 600 nM, 610 nM, K of 100nM, 130nM, 140nM, 150nM, 160nM, 170nM, 180nM, 190nM, 200nM, 220nM, 240nM, 260nM, 280nM, 300nM, 320nM, 340nM, 360nM, 380nM, 400nM, 420nM, 440nM, 460nM, 480nM, 500nM, 520nM, 540nM, or 560nM or higher) DIn certain embodiments, the antigen-binding site of the present invention derived from a Tier 2 cognate pair in Table 3 or derived from a Tier 2 clone in Table 4 binds to human CEACAM5 or a CEACAM5 variant or an extracellular domain thereof at a binding affinity of 15 to 560 nM, 15 to 400 nM, 15 to 300 nM, 15 to 200 nM, 15 to 100 nM, 15 to 80 nM, 20 to 560 nM, 20 to 400 nM, 20 to 300 nM, 20 to 200 nM, 20 to 100 nM, 20 to 80 nM, K in the ranges of 25-100nM, 25-560nM, 25-400nM, 25-300nM, 25-200nM, 25-100nM, 25-80nM, 50-560nM, 50-400nM, 50-300nM, 50-200nM, 50-100nM, 50-80nM, 100-560nM, 100-400nM, 100-300nM, 100-200nM, 120-560nM, 120-400nM, 120-300nM, or 120-200nM D Join by value.

[0170] In certain embodiments, the antigen-binding site is at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH and VL sequences, respectively, of a Tier 1 pair of Table 3 or a Tier 1 clone of Table 4, as disclosed herein. and a K of 25 nM or less (e.g., 24 nM, 23 nM, 22 nM, 21 nM, 20 nM, 19 nM, 18 nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM or less) to human CEACAM5 or a CEACAM5 variant or its extracellular domain. DIn certain embodiments, the antigen-binding site disclosed herein comprises VH and VL sequences that are at least 90% identical (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) to the VH and VL sequences, respectively, of a Tier 2 cognate pair in Table 3 or a Tier 2 clone in Table 4, and binds to human CEACAM5 or a CEACAM5 variant or an extracellular domain thereof with a binding affinity of 15 nM or greater (e.g., For example, a K of 20nM, 25nM, 30nM, 40nM, 50nM, 60nM, 70nM, 80nM, 90nM, 100nM, 110nM, 120nM, 130nM, 140nM, 150nM, 160nM, 170nM, 180nM, 190nM, 200nM, 220nM, 240nM, 260nM, 280nM, 300nM, 320nM, 340nM, 360nM, 380nM, 400nM, 420nM, 440nM, 460nM, 480nM, 500nM, 520nM, 540nM, or 560nM or greater DIn certain embodiments, the antigen-binding site disclosed herein comprises a VH and VL sequence that is at least 90% identical (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) to the VH and VL sequences, respectively, of a Tier 2 cognate pair in Table 3 or a Tier 2 clone in Table 4, and binds to human CEACAM5 or a CEACAM5 variant or an extracellular domain thereof with an affinity of 15 to 560 nM, 15 to 400 nM, 15 to 300 nM, 15 to 200 nM, 15 to 100 nM, or , 15~80nM, 20~560nM, 20~400nM, 20~300nM, 20~200nM, 20~100nM, 20~80nM, 25~ 100nM, 25~560nM, 25~400nM, 25~300nM, 25~200nM, 25~100nM, 25~80nM, 50~560n K in the range of M, 50-400nM, 50-300nM, 50-200nM, 50-100nM, 50-80nM, 100-560nM, 100-400nM, 100-300nM, 100-200nM, 120-560nM, 120-400nM, 120-300nM, or 120-200nM D Join by value.

[0171] In certain embodiments, antigen-binding sites of the invention derived from a Tier 1 or Tier 2 cognate pair of Table 3 or a Tier 1 or Tier 2 clone of Table 4 do not bind to CEACAM1, CEACAM6, or CEACAM8 at detectable levels (e.g., as detected by surface plasmon resonance (SPR) or enzyme-linked immunosorbent assay (ELISA) for in vitro binding, or by flow cytometry for binding to cells expressing the respective antigen). In certain embodiments, antigen-binding sites of the invention derived from a Tier 3 cognate pair of Table 3 or a Tier 3 clone of Table 4 do not bind to CEACAM1, CEACAM6, or CEACAM8 at detectable levels (e.g., a K of 100 nM, 200 nM, 500 nM, 1 μM, 2 μM, 5 μM, or 10 μM or greater). D value).

[0172] In certain embodiments, the antigen-binding site disclosed herein comprises VH and VL sequences that are at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH and VL sequences, respectively, of a Tier 1 or Tier 2 cognate pair in Table 3 or a Tier 1 or Tier 2 clone in Table 4, and does not bind to CEACAM1, CEACAM6, or CEACAM8 at a detectable level (e.g., as detected by surface plasmon resonance (SPR) or enzyme-linked immunosorbent assay (ELISA) for in vitro binding, or by flow cytometry for binding to cells expressing the respective antigen). In certain embodiments, the antigen-binding site comprises VH and VL sequences that are at least 90% identical (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) to the VH and VL sequences, respectively, of a Tier 3 pair of Table 3 or a Tier 3 clone of Table 4, as disclosed herein, and have a detectable K (e.g., 100 nM, 200 nM, 500 nM, 1 μM, 2 μM, 5 μM, or 10 μM or greater). D It binds to CEACAM1, CEACAM6, or CEACAM8 at a specific binding site (value).

[0173] In certain embodiments of any one of the antigen-binding sites disclosed herein, in which the N-terminal amino acid of the heavy chain variable region is Gln (Q), Q can be replaced with Glu (E), generating a variant designated "QE." In certain embodiments of any one of the antigen-binding sites disclosed herein, in which the N-terminal amino acid of the heavy chain variable region is Gln (Q) or Glu (E), Q or E can be replaced with pyroglutamic acid (pE). Antigen-binding sites generated from such substitutions fall within the same tier as the parent antigen-binding site.

[0174] In certain embodiments, the second antigen-binding site competes with the antigen-binding site described above for binding to CEACAM5 (e.g., human CEACAM5, e.g., cynomolgus monkey CEACAM5). In certain embodiments, the antigen-binding site of the present invention competes with an antigen-binding site associated with a clone selected from Table 2, where the clone is selected from the group consisting of clone PH_420-CEACAM5, clone 1078_C04-CEACAM5, clone 1079_H05-CEACAM5, 7A10.A7-CEACAM5-B.01, 8H2.B10-CEACAM5-B.01, mouse 16F6.A2-CEACAM5-B.02, humanized 16F6.A 2-CEACAM5-B.02-BM, PH_415-CEACAM5, PH_416-CEACAM5, PH_418-CEACAM5, PH_419-CEACAM5, PH_417-CEACAM5, PH_421-CEAC AM5, 1078_G03-CEACAM5, mouse 1A1.A3-CEACAM5-B.02, humanized 1A1.A3-CEACAM5-B.02-BM, 1080_G01-CEACAM5, 1078_C12-CEACAM5, 1078_F02-CEACAM5, 1079_B08-CEACAM5, 1078_G03-CEACAM5, 1079_A10-CEACAM5, 1079_A12-CEACAM5, 1078_C04-CEACAM5, 10 80_F11-CEACAM5, 1081_E01-CEACAM5, 1083_A05-CEACAM5, 1085_D12-CEACAM5, 1079_G12-CEACAM5, 1080_A01-CEACAM5, 12C7 .A2-CEACAM5-B.01, 12A6.H2-CEACAM5-B.01, 4G3.C3-CEACAM5-B.01, 4B10.B3-CEACAM5-A.02, 13C7.A6-CEACAM5-B.02, 7E11 .B2-CEACAM5-B.02, 10D6.E3-CEACAM5-B.02, 13C7.F2-CEACAM5-B.02, 16B11.G2-CEACAM5-B.01, and 6D10.C8-CEACAM5-B.02.In some embodiments, antigen binding sites of the invention compete with antigen binding sites comprising a VL sequence and a VH sequence selected from Table 1, wherein the VH sequence and VL sequence are derived from a cognate pair in Table 1 or a clone in Table 2. In some embodiments, antigen binding sites of the invention compete with antigen binding sites comprising a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3, wherein the CDRs are selected from a cognate pair listed in Table 1 or a clone listed in Table 2.

[0175] Fc domain Within the Fc domain, CD16 binding is mediated by the hinge region and CH2 domain. For example, in human IgG1, the interaction with CD16 is primarily focused on amino acid residues Asp265-Glu269, Asn297-Thr299, Ala327-Ile332, Leu234-Ser239 in the CH2 domain, and the carbohydrate residue N-acetyl-D-glucosamine (see Sondermann et al., Nature, 406(6793):267-273). Thus, in certain embodiments, an antibody Fc domain or a portion thereof comprises a hinge and CH2 domain. Based on the known domains, mutations can be selected to enhance or reduce binding affinity to CD16, such as by using a phage display library or a yeast surface display cDNA library, or can be designed based on the known three-dimensional structure of the interaction. Binding of CD16 to the Fc domain can be determined by conventional methods, for example, by surface plasmon resonance (SPR) or enzyme-linked immunosorbent assay (ELISA) for in vitro binding, or by flow cytometry for binding to cells expressing CD16 on their cell surface.

[0176] Assembly of heterodimeric antibody heavy chains can be achieved by expressing two different antibody heavy chain sequences in the same cell, which can result in the assembly of homodimers of each antibody heavy chain as well as heterodimers. Promotion of preferential assembly of heterodimers can be achieved by incorporating different mutations into the CH3 domain of each antibody heavy chain constant region, as shown in U.S. Patent Nos. 13 / 494,870, 16 / 028,850, 11 / 533,709, 12 / 875,015, 13 / 289,934, 14 / 773,418, 12 / 811,207, 13 / 866,756, 14 / 647,480, and 14 / 830,336. For example, mutations can be made in the CH3 domain based on human IgG1 to incorporate different pairs of amino acid substitutions within the first and second polypeptides that allow the two chains to selectively heterodimerize with one another. All amino acid substitution positions shown below are numbered according to the EU index as in Kabat.

[0177] In one scenario, the amino acid substitutions in a first polypeptide replace the original amino acid with a larger amino acid selected from arginine (R), phenylalanine (F), tyrosine (Y), or tryptophan (W), and at least one amino acid substitution in a second polypeptide replaces the original amino acid(s) with a smaller amino acid(s) selected from alanine (A), serine (S), threonine (T), or valine (V), such that the larger amino acid substitution (protrusion) fits into the surface of the smaller amino acid substitution(s) (cavity). For example, one polypeptide can incorporate a T366W substitution, while the other can incorporate three substitutions including T366S, L368A, and Y407V.

[0178] The antibody heavy chain variable domains of the invention may be coupled to an amino acid sequence at least 90% identical to an antibody constant region, e.g., an IgG constant region comprising the hinge, CH2, and CH3 domains, with or without the CH1 domain. In some embodiments, the amino acid sequence of the constant region is at least 90% identical to a human antibody constant region, such as a human IgG1, IgG2, IgG3, or IgG4 constant region. In one embodiment, an antibody Fc domain, or portion thereof, sufficient to bind to CD16 comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the wild-type human IgG1 Fc sequence DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO: 531). In some other embodiments, the amino acid sequence of the constant region is at least 90% identical to an antibody constant region from another mammal, such as a rabbit, dog, cat, mouse, or horse.

[0179] In some embodiments, the antibody constant domain linked to the scFv or Fab fragment is capable of binding to CD 16. In some embodiments, the protein incorporates a portion of an antibody Fc domain (e.g., a sufficient portion of an antibody Fc domain to bind to CD 16), wherein the antibody Fc domain comprises a hinge and CH2 domain (e.g., the hinge and CH2 domain of a human IgG1 antibody) and / or an amino acid sequence at least 90% identical to amino acid sequence 234-332 of a human IgG antibody.

[0180] For example, one or more mutations can be incorporated into the constant region compared to the human IgG1 constant region at Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411 and / or K439. Exemplary substitutions include, for example, Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, T350V, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366L, T366M, T366K, T366W, T366S, L36 8E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K392D, K392E, T394F, T394W, D399R, D399K, D399V, S400K, S400R, D401K, F405A, F405T, Y407A, Y407I, Y407V, K409F, K409W, K409D, K409R, T411D, T411E, K439D, and K439E.

[0181] In certain embodiments, mutations that may be incorporated into CH1 of the human IgG1 constant region may be at amino acids V125, F126, P127, T135, T139, A140, F170, P171 and / or V173. In certain embodiments, mutations that may be incorporated into Cκ of the human IgG1 constant region may be at amino acids E123, F116, S176, V163, S174 and / or T164.

[0182] Alternatively, the amino acid substitutions can be selected from the following set of substitutions shown in Table 5. [Table 5]

[0183] Alternatively, the amino acid substitutions can be selected from the following set of substitutions shown in Table 6. [Table 6]

[0184] Alternatively, the amino acid substitutions can be selected from the following set of substitutions shown in Table 7. [Table 7]

[0185] Alternatively, at least one amino acid substitution in each polypeptide chain can be selected from Table 8. [Table 8]

[0186] Alternatively, at least one amino acid substitution can be selected from the following substitution sets in Table 9, where the position(s) shown in the first polypeptide row are replaced with any known negatively charged amino acid, and the position(s) shown in the second polypeptide row are replaced with any known positively charged amino acid. [Table 9]

[0187] Alternatively, at least one amino acid substitution can be selected from the following set of Table 10, where the position(s) shown in the first polypeptide row are replaced with any known positively charged amino acid, and the position(s) shown in the second polypeptide row are replaced with any known negatively charged amino acid. [Table 10]

[0188] Alternatively, the amino acid substitutions can be selected from the following set in Table 11: [Table 11]

[0189] Alternatively, or in addition, the structural stability of a heteromultimeric protein can be increased by introducing S354C into either the first or second polypeptide chain and Y349C into the opposite polypeptide chain, thereby forming an artificial disulfide bridge within the interface of the two polypeptides.

[0190] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at position T366, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of T366, L368, and Y407.

[0191] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of T366, L368, and Y407, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at position T366.

[0192] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region at one or more positions selected from the group consisting of E357, K360, Q362, S364, L368, K370, T394, D401, F405, and T411, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region at one or more positions selected from the group consisting of Y349, E357, S364, L368, K370, T394, D401, F405, and T411.

[0193] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region at one or more positions selected from the group consisting of Y349, E357, S364, L368, K370, T394, D401, F405, and T411, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region at one or more positions selected from the group consisting of E357, K360, Q362, S364, L368, K370, T394, D401, F405, and T411.

[0194] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of L351, D399, S400, and Y407, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of T366, N390, K392, K409, and T411.

[0195] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of T366, N390, K392, K409, and T411, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of L351, D399, S400, and Y407.

[0196] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of Q347, Y349, K360, and K409, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of Q347, E357, D399, and F405.

[0197] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of Q347, E357, D399, and F405, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of Y349, K360, Q347, and K409.

[0198] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region at one or more positions selected from the group consisting of K370, K392, K409, and K439, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region at one or more positions selected from the group consisting of D356, E357, and D399.

[0199] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of D356, E357, and D399, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of K370, K392, K409, and K439.

[0200] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of L351, E356, T366, and D399, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of Y349, L351, L368, K392, and K409.

[0201] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of Y349, L351, L368, K392, and K409, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of the IgG1 constant region at one or more positions selected from the group consisting of L351, E356, T366, and D399.

[0202] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by a S354C substitution, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by a Y349C substitution.

[0203] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by a Y349C substitution, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by a S354C substitution.

[0204] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by K360E and K409W substitutions, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by Q347R, D399V, and F405T substitutions.

[0205] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by Q347R, D399V, and F405T substitutions, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by K360E and K409W substitutions.

[0206] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by a T366W substitution, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by T366S, T368A, and Y407V substitutions.

[0207] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by T366S, T368A, and Y407V substitutions, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by a T366W substitution.

[0208] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by T350V, L351Y, F405A, and Y407V substitutions, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by T350V, T366L, K392L, and T394W substitutions.

[0209] In some embodiments, the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by T350V, T366L, K392L, and T394W substitutions, and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgG1 constant region by T350V, L351Y, F405A, and Y407V substitutions.

[0210] Exemplary Multispecific Binding Proteins Listed below are examples of TriNKETs that contain an antigen-binding site that binds to CEACAM5 and an antigen-binding site that binds to NKG2D, each linked to an antibody constant region that contains mutations that allow heterodimerization of the two Fc chains. The CDR sequences under Chothia are in bold, and the CDR sequences under Kabat are underlined.

[0211] TriNKETs are designed in the F3 format, i.e., the antigen-binding site that binds to CEACAM5 is a Fab and the antigen-binding site that binds to NKG2D is an scFv. The TriNKETs shown below are all in the F3' format, i.e., the antigen-binding site that binds to CEACAM5 is an scFv and the antigen-binding site that binds to NKG2D is a Fab. In each TriNKET, the scFv contains Cys substitutions in the VH and VL regions to promote disulfide bridge formation between the VH and VL of the scFv.

[0212] The VH and VL of an scFv can be linked via a linker, such as a peptide linker. In certain embodiments, the peptide linker is a flexible linker. Regarding the amino acid composition of the linker, the peptide is selected for its properties of providing flexibility, not interfering with the structure and function of other domains of the protein of the present invention, and being resistant to cleavage by proteases. For example, glycine and serine residues generally provide protease resistance. In certain embodiments, the VL is linked to the VH at the N-terminus or C-terminus via a (GlyGlyGlyGlySer)4 ((G4S)4) linker (SEQ ID NO: 532).

[0213] The length of the linker (e.g., a flexible linker) can be "short," e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 amino acid residues, or "long," e.g., at least 13 amino acid residues. In certain embodiments, the linker is 10-50, 10-40, 10-30, 10-25, 10-20, 15-50, 15-40, 15-30, 15-25, 15-20, 20-50, 20-40, 20-30, or 20-25 amino acid residues in length.

[0214] In certain embodiments, the linker is (GS) n (SEQ ID NO: 533), (GGS) n (SEQ ID NO: 534), (GGGS) n (SEQ ID NO: 535), (GGSG) n (SEQ ID NO: 536), (GGSGG) n (SEQ ID NO: 537), and (GGGGS)n (SEQ ID NO:538), where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In certain embodiments, the linker comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NO:532, SEQ ID NO:539, SEQ ID NO:540, SEQ ID NO:541, SEQ ID NO:542, SEQ ID NO:543, SEQ ID NO:544, SEQ ID NO:545, SEQ ID NO:546, and SEQ ID NO:547 listed in Table 12.

[0215] [Table 12]

[0216] In F3'-TriNKET, the CEACAM5-binding scFv is linked to the N-terminus of the Fc via a Gly-Ser linker. An Ala-Ser or Gly-Ser linker is included in the elbow hinge region sequence to balance flexibility and optimal geometry. In certain embodiments, the additional sequence Thr-Lys-Gly can be added at the N- or C-terminus to the Ala-Ser or Gly-Ser sequence at the hinge.

[0217] As used herein to describe these exemplary TriNKETs, Fc includes the antibody hinge, CH2, and CH3. In each exemplary TriNKET, the Fc domain linked to the scFv contains the mutations Q347R, D399V, and F405T, and the Fc domain linked to the Fab contains the corresponding mutations K360E and K409W to form heterodimers. The Fc domain linked to the scFv further contains a S354C substitution in the CH3 domain, which forms a disulfide bond with the Y349C substitution on the Fc linked to the Fab. These substitutions are in bold in the sequences described in this subsection.

[0218] For example, a TriNKET of the present disclosure is F3'-GB1. F3'-GB1 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of cognate pair A1 in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB1 comprises three polypeptides: GB1-VL-VH-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL.

[0219] JPEG2025527967000159.jpg62161

[0220] JPEG2025527967000160.jpg57159

[0221] JPEG2025527967000161.jpg30158

[0222] GB1-VL-VH-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described below. The scFv contains a GB1 heavy chain variable domain connected to the C-terminus of the GB1 light chain variable domain via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed from the cysteine ​​heterodimerization mutations shown in bold and underlined in the sequence above.

[0223] A49MI-VH-CH1-Fc represents the heavy chain portion of a Fab fragment containing the CH1 domain linked to the heavy chain variable domain (SEQ ID NO: 508) and Fc domain of NKG2D-binding A49MI. The Fc domain in A49MI-VH-CH1-Fc contains a Y349C substitution in the CH3 domain, which forms a disulfide bond with the S354C substitution on the Fc in GB1-VL-VH-Fc. In A49MI-VH-CH1-Fc, the Fc domain also contains K360E and K409W substitutions for heterodimerization with the Fc in GB1-VL-VH-Fc.

[0224] A49MI-VL-CL represents the light chain portion of the Fab fragment containing the light chain variable and constant domains of the NKG2D-binding A49MI (SEQ ID NO: 493).

[0225] Another TriNKET of the present disclosure is F3'-GB3. F3'-GB3 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB3 comprises three polypeptides: GB3-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The polypeptides of GB3-VH-VL-Fc are shown below.

[0226] JPEG2025527967000162.jpg60158

[0227] GB3-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB3 connected to the C-terminus of the heavy chain variable domain of GB3 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0228] Another TriNKET of the present disclosure is F3'-GB5. F3'-GB5 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB5 comprises three polypeptides: GB5-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The polypeptides of GB5-VH-VL-Fc are shown below.

[0229] JPEG2025527967000163.jpg44157JPEG2025527967000164.jpg22157

[0230] GB5-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains a GB5 light chain variable domain connected to the C-terminus of the GB5 heavy chain variable domain via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0231] Another TriNKET of the present disclosure is F3'-GB7. F3'-GB7 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB7 comprises three polypeptides: GB7-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB7-VH-VL-Fc polypeptide is shown below.

[0232] JPEG2025527967000165.jpg60159

[0233] GB7-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB7 connected to the C-terminus of the heavy chain variable domain of GB7 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0234] Another TriNKET of the present disclosure is F3'-GB9. F3'-GB9 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB9 comprises three polypeptides: GB9-VL-VH-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB9-VL-VH-Fc polypeptide is shown below.

[0235] JPEG2025527967000166.jpg60158

[0236] GB9-VL-VH-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB9 connected to the N-terminus of the heavy chain variable domain of GB9 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0237] Another TriNKET of the present disclosure is F3'-GB11. F3'-GB11 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB11 comprises three polypeptides: GB11-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB11-VH-VL-Fc polypeptide is shown below.

[0238] JPEG2025527967000167.jpg59157

[0239] GB11-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB11 connected to the C-terminus of the heavy chain variable domain of GB11 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0240] Another TriNKET of the present disclosure is F3'-GB13. F3'-GB13 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB13 comprises three polypeptides: GB13-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB13-VH-VL-Fc polypeptide is shown below.

[0241] JPEG2025527967000168.jpg60157

[0242] GB13-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB13 connected to the C-terminus of the heavy chain variable domain of GB13 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0243] Another TriNKET of the present disclosure is F3'-GB15. F3'-GB15 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB15 comprises three polypeptides: GB15-VL-VH-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB15-VL-VH-Fc polypeptide is shown below.

[0244] JPEG2025527967000169.jpg43156JPEG2025527967000170.jpg21159

[0245] GB15-VL-VH-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB15 connected to the N-terminus of the heavy chain variable domain of GB15 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0246] Another TriNKET of the present disclosure is F3'-GB17. F3'-GB17 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB17 comprises three polypeptides: GB17-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB17-VH-VL-Fc polypeptide is shown below.

[0247] JPEG2025527967000171.jpg60156

[0248] GB17-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB17 connected to the C-terminus of the heavy chain variable domain of GB17 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0249] Another TriNKET of the present disclosure is F3'-GB19. F3'-GB19 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB19 comprises three polypeptides: GB19-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB19-VH-VL-Fc polypeptide is shown below.

[0250] JPEG2025527967000172.jpg59155

[0251] GB19-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB19 connected to the C-terminus of the heavy chain variable domain of GB19 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0252] Another TriNKET of the present disclosure is F3'-GB21. F3'-GB21 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB21 comprises three polypeptides: GB21-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB21-VH-VL-Fc polypeptide is shown below.

[0253] JPEG2025527967000173.jpg62158

[0254] GB21-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB21 connected to the C-terminus of the heavy chain variable domain of GB21 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0255] Another TriNKET of the present disclosure is F3'-GB23. F3'-GB23 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB23 comprises three polypeptides: GB23-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB23-VH-VL-Fc polypeptide is shown below.

[0256] JPEG2025527967000174.jpg59158

[0257] GB23-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB23 connected to the C-terminus of the heavy chain variable domain of GB23 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0258] Another TriNKET of the present disclosure is F3'-GB25. F3'-GB25 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB25 comprises three polypeptides: GB25-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB25-VH-VL-Fc polypeptide is shown below.

[0259] JPEG2025527967000175.jpg41159JPEG2025527967000176.jpg22157

[0260] GB25-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB25 connected to the C-terminus of the heavy chain variable domain of GB5 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0261] Another TriNKET of the present disclosure is F3'-GB27. F3'-GB27 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB27 comprises three polypeptides: GB27-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB27-VH-VL-Fc polypeptide is shown below.

[0262] JPEG2025527967000177.jpg61159

[0263] GB27-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB27 connected to the C-terminus of the heavy chain variable domain of GB27 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0264] Another TriNKET of the present disclosure is F3'-GB29. F3'-GB29 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB29 comprises three polypeptides: GB29-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB29-VH-VL-Fc polypeptide is shown below.

[0265] JPEG2025527967000178.jpg61158

[0266] GB29-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB29 connected to the C-terminus of the heavy chain variable domain of GB29 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0267] Another TriNKET of the present disclosure is F3'-GB31. F3'-GB31 comprises (a) a CEACAM5-binding scFv sequence derived from the VH and VL sequences of the corresponding cognate pair in Table 2 linked to an Fc domain, and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to the Fc domain. F3'-GB31 comprises three polypeptides: GB31-VH-VL-Fc, A49MI-VH-CH1-Fc, and A49MI-VL-CL. A49MI-VH-CH1-Fc and A49MI-VL-CL are described above in the context of F3'GB1. The GB31-VH-VL-Fc polypeptide is shown below.

[0268] JPEG2025527967000179.jpg60159

[0269] GB31-VH-VL-Fc represents the complete sequence of a CEACAM5-binding scFv linked to an Fc domain via a Gly-Ser hinge. The Fc domain linked to the scFv contains Q347R, D399V, and F405T substitutions for heterodimerization, as well as an S354C substitution for disulfide bond formation with the Y349C substitution in A49MI-VH-CH1-Fc, as described above. The scFv contains the light chain variable domain of GB31 connected to the C-terminus of the heavy chain variable domain of GB31 via a (G4S)4 linker (SEQ ID NO: 532). The heavy and light chain variable domains of the scFv are also linked via a disulfide bridge formed via a cysteine ​​heterodimerization mutation, shown in bold and underlined in the sequence above.

[0270] In certain embodiments, a TriNKET of the present disclosure is identical to one of the exemplary TriNKETs described above that contain the EW-RVT Fc mutation, except that the Fc domain linked to the NKG2D-binding Fab fragment contains the Q347R, D399V, and F405T substitutions, and the Fc domain linked to the CEACAM5-binding scFv contains the corresponding substitutions K360E and K409W to form heterodimers. In certain embodiments, a TriNKET of the present disclosure is identical to one of the exemplary TriNKETs described above that contain the KiH Fc mutation, except that the Fc domain linked to the NKG2D-binding Fab fragment contains the T366S, L368A, and Y407V "hole" substitutions, and the Fc domain linked to the CEACAM5-binding scFv contains the T366W "knob" substitution to form heterodimers.

[0271] In certain embodiments, a TriNKET of the present disclosure is identical to one of the exemplary TriNKETs described above, except that the Fc domain linked to the NKG2D-binding Fab fragment contains a S354C substitution in the CH3 domain, and the Fc domain linked to the CEACAM5-binding scFv contains a Y349C substitution in the CH3 domain that matches to form a disulfide bond.

[0272] Those skilled in the art will understand that during protein production and / or storage, the N-terminal glutamate (E) or glutamine (Q) can cyclize to form a lactam (e.g., spontaneously or catalyzed by enzymes present during production and / or storage). Thus, in some embodiments in which the N-terminal residue of a polypeptide's amino acid sequence is E or Q, the corresponding amino acid sequence in which E or Q is replaced with pyroglutamate is also contemplated herein.

[0273] Those skilled in the art will also understand that the C-terminal lysine (K) of a protein can be removed (e.g., spontaneously or catalyzed by enzymes present during production and / or storage) during protein production and / or storage. Such removal of K is often observed in proteins that include an Fc domain at their C-terminus. Thus, in some embodiments where the C-terminal residue of a polypeptide's amino acid sequence (e.g., an Fc domain sequence) is K, the corresponding amino acid sequence with the K removed is also contemplated herein.

[0274] The multispecific proteins described above can be produced using recombinant DNA techniques well known to those skilled in the art. For example, a first nucleic acid sequence encoding a first immunoglobulin heavy chain can be cloned into a first expression vector, a second nucleic acid sequence encoding a second immunoglobulin heavy chain can be cloned into a second expression vector, and a third nucleic acid sequence encoding an immunoglobulin light chain can be cloned into a third expression vector, and the first, second, and third expression vectors can be stably transfected together into a host cell to produce a multimeric protein.

[0275] To achieve the highest yield of the multispecific protein, different ratios of the first, second, and third expression vectors can be explored to determine the optimal ratio for transfection into host cells. After transfection, single clones can be isolated for cell bank generation using methods known in the art, such as limiting dilution, ELISA, FACS, microscopy, or Clonepix.

[0276] Clones can be cultured under conditions suitable for bioreactor scale-up and sustained expression of the multispecific proteins. The multispecific proteins can be isolated and purified using methods known in the art, including centrifugation, depth filtration, cell lysis, homogenization, freeze-thaw, affinity purification, gel filtration, ion exchange chromatography, hydrophobic interaction exchange chromatography, and mixed-mode chromatography.

[0277] II. Characteristics of Multispecific Proteins The multispecific proteins described herein comprise an NKG2D-binding site, a CEACAM5-binding site, and an antibody Fc domain or portion thereof sufficient to bind CD 16, or an antigen-binding site that binds CD 16. In some embodiments, the multispecific protein comprises an additional antigen-binding site that binds CEACAM5, as exemplified by the F4-TriNKET format.

[0278] In some embodiments, the multispecific proteins exhibit similar thermostability to the corresponding monoclonal antibody, i.e., the monoclonal antibody that contains the same CEACAM5 binding site as that incorporated into the multispecific protein.

[0279] In some embodiments, the multispecific protein simultaneously binds to cells expressing NKG2D and / or CD16, e.g., NK cells, and cells expressing CEACAM5, e.g., certain tumor cells. Binding of the multispecific protein to NK cells can enhance the activity of NK cells for the destruction of CEACAM5-expressing tumor cells.

[0280] In some embodiments, the multispecific protein binds to CEACAM5 with similar affinity as the corresponding anti-CEACAM5 monoclonal antibody (i.e., a monoclonal antibody that contains the same CEACAM5 binding site as that incorporated into the multispecific protein). In some embodiments, the multispecific protein is more effective at killing tumor cells that express CEACAM5 than the corresponding monoclonal antibody.

[0281] In certain embodiments, the multispecific proteins described herein that contain a binding site for CEACAM5 activate primary human NK cells when co-cultured with cells expressing CEACAM5. NK cell activation is characterized by CD107a degranulation and increased IFN-γ cytokine production. Furthermore, compared to the corresponding anti-CEACAM5 monoclonal antibody, the multispecific proteins can exhibit superior activation of human NK cells in the presence of cells expressing CEACAM5.

[0282] In some embodiments, the multispecific proteins described herein that contain a binding site for CEACAM5 enhance the activity of resting human NK cells and IL-2-activated human NK cells when co-cultured with cells expressing CEACAM5.

[0283] In some embodiments, the multispecific proteins are advantageous for targeting tumor cells that express intermediate and low levels of CEACAM5 compared to the corresponding monoclonal antibodies that bind to CEACAM5.

[0284] In some embodiments, the bivalent F4 format of TriNKET (i.e., TriNKET containing an additional antigen-binding site that binds to CEACAM5) improves the avidity of TriNKET binding to CEACAM5, thereby substantially stabilizing the expression and maintenance of high levels of CEACAM5 on the surface of tumor cells. In some embodiments, F4-TriNKET mediates more potent tumor cell killing than the corresponding F3-TriNKET or F3'-TriNKET.

[0285] III. Therapeutic applications The present invention provides methods of treating autoimmune diseases or cancer using the multispecific binding proteins described herein and / or the pharmaceutical compositions described herein. The methods can be used to treat a variety of cancers that express CEACAM5.

[0286] Treatment methods can be characterized according to the cancer being treated, for example, in certain embodiments, the cancer is selected from the group consisting of gastrointestinal cancer, colorectal cancer, pancreatic cancer, non-small cell lung cancer, and esophageal cancer.

[0287] In certain embodiments, the cancer is a solid tumor. In certain other embodiments, the cancer is brain cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, colorectal cancer, endometrial cancer, esophageal cancer, leukemia, lung cancer, liver cancer, melanoma, ovarian cancer, pancreatic cancer, prostate cancer, rectal cancer, kidney cancer, stomach cancer, testicular cancer, or uterine cancer.In yet other embodiments, the cancer is angiogenic tumor, squamous cell carcinoma, adenocarcinoma, small cell carcinoma, melanoma, glioma, neuroblastoma, sarcoma (e.g., angiosarcoma or chondrosarcoma), laryngeal carcinoma, parotid gland carcinoma, biliary tract carcinoma, thyroid carcinoma, acral lentiginous melanoma, actinic keratosis, acute lymphocytic leukemia, acute myeloid leukemia, adenoid cystic carcinoma, adenoma, adenosarcoma, adenosquamous cell carcinoma, anal canal carcinoma, anal carcinoma, anorectal carcinoma, astrocytoma, Bartholin's gland carcinoma, basal cell carcinoma, bile duct carcinoma, bone cancer, bone marrow carcinoma, bronchial carcinoma, bronchial adenocarcinoma, carcinoid, cholangiocarcinoma, chondrosarcoma, choroid lamina propria, thyroid carcinoma, thyroid cancer ... Cephaloma / carcinoma, chronic lymphocytic leukemia, chronic myeloid leukemia, clear cell carcinoma, connective tissue carcinoma, cystadenoma, digestive system cancer, duodenal cancer, endocrine system cancer, endodermal sinus sarcoma, endometrial stromal hyperplasia, endometrial hyperplasia, endometrial adenocarcinoma, endothelial cell carcinoma, ependymal carcinoma, epithelial cell carcinoma, Ewing's sarcoma, eye and orbital cancer, female genital tract cancer, focal nodular hyperplasia, gallbladder cancer, gastric vestibular cancer, gastric fundus cancer, gastrinoma, glioblastoma, glucagonoma, cardiac cancer, hemangioblastoma, hemangioendothelioma, hemangioma, hepatic adenoma, hepatic adenomatosis, hepato-bile duct cancer, hepatocellular carcinoma, Hodgkin's disease, Ileal cancer, insulinoma, epithelial neoplasm, intraepithelial squamous neoplasm, intrahepatic cholangiocarcinoma, invasive squamous cell carcinoma, jejunal cancer, joint cancer, Kaposi's sarcoma, pelvic cancer, large cell carcinoma, colon cancer, leiomyosarcoma, malignant melanoma, lymphoma, male genital cancer, malignant mesothelioma, medulloblastoma, medulloepithelioma, meningeal cancer, mesothelial carcinoma, metastatic carcinoma, oral cancer, mucoepidermoid carcinoma, multiple myeloma, muscle cancer, nasal passage cancer, nervous system cancer, neuroepithelial adenocarcinoma, nodular melanoma, nonepithelial skin cancer, non-Hodgkin's lymphoma, oat cell carcinoma, oligodendroglial carcinoma, oral cancer, osteosarcoma, papillary serous gland cancer, penile cancer, pharyngeal cancer, pituitary tumor, plasmacytoma, pseudosarcoma, pulmonary blastoma, rectal cancer, renal cell carcinoma, respiratory system cancer, retinoblastoma, rhabdomyosarcoma, sarcoma, serous carcinoma, sinonasal cancer, skin cancer, small cell carcinoma, small intestine cancer, smooth muscle carcinoma, soft tissue cancer, somatostatin-secreting tumor, spinal cancer, squamous cell carcinoma, submesothelial carcinoma, spreading melanoma, T-cell leukemia, tongue cancer, undifferentiated carcinoma, ureteral cancer, urethral cancer, bladder cancer, urinary system cancer, cervical cancer, uterine cancer, uveal melanoma, vaginal cancer, verrucous carcinoma, VIP-secreting tumor, vulvar cancer, well-differentiated carcinoma, or Wilms' tumor.

[0288] The cancer to be treated can be characterized by the presence of specific antigens expressed on the surface of cancer cells.Cancers characterized by the expression of CEACAM5 include, but are not limited to, medullary thyroid carcinoma (MTC), non-medullary thyroid carcinoma (non-MTC), gastric cancer, colorectal cancer, hepatocellular carcinoma, lung cancer, pancreatic cancer, breast cancer, and ovarian cancer.In certain embodiments, the cancer cells can express one or more of CEACAM1, CEACAM3, CEACAM6, and CEACAM8. In certain embodiments, the cancer cells can express, in addition to CEACAM5, one or more of CD2, CD19, CD20, CD30, CD38, CD40, CD52, CD70, EGFR / ERBB1, IGF1R, HER3 / ERBB3, HER4 / ERBB4, MUC1, TROP2, cMET, SLAMF7, PSCA, MICA, MICB, TRAILR1, TRAILR2, MAGE-A3, B7.1, B7.2, CTLA4, and PD1.

[0289] It is believed that the proteins, conjugates, cells, and / or pharmaceutical compositions disclosed herein can be used to treat various cancers, not limited to cancers in which cancer cells express CEACAM5. For example, in certain embodiments, the proteins, conjugates, cells, and / or pharmaceutical compositions disclosed herein can be used to treat cancers associated with CEACAM5-expressing cells. CEACAM5 is overexpressed in a high percentage of human cancers. Thus, the methods disclosed herein can be used to treat various cancers in which CEACAM5 is expressed.

[0290] IV. Combination Therapy Another aspect of the invention provides combination therapy: the multispecific binding proteins described herein can be used in combination with additional therapeutic agents to treat autoimmune diseases or to treat cancer.

[0291] Exemplary therapeutic agents that may be used as part of a combination therapy in the treatment of autoimmune inflammatory diseases are described in Li et al. (2017), Front. Pharmacol., 8:460, and include, for example, nonsteroidal anti-inflammatory drugs (NSAIDs) (e.g., COX-2 inhibitors), glucocorticoids (e.g., prednisone / prednisolone, methylprednisolone, and fluorinated glucocorticoids such as dexamethasone and betamethasone), disease-modifying antirheumatic drugs (DMARDs) (e.g., methotrexate, leflunomide, gold compounds, sulfasalazine, azathioprine, cyclosporine, cyclopentasiloxane ... These include anti-cancer drugs such as phosphamides, antimalarials, D-penicillamine, and cyclosporine, anti-TNF biologics (e.g., infliximab, etanercept, adalimumab, golimumab, certolizumab pegol, and their biosimilars), and other biologics that target CTLA-4 (e.g., abatacept), IL-6 receptor (e.g., tocilizumab), IL-1 (e.g., anakinra), Th1 immune responses (IL-12 / IL-23) (e.g., ustekinumab), Th17 immune responses (IL-17) (e.g., secukinumab), and CD20 (e.g., rituximab).

[0292] Exemplary therapeutic agents that may be used as part of a combination therapy in the treatment of cancer include, for example, radiation, mitomycin, tretinoin, ribomustine, gemcitabine, vincristine, etoposide, cladribine, mitobronitol, methotrexate, doxorubicin, carboquone, pentostatin, nitracrine, zinostatin, cetrorelix, letrozole, raltitrexed, daunorubicin, fadrozole, fotemustine, thymalfasin, sobuzoxane, nedaplatin, cytarabine, bicalutamide, vinorelbine, vesnarinone, aminoglutethimide, amsacrine, proglumide, elliptinib acetate, ketanserin, doxifluridine, etretinate, isotretinoin, streptozocin, nimustine, vindesine, fluoxet ... and thamide, drogenil, butosin, carmofur, razoxane, sizofiran, carboplatin, mitolactol, tegafur, ifosfamide, prednimustine, picibanil, levamisole, teniposide, iprosulfan, enocitabine, lisuride, oxymetholone, tamoxifen, progesterone, mepitiostane, epitiostanol, formestane, interferon-alpha, interferon-2 alpha, interferon-beta, interferon-gamma (IFN-γ), colony-stimulating factor-1, colony-stimulating factor-2, denileukin diftitox, interleukin-2, luteinizing hormone-releasing factor and variants of the foregoing that may exhibit differential binding to their cognate receptors or increased or decreased serum half-lives.

[0293] A further class of drugs that can be used as part of a combination therapy in the treatment of cancer are immune checkpoint inhibitors. Exemplary immune checkpoint inhibitors include agents that inhibit one or more of: (i) cytotoxic T-lymphocyte-associated antigen 4 (CTLA4), (ii) programmed cell death protein 1 (PD1), (iii) PDL1, (iv) LAG3, (v) B7-H3, (vi) B7-H4, and (vii) TIM3. The CTLA4 inhibitor ipilimumab has been approved by the U.S. Food and Drug Administration for the treatment of melanoma. In certain embodiments, the inhibitor can be an antibody, antigen-binding fragment, immunoadhesin, fusion protein, or oligopeptide. In some embodiments, the checkpoint inhibitor is a PD1 inhibitor selected from the group consisting of an anti-PD1 antibody or an anti-PDL1 antibody. In some embodiments, the PD1 inhibitor is selected from nivolumab (OPDIVO, Bristol Myers Squibb, New York, NY), pembrolizumab (KEYTRUDA, Merck Sharp & Dohme Corp, Kenilworth, NJ USA), setiplimab (Regeneron, Tarrytown, NY), or pidilizumab (CT-011). In some embodiments, the PD1 inhibitor is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD1-binding portion of PDL1 or PDL2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence). In some embodiments, the PD1 inhibitor is AMP-224. In some embodiments, the PDL1 inhibitor is an anti-PDL1 antibody such as durvalumab (IMFINZI, Astrazeneca, Wilmington, DE), atezolizumab (TECENTRIQ, Roche, Zurich, CH), or avelumab (BAVENCIO, EMD Serono, Billerica, MA). In some embodiments, the PDL1 inhibitor is selected from YW243.55.S70, MPDL3280A, MEDI-4736, MSB-0010718C, or MDX-1105.

[0294] Still other agents that may be used as part of a combination therapy in the treatment of cancer are monoclonal antibody agents that target non-checkpoint targets (e.g., Herceptin) and non-cytotoxic agents (e.g., tyrosine kinase inhibitors).

[0295] Further categories of anti-cancer drugs include, for example: (i) ALK inhibitors, ATR inhibitors, A2A antagonists, base excision repair inhibitors, Bcr-Abl tyrosine kinase inhibitors, Bruton's tyrosine kinase inhibitors, CDC7 inhibitors, CHK1 inhibitors, cyclin-dependent kinase inhibitors, DNA-PK inhibitors, inhibitors of both DNA-PK and mTOR, DNMT1 inhibitors, DNMT1 inhibitors + 2-chloro-deoxyadenosine, HDAC inhibitors, hedgehog signaling pathway inhibitors, IDO inhibitors, JAK inhibitors, mTOR inhibitors, MEK inhibitors, MELK inhibitors, MTH1 inhibitors, PARP inhibitors, phosphoinositide 3-kinase inhibitors, inhibitors of both PARP1 and DHODH, proteasome inhibitors, topoisomerase II inhibitors, tyrosine kinase inhibitors, VEGFR inhibitors, and WEE1 inhibitors; (ii) agonists of OX40, CD137, CD40, GITR, CD27, HVEM, TNFRSF25, or ICOS; and (iii) cytokines selected from the group consisting of IL-12, IL-15, GM-CSF, and G-CSF.

[0296] The proteins of the present invention can also be used as an adjunct to surgical removal of the primary lesion.

[0297] The amounts and relative timing of administration of the multispecific binding protein and additional therapeutic agent(s) can be selected to achieve a desired combined therapeutic effect. For example, when administering a combination therapy to a patient in need of such administration, the therapeutic agents in the combination, or pharmaceutical compositions or compositions comprising the therapeutic agents, can be administered in any order, e.g., sequentially, in parallel, together, simultaneously, etc. Further, for example, the multispecific binding protein can be administered during the period in which the additional therapeutic agent(s) exert their prophylactic or therapeutic effect, or vice versa.

[0298] V. Pharmaceutical Compositions The present disclosure also features pharmaceutical compositions containing a therapeutically effective amount of a protein described herein. The compositions can be formulated for use in a variety of drug delivery systems. For proper formulation, one or more physiologically acceptable excipients or carriers can also be included in the composition. Suitable formulations for use in the present disclosure can be found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, Pa., 17th ed., 1985. For a brief review of methods for drug delivery, see, e.g., Langer (Science 249:1527-1533, 1990).

[0299] The intravenous drug delivery formulation of the present disclosure may be contained in a bag, pen, or syringe. In certain embodiments, the bag may be connected to a channel containing tubing and / or a needle. In certain embodiments, the formulation may be a lyophilized formulation or a liquid formulation. In certain embodiments, the formulation may be freeze-dried (lyophilized). In certain embodiments, the formulation may be a liquid formulation.

[0300] The protein may be present in a liquid, aqueous pharmaceutical formulation comprising a therapeutically effective amount of the protein in a buffer solution that forms the formulation.

[0301] These compositions may be sterilized by conventional sterilization techniques or may be sterile filtered. The resulting aqueous solutions may be packaged for immediate use or lyophilized, with the lyophilized preparation being combined with a sterile aqueous carrier prior to administration. The pH of the preparation is typically 3 to 11, more preferably 5 to 9 or 6 to 8, and most preferably 7 to 8, e.g., 7 to 7.5. The resulting solid form compositions may be packaged in a plurality of single-dose units, each containing a fixed amount of one or more of the above-mentioned agents. The solid form compositions may also be packaged in flexible-volume containers.

[0302] In certain embodiments, the present disclosure provides formulations having an extended shelf life comprising a protein of the present disclosure in combination with mannitol, citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, sodium dihydrogen phosphate dihydrate, sodium chloride, polysorbate 80, water, and sodium hydroxide.

[0303] In certain embodiments, aqueous formulations are prepared comprising a protein of the present disclosure in a pH buffered solution. The buffers of the present invention may have a pH ranging from about 4 to about 8, e.g., from about 4.5 to about 6.0, or from about 4.8 to about 5.5, or may have a pH ranging from about 5.0 to about 5.2. Intermediate pH ranges within the above-listed ranges are also intended to be part of the present disclosure. For example, ranges of values ​​using any combination of the above-listed values ​​as upper and / or lower limits are intended to be included. Examples of buffers that control the pH within this range include acetate (e.g., sodium acetate), succinate (e.g., sodium succinate), gluconate, histidine, citrate, and other organic acid buffers.

[0304] In certain embodiments, the formulation includes a buffer system containing citrate and phosphate to maintain a pH in the range of about 4 to about 8. In certain embodiments, the pH range can be about 4.5 to about 6.0, or about pH 4.8 to about 5.5, or about pH 5.0 to about 5.2. In certain embodiments, the buffer system includes citric acid monohydrate, sodium citrate, disodium phosphate dihydrate, and / or sodium dihydrogen phosphate dihydrate. In certain embodiments, the pH of the formulation is adjusted with sodium hydroxide.

[0305] A polyol can also be included in the formulation, which can act as an isotonicity agent and stabilize the antibody. The polyol is added to the formulation in an amount that can vary depending on the desired isotonicity of the formulation. In certain embodiments, the aqueous formulation can be isotonic. The amount of polyol added can also be changed depending on the molecular weight of the polyol. For example, a smaller amount of monosaccharide (e.g., mannitol) can be added compared to a disaccharide (such as trehalose). In certain embodiments, the polyol that can be used in the formulation as an isotonicity agent is mannitol.

[0306] A detergent or surfactant may be added to the formulation. Exemplary detergents include non-ionic detergents such as polysorbates (e.g., polysorbate 20, 80, etc.) or poloxamers (e.g., poloxamer 188). The amount of surfactant added is such that it reduces aggregation of the formulated antibody and / or minimizes the formation of particulates in the formulation and / or reduces adsorption. In certain embodiments, the formulation may include a surfactant that is a polysorbate. In certain embodiments, the formulation may contain the detergent polysorbate 80 or Tween 80. Tween 80 is a term used to describe polyoxyethylene (20) sorbitan monooleate (see Fiedler, Lexikon der Hifsstoffe, Editio Cantor Verlag Aulendorf, 4th ed., 1996).

[0307] In embodiments, the protein products of the present disclosure are formulated as liquid formulations. The liquid formulations may be provided in either USP / Ph Eur Type I50R vials closed with rubber stoppers and sealed with aluminum crimp seal closures. The stoppers may be made of elastomers that comply with USP and Ph Eur. In certain embodiments, the vials can be filled with a protein product solution to allow for an extractable volume. In certain embodiments, the liquid formulations can be diluted with saline.

[0308] In certain embodiments, the liquid formulations of the present disclosure may be prepared in combination with a stabilizing level of sugar. In certain embodiments, the liquid formulations may be prepared in an aqueous carrier. In certain embodiments, the stabilizer may be added in an amount less than that which may cause undesirable or inappropriate viscosity for intravenous administration. In certain embodiments, the sugar may be a disaccharide, such as sucrose. In certain embodiments, the liquid formulation may also include one or more of a buffer, a surfactant, and a preservative.

[0309] In certain embodiments, the pH of the liquid formulation may be set by the addition of a pharmaceutically acceptable acid and / or base. In certain embodiments, the pharmaceutically acceptable acid may be hydrochloric acid. In certain embodiments, the base may be sodium hydroxide.

[0310] In addition to aggregation, deamidation is a common product variant of peptides and proteins that can occur during fermentation, harvest / cell clarification, purification, drug substance / drug product storage, and sample analysis. Deamidation is the loss of NH3 from proteins to form a succinimide intermediate that can undergo hydrolysis. The succinimide intermediate results in a 17-dalton mass loss from the parent peptide. Subsequent hydrolysis results in an 18-dalton mass gain. Isolation of the succinimide intermediate is difficult due to its instability under aqueous conditions. Therefore, deamidation is typically detectable as a 1-dalton mass gain. Deamidation of asparagine leads to either aspartic acid or isoaspartic acid. Parameters that affect the rate of deamidation include pH, temperature, solvent dielectric constant, ionic strength, primary sequence, local polypeptide conformation, and tertiary structure. The amino acid residue adjacent to Asn in the peptide chain influences the rate of deamidation. Gly and Ser following Asn in the protein sequence are more susceptible to deamidation.

[0311] In certain embodiments, the liquid formulations of the present disclosure may be stored under conditions of pH and humidity to prevent deamination of the protein product.

[0312] Aqueous carriers of interest herein are those that are pharmaceutically acceptable (safe and non-toxic for administration to humans) and useful for preparing liquid formulations. Exemplary carriers include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffer (e.g., phosphate-buffered saline), sterile saline, Ringer's solution, or dextrose solution.

[0313] Preservatives may be added to the formulations herein to reduce bacterial action. The addition of a preservative may, for example, facilitate the production of multi-use (multiple dose) formulations.

[0314] An intravenous (IV) formulation may be the preferred route of administration in certain cases, such as when a patient is hospitalized after transplant and receives all medications via the IV route. In certain embodiments, the liquid formulation is diluted with 0.9% sodium chloride solution prior to administration. In certain embodiments, the injectable diluted formulation is isotonic and suitable for administration by intravenous infusion.

[0315] In certain embodiments, salts or buffer components may be added in amounts of 10 mM to 200 mM. Salts and / or buffering agents are pharmaceutically acceptable and are derived from a variety of known acids (inorganic and organic) with "base-forming" metals or amines. In certain embodiments, the buffering agent may be a phosphate buffer. In certain embodiments, the buffering agent may be a glycinate, carbonate, or citrate buffer, in which case sodium, potassium, or ammonium ions may serve as counterions.

[0316] Preservatives may be added to the formulations herein to reduce bacterial action. The addition of a preservative may, for example, facilitate the production of multi-use (multiple dose) formulations.

[0317] Aqueous carriers of interest herein are those that are pharmaceutically acceptable (safe and non-toxic for administration to humans) and useful for preparing liquid formulations. Exemplary carriers include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), a pH buffer (e.g., phosphate-buffered saline), sterile saline, Ringer's solution, or dextrose solution.

[0318] The protein of the present disclosure may be present in a lyophilized formulation comprising the protein and a cryoprotectant. The cryoprotectant may be a sugar, such as a disaccharide. In certain embodiments, the cryoprotectant may be sucrose or maltose. The lyophilized formulation may also include one or more of a buffer, a surfactant, a bulking agent, and / or a preservative.

[0319] The amount of sucrose or maltose useful for stabilizing the lyophilized formulation can be a weight ratio of protein to sucrose or maltose of at least 1:2, in certain embodiments, the weight ratio of protein to sucrose or maltose can be between 1:2 and 1:5.

[0320] In certain embodiments, the pH of the formulation may be established prior to lyophilization by the addition of a pharmaceutically acceptable acid and / or base. In certain embodiments, the pharmaceutically acceptable acid may be hydrochloric acid. In certain embodiments, the pharmaceutically acceptable base may be sodium hydroxide.

[0321] Prior to lyophilization, the pH of the solution containing the protein of the present disclosure can be adjusted to between 6 and 8. In certain embodiments, the pH range of the lyophilized formulation can be between 7 and 8.

[0322] In certain embodiments, salts or buffer components may be added in amounts of 10 mM to 200 mM. Salts and / or buffering agents are pharmaceutically acceptable and are derived from a variety of known acids (inorganic and organic) with "base-forming" metals or amines. In certain embodiments, the buffering agent may be a phosphate buffer. In certain embodiments, the buffering agent may be a glycinate, carbonate, or citrate buffer, in which case sodium, potassium, or ammonium ions may serve as counterions.

[0323] In certain embodiments, a "bulking agent" can be added. A "bulking agent" is a compound that adds mass to the lyophilization mixture and contributes to the physical structure of the lyophilized cake (e.g., facilitating the production of an essentially uniform lyophilized cake that maintains an open pore structure). Exemplary bulking agents include mannitol, glycine, polyethylene glycol, and sorbitol. The lyophilized formulation of the present invention may contain such a bulking agent.

[0324] Preservatives may be added to the formulations herein to reduce bacterial action. The addition of a preservative may, for example, facilitate the production of multi-use (multiple dose) formulations.

[0325] In certain embodiments, the lyophilized formulation may be comprised of an aqueous carrier. Aqueous carriers of interest herein are those that are pharmaceutically acceptable (e.g., safe and non-toxic for human administration) and useful for preparing a liquid formulation after lyophilization. Exemplary diluents include sterile water for injection (SWFI), bacteriostatic water for injection (BWFI), pH buffer (e.g., phosphate-buffered saline), sterile saline, Ringer's solution, or dextrose solution.

[0326] In certain embodiments, the lyophilized formulations of the present disclosure are reconstituted with either Sterile Water for Injection, USP (SWFI) or 0.9% Sodium Chloride Injection, USP. During reconstitution, the lyophilized powder goes into solution.

[0327] In certain embodiments, the lyophilized protein product of the present disclosure is reconstituted with water for injection and diluted with 0.9% saline (sodium chloride solution).

[0328] Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied to obtain an amount of the active ingredient that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration without being toxic to the patient.

[0329] A specific dose may be a uniform dose for each patient, e.g., 50-5000 mg of protein. Alternatively, a patient's dose can be adjusted to the patient's approximate body weight or surface area. Other factors in determining the appropriate dosage may include the disease or condition being treated or prevented, the severity of the disease, the route of administration, and the patient's age, sex, and medical condition. Further refinement of the calculations necessary to determine the appropriate dosage for treatment is routinely performed by those of skill in the art, particularly in light of the dosage information and assays disclosed herein. Dosages can also be determined by the use of known assays for determining dosages used in conjunction with appropriate dose-response data. Dosages for individual patients may be adjusted as disease progression is monitored. Blood levels of the targetable construct or complex in the patient can be measured to determine whether the dosage needs to be adjusted to reach or maintain an effective concentration. Pharmacogenomics can be used to determine which targetable constructs and / or complexes, and their dosages, are likely to be most effective for a given individual (Schmitz et al., Clinica Chimica Acta 308:43-53, 2001; Steimer et al., Clinica Chimica Acta 308:33-41, 2001).

[0330] Doses may be given once or more times daily, weekly, monthly, or yearly, or even once every 2 to 20 years. One skilled in the art can readily estimate repetition rates for administration based on measured residence times and concentrations of the targetable construct or complex in bodily fluids or tissues. Administration of the present invention may be intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, intrapleural, intrathecal, intracavity, by catheter perfusion, or direct intralesional injection. It may be administered once or more times daily, weekly, monthly, or yearly.

[0331] The above description describes several aspects and embodiments of the present invention. This patent application specifically contemplates all combinations and permutations of aspects and embodiments.

[0332] [Example] The invention having now been generally described will be more readily understood by reference to the following examples, which are included solely for the purpose of illustrating certain aspects and embodiments of the invention and are not intended to be limiting of the invention.

[0333] [Example 1] Immunization and production of hybridomas BALB / cJ mice were purchased from The Jackson Laboratory (stock number 000651) and immunized with either the isogenic Ba / F3 cell line overexpressing cynomolgus monkey and / or human CEACAM5; hCEACAM5-A3B3 domain; recombinant cynomolgus monkey and / or human CEACAM5; or a human NABA construct (a NABA consisting of the N, A1, and A2 domains of human CEACAM1 and the B3 domain of human CEACAM5). These mice were used to generate mouse mAbs (monoclonal antibodies). H2L2™ mice were purchased from Harbour Biomed and immunized with either the isogenic Ba / F3 cell line overexpressing cynomolgus monkey and / or human CEACAM5; the hCEACAM5-A3B3 domain; recombinant cynomolgus monkey and / or human CEACAM5; or a human NABA construct (a NABA consisting of the N, A1, and A2 domains of human CEACAM1 and the B3 domain of human CEACAM5). These mice were used to produce human / rat chimeric mAbs with human variable regions and rat constant regions. Subsequently, spleen cells from the immunized mice were fused with mouse myeloma cells to generate hybridoma cells.

[0334] The fused hybridoma cells were cultured in supplemented DMEM culture medium in a humidified atmosphere containing 8% CO at 37°C. Hybridoma supernatants were evaluated for CEACAM5, CEACAM1, CEACAM6, and CEACAM8 binding by enzyme-linked immunosorbent assay (ELISA) and multiplexed surface plasmon resonance (SPR) (Carterra LSA). CEACAM5 antigen-specific hybridomas were then subcloned. Clones for further study were selected for preliminary multiplexed SPR (Carterra) binding affinity estimation, binding to cells expressing human and cynomolgus monkey CEACAM5, and CEACAM5 binding. + The clone was selected based on its binding to cancer cell lines and epitope diversity. Cross-reactivity with cynomolgus monkey CEACAM5 was observed for clone 16F6.A2-CEACAM5-B.02.

[0335] Balb / cJ mouse mAb was purified from hybridoma supernatant by Protein A chromatography using AmMag™ Protein A magnetic beads (P / NL00695, Genscript Biotech, Piscataway, NJ). The beads were equilibrated with 1.5 M glycine, 3.0 M NaCl, pH 8.5. The supernatant was diluted 1:1 with 1.5 M glycine, 3.0 M NaCl, pH 8.5 and incubated with ProA magnetic beads for 1 hour with gentle rocking. The beads were washed with 1.5 M glycine, 3.0 M NaCl, pH 8.5 to remove unbound protein. The antibody was eluted with 100 mM glycine, pH 3.0, and immediately neutralized to pH 7.5 with 1.0 M Tris, pH 8.3. Protein concentration was determined by A280 using a Nanodrop spectrophotometer. The human (variable region) / rat (constant region) mAb derived from H2L2 was purified from hybridoma supernatant by Protein G chromatography (Global Life Sciences Solutions, Marlborough, MA). The Protein G column was equilibrated with 50 mM sodium acetate, pH 5.0 + 10 mM NaCl. The supernatant was diluted 10-fold with 50 mM sodium acetate, pH 5.0 + 10 mM NaCl and equilibrated Protein G medium for 1 hour with gentle rocking. The beads were washed with 50 mM sodium acetate, pH 5.0 + 10 mM NaCl to remove unbound protein. The antibody was eluted with 100 mM glycine pH 2.5 and immediately neutralized to pH 7.5 with 1.0 M Tris, pH 8.3. After purification, the protein concentration was determined by A280 using a Nanodrop spectrophotometer. Similarly, a human / rat chimeric mAb (with human variable regions and rat constant regions) derived from H2L2 was purified from hybridoma supernatant by protein G chromatography (Global LifeSciences Solutions, Marlborough, MA), and the protein concentration was determined by A280 using a Nanodrop spectrophotometer.

[0336] Balb / cJ mouse mAbs were tested for cell surface binding to CEACAM5 and cross-reactivity with CEACAM1, CEACAM6, and CEACAM8. Additionally, Balb / cJ mouse mAbs were tested for in vitro binding to CEACAM1, CEACAM5, CEACAM6, and CEACAM8 using surface plasmon resonance (SPR). Experiments were performed at 37°C to mimic physiological temperature using either a Carterra LSA or Biacore8K instrument.

[0337] The H2L2-derived human / rat chimeric mAb was tested for cell surface binding to CEACAM5 and cross-reactivity with CEACAM1, CEACAM6, and CEACAM8. Additionally, the H2L2-derived human / rat chimeric mAb was tested for in vitro binding to CEACAM5, CEACAM1, CEACAM6, and CEACAM8 using surface plasmon resonance (SPR). Experiments were performed at 37°C to mimic physiological temperature using either a Carterra LSA or Biacore8K instrument.

[0338] [Example 2] Generation of binders using yeast display technology Additional CEACAM5 binders were generated using yeast display technology by constructing an H2L2 immune library. Briefly, yeast were transfected with starter constructs containing the parental CEACAM5 VH and / or VL sequences. Novel clones were selected, and binders were isolated and characterized as described above.

[0339] Yeast strains and plasmids The auxotrophic Saccharomyces cerevisiae strain EBY100 (Meyenex E.C. Hansen (ATCC® MYA-4941™)) with leucine and tryptophan selection markers was used for the construction of the scFv yeast display library. EBY100 has a genomic insertion of AGA1 for surface display, and its expression is regulated by a galactose promoter with a uracil selection marker. Each scFv also contains a carboxy-terminal Flag tag that is also controlled by the galactose promoter.

[0340] Construction of a CEACAM5 immune scFv yeast display library After immunization, mouse splenocytes were harvested, RNA was extracted using a high-purity RNA isolation kit (Roche, product number 11828665001), and RT-PCR was performed to generate a cDNA library (Invitrogen, product number 18090010) according to the manufacturer's instructions. The cDNA was used as a template for amplification of variable heavy (VH) and light (VL; kappa only) antibody genes, which were then assembled into a single-chain antibody fragment (scFv) library in both orientations (VH-VL or VL-VH scFv). After transformation (electroporation) and homologous recombination, the scFv library was incorporated into a yeast surface display vector.

[0341] Isolation of CEACAM5-specific scFv binders from a library After electroporation, yeast cells were grown in selective medium (Teknova product number C8240). The scFv library was then induced to display scFvs on the yeast cell surface by switching to galactose medium. Isolation of CEACAM5-specific binders was achieved through three rounds of selection. First, the library was screened with human CEACAM5 hits using magnetic-activated cell sorting (MACS), followed by two rounds of selection by fluorescence-activated cell sorting (FACS) to obtain a panel of CEACAM5-specific scFvs. Individual scFv clones were characterized for CEACAM5-binding affinity and specificity while displayed on yeast and then transferred into vectors for expression in mammalian cells using molecular biology techniques known in the art.

[0342] [Example 3] Humanization and creation of variants for sequence reliability The Balb / cJ hybridoma mAb was humanized. Humanized variants were generated by grafting murine CDRs into human framework regions. The following clones were humanized: murine 1A1.A3-CEACAM5-B.02 and murine 16F6.A2-CEACAM5-B.02. Their sequences and those of their humanized variants are shown in Table 4. The murine VH and VL sequences of clone 16F6.A2-CEACAM5-B.02 were blasted against a human sequence database to identify suitable frameworks for hosting the CDRs. IGHV1-2*02 (sequence identity: 66.3%) and IGKV4-1*01 (sequence identity: 80.2%) were selected for advancement. Structural models were constructed to examine and identify potential back mutations. After grafting the hypervariable regions from the mouse counterpart onto the above human framework, the following back mutations were introduced into the variable heavy chain (VH): V67T, M69L, R71A, S76P, and A93T (all Chothia numbering). No back mutations were introduced into the variable light chain (VL).

[0343] The mouse VH and VL sequences of clone 1A1.A3 were blasted against a human sequence database to identify suitable frameworks for hosting the CDRs. IGHV1-69-2*01 (sequence identity: 63.5%) and IGKV3-11*01 (sequence identity: 64.2%) were selected for advancement. Structural models were constructed to examine and identify potential backmutations. After grafting the hypervariable regions from the mouse counterpart into the above human framework, the following backmutations were introduced in the VH: V5Q, K12V, I20L, V24A, Q38T, M48I, V67A, I69M, M80L, A93N, and T94V (all according to Chothia numbering). The following backmutations were also introduced in the VL: L13A, Y36F, L47W, I58V, and F71Y.

[0344] The clones were examined for potential sequence fidelity. The following potential sequence fidelity motifs were considered: M (potential oxidation site); NG, NS, and NT sequence motifs (potential deamidation sites); DG, DS, and DT sequence motifs (potential isomerization sites); and DP sequence motif (potential site for chemical hydrolysis). Variants of these antibodies were designed to remove putative sequence fidelity motifs, and the sequences of such variants are shown in Table 4.

[0345] [Example 4] Classification of monoclonal antibodies The mAbs were classified by tier (Tier 1, 2, 3) as shown in Tables 3 and 4. mAbs classified as "Tier 1" were CEACAM5-specific high-affinity mAbs with KD values ​​of approximately 15 nM or less (e.g., KD range of approximately 4 nM to approximately 15 nM). mAbs classified as Tier 2 were CEACAM5-specific medium- and low-affinity mAbs with KD values ​​ranging from approximately 25 nM to approximately 80 nM (for medium affinity) and approximately 120 nM to approximately 560 nM (for low affinity). mAbs classified as "Tier 3" were mAbs that, in addition to binding to CEACAM5, also showed low levels of cross-reactivity with CEACAM1, CEACAM6, and CEACAM8. For classification, the mAbs produced by the method of Example 1 were evaluated in a mAb format, and the mAbs produced by the method of Example 2 were evaluated in a multispecific antibody format comprising an scFv that binds to CEACAM5 and a Fab fragment that binds to a different antigen.

[0346] The clones in each tier are listed in Table 13 below. The VH, VL, and CDR sequences of these clones are shown in Table 4.

[0347] [Table 13]

[0348] [Example 5] NKG2D-binding domain binds to NKG2D Binding affinities of various NKG2D-binding domains The kinetics and affinity of various NKG2D binding domains were evaluated by surface plasmon resonance using a Biacore 8K instrument (GE Healthcare). Anti-human Fc antibodies were immobilized on a CM5 chip using standard amine coupling chemistry. Human monoclonal antibodies containing various NKG2D binding domains were captured on the anti-human Fc chip at a density of approximately 100 RU. Solutions containing 0.411 nM to 100 nM soluble mouse Fc-human NKG2D dimers were injected over the captured NKG2D antibody and control surfaces at 30 μl / min at 37°C. The surfaces were regenerated between cycles by rapid injection of 10 mM glycine (pH 1.8). To obtain kinetic rate constants, the double-referenced data were fitted to a 1:1 interaction model using Biacore 8K Evaluation software (GE Healthcare). The equilibrium binding constant, K D is the dissociation constant k d and the association constant k a The ratio (k d / k a ) As shown in Table 14 below, the binding affinity of the NKG2D-binding domain to NKG2D is in the range of 10 nM to 62 nM.

[0349] [Table 14]

[0350] The NKG2D-binding domain binds to purified recombinant NKG2D. The nucleic acid sequence of the human, mouse, or cynomolgus monkey NKG2D ectodomain was fused to a nucleic acid sequence encoding a human IgG1 Fc domain and expressed in mammalian cells. After purification, the NKG2D-Fc fusion protein was adsorbed to microplate wells. After blocking the wells with bovine serum albumin to prevent nonspecific binding, titrated NKG2D-binding domains were added to the wells pre-adsorbed with the NKG2D-Fc fusion protein. Primary antibody binding was detected using a secondary antibody conjugated to horseradish peroxidase that specifically recognizes the human kappa light chain to avoid Fc cross-reactivity. Binding signals were visualized by adding the horseradish peroxidase substrate 3,3',5,5'-tetramethylbenzidine (TMB) to the wells, and the absorbance was measured at 450 nM and corrected at 540 nM. NKG2D-binding domain clones, isotype controls, or positive controls (comprising heavy and light chain variable domains selected from the group consisting of SEQ ID NOs: 526-529, or anti-mouse NKG2D clones MI-6 and CX-5 available from eBioscience) were added to each well.

[0351] The isotype control showed minimal binding to recombinant NKG2D-Fc protein, while the positive control bound most strongly to the recombinant antigen. The NKG2D-binding domains produced by all clones showed binding across human, mouse, and cynomolgus monkey recombinant NKG2D-Fc proteins, although the affinity varied among clones. In general, each anti-NKG2D clone bound with similar affinity to human (Figure 18) and cynomolgus monkey (Figure 19) recombinant NKG2D-Fc, but with lower affinity to mouse (Figure 20) recombinant NKG2D-Fc.

[0352] The NKG2D-binding domain binds to cells expressing NKG2D. The EL4 mouse lymphoma cell line was engineered to express human or mouse NKG2D-CD3 zeta signaling domain chimeric antigen receptors. NKG2D-binding clones, isotype controls, or positive controls were used at 100 nM concentrations to stain extracellular NKG2D expressed on EL4 cells. Antibody binding was detected using a fluorophore-conjugated anti-human IgG secondary antibody. Cells were analyzed by flow cytometry, and fold over background (FOB) was calculated using the mean fluorescence intensity (MFI) of NKG2D-expressing cells compared to parental EL4 cells.

[0353] NKG2D-binding domains produced by all clones bound to EL4 cells expressing human and mouse NKG2D. A positive control antibody (comprising heavy and light chain variable domains selected from the group consisting of SEQ ID NOs: 526-529, or anti-mouse NKG2D clones MI-6 and CX-5, available at eBioscience) gave the best FOB binding signal. NKG2D binding affinity for each clone was similar between cells expressing human NKG2D (Figure 21) and cells expressing mouse NKG2D (Figure 22).

[0354] Example 6: NKG2D-binding domain blocks natural ligand binding to NKG2D Competition with ULBP-6 Recombinant human NKG2D-Fc protein was adsorbed to microplate wells, which were then blocked with bovine serum albumin to reduce nonspecific binding. A saturating concentration of ULBP-6-His-biotin was added to the wells, followed by the addition of the NKG2D-binding domain clone. After a 2-hour incubation, the wells were washed, and ULBP-6-His-biotin remaining bound to the NKG2D-Fc-coated wells was detected with streptavidin conjugated to horseradish peroxidase and TMB substrate. Absorbance was measured at 450 nM and corrected to 540 nM. After background subtraction, specific binding of the NKG2D-binding domain to the NKG2D-Fc protein was calculated from the percentage of ULBP-6-His-biotin blocked from binding to the NKG2D-Fc protein in the wells. A positive control antibody (comprising a heavy chain variable domain and a light chain variable domain selected from the group consisting of SEQ ID NOs: 526-529) and various NKG2D-binding domains blocked ULBP-6 binding to NKG2D, whereas the isotype control showed little competition with ULBP-6 (Figure 23).

[0355] The ULBP-6 sequence is represented by SEQ ID NO:566.

[0356] MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI (SEQ ID NO: 566)

[0357] Competition with MICA Recombinant human MICA-Fc protein was adsorbed to microplate wells, and the wells were blocked with bovine serum albumin to reduce nonspecific binding. NKG2D-Fc-biotin was added to the wells, followed by the NKG2D-binding domain. After incubation and washing, streptavidin-HRP and TMB substrate were used to detect NKG2D-Fc-biotin remaining bound to the MICA-Fc-coated wells. Absorbance was measured at 450 nM and corrected to 540 nM. After background subtraction, specific binding of the NKG2D-binding domain to the NKG2D-Fc protein was calculated from the percentage of NKG2D-Fc-biotin blocked from binding to the MICA-Fc-coated wells. A positive control antibody (comprising a heavy chain variable domain and a light chain variable domain selected from the group consisting of SEQ ID NOs: 526-529) and various NKG2D-binding domains blocked MICA binding to NKG2D, whereas an isotype control showed little competition with MICA (Figure 24).

[0358] Conflict with Rae-1 Delta Recombinant mouse Rae-1 delta-Fc (purchased from R&D Systems) was adsorbed to microplate wells, and the wells were blocked with bovine serum albumin to reduce nonspecific binding. Mouse NKG2D-Fc-biotin was added to the wells, followed by the NKG2D-binding domain. After incubation and washing, streptavidin-HRP and TMB substrate were used to detect NKG2D-Fc-biotin that remained bound to the Rae-1 delta-Fc-coated wells. Absorbance was measured at 450 nM and corrected to 540 nM. After background subtraction, specific binding of the NKG2D-binding domain to the NKG2D-Fc protein was calculated from the percentage of NKG2D-Fc-biotin blocked from binding to the Rae-1 delta-Fc-coated wells. A positive control (comprising heavy and light chain variable domains selected from the group consisting of SEQ ID NOs: 526-529, or anti-mouse NKG2D clones MI-6 and CX-5 available at eBioscience) and various NKG2D binding domain clones blocked Rae-1 delta binding to mouse NKG2D, whereas an isotype control antibody showed little competition with Rae-1 delta (Figure 25).

[0359] [Example 7] NKG2D-binding domain clones activate NKG2D The nucleic acid sequences of human and mouse NKG2D were fused to a nucleic acid sequence encoding the CD3 zeta signaling domain to obtain chimeric antigen receptor (CAR) constructs. The NKG2D-CAR constructs were then cloned into retroviral vectors using Gibson assembly and transfected into expi293 cells for retroviral production. EL4 cells were infected with a virus containing NKG2D-CAR together with 8 μg / mL polybrene. 24 hours after infection, the expression level of NKG2D-CAR in EL4 cells was analyzed by flow cytometry, and clones expressing high levels of NKG2D-CAR on the cell surface were selected.

[0360] To determine whether the NKG2D-binding domains activate NKG2D, they were adsorbed to microplate wells, and NKG2D-CAREL4 cells were cultured on the antibody fragment-coated wells for 4 hours in the presence of brefeldin-A and monensin. Intracellular TNF-α production, an indicator of NKG2D activation, was assayed by flow cytometry. The percentage of TNF-α-positive cells was normalized to cells treated with a positive control. All NKG2D-binding domains activated both human NKG2D (Figure 26) and mouse NKG2D (Figure 27).

[0361] [Example 8] NKG2D-binding domain activates NK cells Primary human NK cells Peripheral blood mononuclear cells (PBMCs) were isolated from human peripheral blood buffy coats using density gradient centrifugation. NK cells (CD3 - CD56 + ) were isolated from PBMCs using negative magnetic bead selection, and the purity of the isolated NK cells was typically >95%. The isolated NK cells were then cultured for 24–48 hours in medium containing 100 ng / mL IL-2, then transferred to wells of a microplate onto which the NKG2D binding domain had been adsorbed and cultured in medium containing a fluorophore-conjugated anti-CD107a antibody, brefeldin-A, and monensin. After culture, NK cells were assayed by flow cytometry using fluorophore-conjugated antibodies against CD3, CD56, and IFN-γ. CD107a and IFN-γ staining was compared with CD3. - CD56 + NK cell activation was assessed by analyzing CD107a / IFN-γ double positive cells. An increase in CD107a / IFN-γ double positive cells indicates better NK cell activation due to engagement of two activating receptors rather than one. The NKG2D binding domain and positive control (e.g., heavy chain variable domain represented by SEQ ID NO: 526 or SEQ ID NO: 528, light chain variable domain represented by SEQ ID NO: 527 or SEQ ID NO: 529) showed that a higher percentage of NK cells express CD107a than the isotype control. + and IFN-γ +(FIGS. 28 and 29 represent data from two independent experiments, each using PBMCs from a different donor for NK cell preparation).

[0362] Primary mouse NK cells Spleens were obtained from C57Bl / 6 mice and disrupted through a 70 μm cell strainer to obtain a single cell suspension. Cells were pelleted and resuspended in ACK lysis buffer (purchased from Thermo Fisher Scientific #A1049201; 155 mM ammonium chloride, 10 mM potassium bicarbonate, 0.01 mM EDTA) to remove red blood cells. The remaining cells were cultured with 100 ng / mL hIL-2 for 72 hours, then harvested and prepared for NK cell isolation. NK cells (CD3 - NK1.1 + ) were isolated from splenocytes using a negative depletion technique with magnetic beads, typically with a purity of >90%. Purified NK cells were cultured for 48 hours in medium containing 100 ng / mL mIL-15, then transferred to wells of a microplate adsorbed with NKG2D-binding domains and cultured in medium containing a fluorophore-conjugated anti-CD107a antibody, brefeldin-A, and monensin. After culture in the NKG2D-binding domain-coated wells, NK cells were assayed by flow cytometry using fluorophore-conjugated antibodies against CD3, NK1.1, and IFN-γ. CD107a and IFN-γ staining was compared with CD3. - NK1.1 + NK cell activation was assessed by analyzing CD107a / IFN-γ double-positive cells. An increase in CD107a / IFN-γ double-positive cells indicates better NK cell activation due to engagement of two activating receptors rather than one. The NKG2D binding domain and positive control (selected from the group consisting of anti-mouse NKG2D clones MI-6 and CX-5 available at eBioscience) showed that a higher percentage of NK cells express CD107a than the isotype control. + and IFN-γ + (FIGS. 30 and 31 show data from two independent experiments, each using a different mouse for NK cell preparation).

[0363] Example 9: NKG2D-binding domains enable cytotoxicity of target tumor cells Human and mouse primary NK cell activation assays demonstrated an increase in cytotoxicity markers on NK cells after incubation with the NKG2D-binding domain. To address whether this translates into increased tumor cell lysis, we utilized a cell-based assay in which each NKG2D-binding domain was developed into a monospecific antibody. The Fc region was used as one targeting arm, while the Fab fragment region (NKG2D-binding domain) acted as another targeting arm to activate NK cells. THP-1 cells, which are of human origin and express high levels of Fc receptors, were used as tumor targets using the Perkin Elmer DELFIA Cytotoxicity Kit. THP-1 cells were labeled with BATDA reagent and incubated at 10°C in culture medium. 5 The labeled THP-1 cells were then combined with NKG2D antibody and isolated mouse NK cells in wells of a microtiter plate for 3 hours at 37°C. After incubation, 20 μL of culture supernatant was removed, mixed with 200 μL of europium solution, and incubated with shaking in the dark for 15 minutes. Fluorescence was measured over time using a PheraStar plate reader equipped with a time-resolved fluorescence module (excitation 337 nm, emission 620 nm), and specific lysis was calculated according to the kit instructions.

[0364] The positive control, ULBP-6 (the natural ligand for NKG2D), showed increased specific lysis of THP-1 target cells by mouse NK cells. NKG2D antibodies also increased specific lysis of THP-1 target cells, whereas an isotype control antibody showed decreased specific lysis. The dotted line indicates specific lysis of THP-1 cells by mouse NK cells without added antibody (Figure 32).

[0365] [Example 10] NKG2D antibodies exhibit high thermal stability The melting temperature of the NKG2D-binding domain was assayed using differential scanning fluorimetry, and the extrapolated apparent melting temperature is higher compared to typical IgG1 antibodies (Figure 33).

[0366] [Example 11] Synergistic activation of human NK cells by cross-linking NKG2D and CD16 Primary human NK cell activation assay Peripheral blood mononuclear cells (PBMCs) were isolated from peripheral human blood buffy coats using density gradient centrifugation. NK cells were purified from PBMCs using negative magnetic beads (StemCell, #17955). NK cells were over 90% CD3+ as determined by flow cytometry. - CD56 + The cells were then grown in medium containing 100 ng / mL hIL-2 (Peprotech, #200-02) for 48 hours before being used in activation assays. Antibodies were coated onto 96-well flat-bottom plates at concentrations of 2 μg / mL (anti-CD16, Biolegend, #302013) and 5 μg / mL (anti-NKG2D, R&D #MAB139) in 100 μL of sterile PBS overnight at 4°C, followed by extensive washing of the wells to remove excess antibody. To assess degranulation, IL-2-activated NK cells were cultured at 5 × 10 in culture medium supplemented with 100 ng / mL human IL-2 (hIL2) and 1 μg / mL APC-conjugated anti-CD107a mAb (Biolegend #328619). 5 The cells were then resuspended at 1 x 10 cells / mL. 5 Cells / well were added to the antibody-coated plates. Protein transport inhibitors brefeldin A (BFA, Biolegend #420601) and monensin (Biolegend #420701) were added at final dilutions of 1:1000 and 1:270, respectively. Seeded cells were incubated at 37°C in 5% CO2 for 4 hours. For intracellular staining of IFN-γ, NK cells were labeled with anti-CD3 (Biolegend #300452) and anti-CD56 mAb (Biolegend #318328), then fixed, permeabilized, and labeled with anti-IFN-γ mAb (Biolegend #506507). NK cells were analyzed by live CD56 immunofluorescence. + CD3 - After gating on cells, they were analyzed for CD107a and IFN-γ expression by flow cytometry.

[0367] To examine the relative potency of receptor combinations, we performed crosslinking of NKG2D or CD16 and co-crosslinking of both receptors by plate-bound stimulation. As shown in Figure 34 (Figures 34A-34C), combined stimulation of CD16 and NKG2D resulted in highly elevated levels of CD107a (degranulation) (Figure 34A) and / or IFN-γ production (Figure 34B). The dotted lines represent the additive effect of individual stimulation of each receptor.

[0368] CD107a levels and intracellular IFN-γ production of IL-2-activated NK cells were analyzed 4 hours after plate-bound stimulation with anti-CD16, anti-NKG2D, or a combination of both monoclonal antibodies. Graphs show mean (n=2) ± SD. Figure 34A shows CD107a levels. Figure 34B shows IFN-γ levels. Figure 34C shows CD107a and IFN-γ levels. Data shown in Figures 34A-34C are representative of five independent experiments using five different healthy donors.

[0369] [Example 12] Preparation of CEACAM5 TriNKET-binding protein Generation of AB0264 and AB0621 scFv from AB0131 AB0131 is an scFv identified from the BALB / c immunization effort described in Example 1. AB0131 was derived from clone 16F6.A2-CEACAM5-B.02-BM. To generate humanized AB0264, five back mutations were introduced into the VH domain of AB0131, and two cysteines were introduced to stabilize the disulfide bond. The scFv polypeptide sequence of AB0264 is shown below as SEQ ID NO:703. Back mutations are identified in bold letters, and the introduced cysteines are identified in bold underlined letters.

[0370] TIFF2025527967000182.tif37152

[0371] The proline residue in the VH domain of AB0264 was found to occur at a frequency of less than 1% in the human framework. This residue, identified in bold italics, was substituted with serine (36% of human framework sequences; Abyss) to generate AB0621. The scFv polypeptide sequence of AB0621 is shown below as SEQ ID NO:714.

[0372] TIFF2025527967000183.tif36165

[0373] Generation of AB0411 scFv from AB0100 scFv ABO100 is a fully human scFv identified from interrogation of the H2L2 yeast immune library described in Example 2. ABO100 was derived from a variant of clone 1078_C04CEACAM5. The glutamine residue in the VH domain of ABO100 was found to be present in less than 1% of human frameworks. To generate AB0411, the glutamine residue was substituted with leucine (63% human framework; Abysis), and two cysteines were introduced to stabilize the disulfide bond. The scFv polypeptide sequence of AB0411 is shown below as SEQ ID NO:707. The stabilizing cysteines are shown in bold and underlined, and the leucine substitutions are shown in bold and italic.

[0374] TIFF2025527967000184.tif39165

[0375] Generation of AB0466 scFv from AB0073 scFv AB0073 is a fully human scFv identified from the interrogation of the H2L2 yeast immune library described in Example 2. AB0073 was derived from a variant of clone PH_420-CEACAM5. The arginine residue in the VL domain of AB0073 was found to be present in less than 1% of human frameworks. To generate AB0466, the arginine residue was replaced with glutamine (15% human framework; Abysis). Furthermore, since the NS motif was observed to deamidate after stress, the NS motif in the VH domain was replaced with SS, and the NS motif in the VL domain was replaced with NA. Finally, two cysteines were introduced to stabilize the disulfide bond. The scFv polypeptide sequence of AB0466 is shown below as SEQ ID NO: 710. The stabilizing cysteines are shown in bold and underlined, and all other amino acid substitutions are shown in bold and italic.

[0376] TIFF2025527967000185.tif41165

[0377] Generation of F3'CEACAM5 TriNKET multispecific binding protein The above AB0264, AB0621, AB0411 and AB0466 scFvs were redesigned as F3'TriNKET multispecific binding proteins. F3'TriNKET contained: (a) a CEACAM5-binding scFv sequence comprising a light chain variable domain linked to the C-terminus of a heavy chain variable domain via a (G4S)4 linker (SEQ ID NO: 532), wherein the scFv is linked to an Fc domain, and the Fc domain comprises Q347R, D399V, and F405T substitutions for heterodimerization and an S354C substitution for disulfide bond formation; and (b) an NKG2D-binding Fab fragment derived from A49MI, comprising a heavy chain portion comprising a heavy chain variable domain and a CH1 domain, and a light chain portion comprising a light chain variable domain and a light chain constant domain, wherein the CH1 domain is linked to an Fc domain, and the Fc domain comprises K360E and K409W substitutions for heterodimerization and a Y349C substitution for disulfide bond formation. The amino acid sequence of the F3' CEACAM5 TriNKET-binding protein is shown in Table 15 below.

[0378] [Table 15] TIFF2025527967000187.tif232154TIFF2025527967000188.tif236154TIFF2025527967000189.tif170154

[0379] Production and purification of F3' CEACAM5 TriNKET multispecific binding protein The F3'CEACAM5 TriNKET molecule was transiently expressed in Chinese hamster ovary (CHO) cells using various DNA ratios for various protein chains. The supernatant containing the expressed molecule was captured from the culture supernatant by overnight incubation with Protein A chromatography resin using established methods. The bound TriNKET molecule was eluted from the Protein A resin with 0.1 M glycine, pH 3.5.

[0380] After adjusting to pH 7.0, the sample eluate was passed through an anion exchange (AEX) resin and the flow-through was collected. The sample flow-through was then polished by cation exchange (CEX) chromatography using traditional methods to obtain a purity of >98% as determined by capillary gel electrophoresis, analytical size exclusion chromatography, and intact mass analysis by mass spectrometry.

[0381] [Example 13] Binding of CEACAM5 TriNKET to target protein Binding to human and cynomolgus CEACAM5 at pH 6.0 and 7.4 To determine the affinity and cross-reactivity of CEACAM5 TriNKET molecules, AB0411, AB0466, or AB0621 TriNKETs were captured using an anti-human Fc capture antibody (Cytiva, no. BR100839) immobilized on a Biacore CM5 standard surface sensor chip according to the manufacturer's instructions. Human or cynomolgus CEACAM5 was titrated with capture AB0411, AB0466, and AB0621 in two-fold serial dilutions starting at 300 nM. Association was monitored for 300 seconds, and dissociation was monitored for 600 seconds. Assays were performed at 37°C, pH 7.4, and 6.0. The CM5 chip surface was regenerated with 10 mM glycine pH 1.5 at 100 μL / min for 20 seconds.

[0382] The results show that AB0411 and AB0466 bind to human CEACAM5 but not to cynomolgus monkey CEACAM5, with AB0411 exhibiting higher affinity than AB0466. AB0621 binds to both human and cynomolgus monkey CEACAM5 at both pH 7.4 and 6.0 with affinity comparable to AB0466, with a slight increase in affinity at lower pH. AB0264 showed affinity comparable to AB0621, but for the K398 allele of human CEACAM5. The results of the in vitro binding assay are shown in Table 16.

[0383] [Table 16]

[0384] CEACAM5 TriNKET binds to different domains of human CEACAM5 To determine which hCEACAM5 protein domain(s) TriNKET bound, different assay formats were performed depending on whether the protein domain was His-tagged or Fc-fused. When the protein domain was an Fc fusion, AB0411, AB0466, AB0264, or AB0621 was captured using an anti-human Fab antibody (Cytiva, #28958325) immobilized on a CM5 chip. Various hCEACAM5 protein domains (N-term, A1-B1, A2, B2, A3, or B3) were titrated over the captured TriNKET at 50 μL / min for 180 s of association and 300 s of dissociation. Assays were performed in HBS-EP+ running buffer (pH 7.4) at 25°C. The CM5 chip surface was regenerated with 10 mL of glycine pH 2.1.

[0385] If the protein domain contained a His tag, AB0411, AB0466, AB0264, or AB0621 was captured using an anti-human Fc antibody (Cytiva) immobilized on a CM5 chip. Various hCEACAM5 protein domains were titrated onto the captured antibody at 50 μL / min for 180 seconds of association and 300 seconds of dissociation. Assays were performed in HBS-EP+ running buffer (pH 7.4) at 37°C. The surface of the CM5 chip was regenerated using 3 M MgCl2.

[0386] The results indicated that TriNKETs bind only to the A1-B1 domain, consistent with hydrogen-deuterium exchange mass spectrometry (HDX-MS) epitope mapping data (not shown). The affinity for the A1-B1 domain is comparable to that for the ectodomain of human CEACAM5. None of the TriNKETs showed binding to the A2-B2 or A3-B3 domains. The results of the domain binding assays are shown in Table 17.

[0387] [Table 17]

[0388] Binding of CEACAM5 TriNKET to human CEACAM5 SNP Several notable single nucleotide polymorphisms (SNPs) in human CEACAM5 were identified and evaluated for binding to AB0411, AB0466, and AB0621 using a Biacore surface plasmon resonance (SPR) assay developed for the major CEACAM5 SNP E398. For comparison, the fold affinity loss (KD / KD(Ref)) was calculated. As shown in Table 18 below, for various SNPs, AB0621 showed a maximum affinity loss of approximately 2-fold, AB0411 showed a maximum affinity loss of approximately 5-fold, and AB0466 showed a maximum affinity loss of approximately 9-fold.

[0389] [Table 18]

[0390] Binding of CEACAM5 TriNKET to human and cynomolgus monkey CEACAMs 1, 6, and 8 Binding to human and cynomolgus monkey CEACAMs 1, 6, and 8 was assessed by SPR using the same protocol as for CEACAM5, but titrating each protein up to 600 and 1200 nM. There was no detectable binding signal for AB0621 at these concentrations. In contrast, reproducible weak binding signals were detected for AB0411 and AB0466, although these two TriNKETs also bind to distinct epitopes on the N-terminus of CEACAM5. Typical weak-binding sensorgrams for AB0411 and AB0466 against human CEACAMs 1 and 6 showed weaker but more pronounced signals compared to AB0621. Steady-state approximations did not reach concentrations high enough to approach saturation for reliable KD determinations, but KD estimates are likely greater than approximately half the maximum analyte concentration used. The results of the CEACAMs 1, 6, and 8 binding assays are shown in Table 19.

[0391] [Table 19]

[0392] Simultaneous binding to CEACAM5, NKG2D, and CD16 target proteins Using SPR on a CM5 chip immobilized with human CEACAM5, we demonstrated simultaneous binding of the three arms of AB0264 (which differs from AB0621 only in having a proline at position 77 instead of a serine). This surface was used to initially capture AB0264 stably on the chip surface. Figures 35A and 35B demonstrate that subsequent injection of saturating levels (2 μM) of CD16A (V158 / V176) alone, followed by a premix of 2 μM CD16A and 2 μM NKG2D-His, demonstrated a graded binding signal indicative of the formation of a heterotetrameric complex on the chip surface. The ratio of binding signals (proportional to MW) was approximately 5:1:1, consistent with a 1:1:1 molar stoichiometry of the complex bound to the CEACAM5 surface.

[0393] Binding to NKG2D at pH 7.4 and 6.0 Binding to NKG2D was assessed by SPR using a mouse Fc capture kit (Cytiva, number BR100838) immobilized on a CM5 chip. Human and cynomolgus NKG2D fused to mouse Fc were captured, and AB0411, AB0466, or AB0621 were titrated from 600 nM. The results, shown in Table 20 below, demonstrate comparable affinity for all three TriNKETs for human and cynomolgus NKG2D.

[0394] [Table 20]

[0395] Binding to CD16A (FcγR3a) Binding to human and cynomolgus monkey CD16A was assessed using biotinylated CD16A captured on a streptavidin (SA) sensor chip (Cytiva, product code BR100531). AB0411, AB0466, or AB0621 was titrated from 1500 nM at 25°C at 30 μL / min for 150 seconds of association followed by 300 seconds of dissociation. The chip surface was regenerated with 2 mM sodium hydroxide at 30 μL / min for 5 seconds. The running buffer was HBS-EP+. As shown in Table 21 below, affinities were comparable across all TriNKETs. The V158 isoform bound approximately 2-3 times tighter than the F158 isoform, as expected. Cyno FcγRIIIA showed slightly stronger binding than human FcγRIIIA V158.

[0396] [Table 21]

[0397] AB0621 binding to human FcγRs, excluding CD16a (FcγR3a) AB0621 was captured on a Protein A chip (Cytiva, #29127556). Human FcγRs were titrated onto the captured AB0621 in 3-fold serial dilutions, starting at 300 nM for FcγRI, 1000 nM for FcγRIIA R131 and H131, and 3000 nM for FcγRIIB and FcγRIIIB. Association was monitored for 120 seconds, and dissociation was monitored for 180 seconds. The assay was performed at 25°C, pH 7.4. The chip surface was regenerated with 10 mM glycine pH 1.5 at 30 μL / min for 20 seconds. The results, shown in Table 22, demonstrate that AB0621 binds to FcγRs with an affinity comparable to that of a typical IgG1 antibody.

[0398] [Table 22]

[0399] AB0621 binds to human FcRn Anti-kappa light chain antibodies were immobilized on a CM5 chip using standard amine coupling protocols. AB0621 was captured on the chip and titrated against human or cynomolgus FcRn as two-fold serial dilutions starting at 2000 nM. Association was monitored for 120 seconds, and dissociation was monitored for 180 seconds. Assays were performed at both pH 7.4 and pH 6.0 at 25°C. The chip surface was regenerated with 10 mM glycine pH 1.5 at 30 μL / min for 20 seconds, followed by two pulses of 10 mM NaOH at 30 μL / min for 20 seconds.

[0400] The results shown in Table 23 demonstrate that, as expected, AB0621 binds to both human FcRn and cynomolgus monkey FcRn with equal affinity at pH 6.0, and that AB0621 does not bind to either human FcRn or cynomolgus monkey FcRn at pH 7.4.

[0401] [Table 23]

[0402] [Example 14] CEACAM5 TriNKET cell binding assay Quantification of cell surface CEACAM5 molecules by flow cytometry Various cancer cell lines were diluted in FACS buffer, and 200,000 cells of each cell type were seeded in duplicate per well in a 96-well plate for FACS staining. The monovalent mouse Fc variant of the anti-CEACAM5 antibody labetuzumab was diluted to 200 nM in FACS buffer and used to resuspend the cells. The plate was incubated for 120 min at 4°C, washed with FACS buffer, and resuspended with secondary detection reagent from Agilent's commercial receptor quantification kit, QIFIKIT. FITC-anti-mouse secondary detection reagent was diluted 1:50 in FACS buffer and incubated on the cells for 60 min at 4°C. Calibration beads were washed with FACS buffer, resuspended in the FITC-anti-mouse detection reagent prepared for the cells, and incubated for 60 min at 4°C.

[0403] The cells and beads were washed with FACS buffer, resuspended in 70 μl of fixation buffer, and incubated at 4°C for 20 minutes. The cells and beads were washed again with FACS buffer, and data were acquired using a Thermo Fisher Attune NxT. Cells of interest were identified using a plot of FSC vs. SSC, and an appropriately shaped gate was drawn around the cells. Within the gated cells, doublet events were removed by viewing a plot of FSC-H vs. FSC-A. Live cells were gated within the single-cell population. Within the live gate, the MFI of each sample was calculated. The MFI of cells and calibration beads was converted to log(MFI) after background subtraction using wells containing only secondary detection reagent. The log(MFI) of the calibration beads was plotted against log(receptor number provided by the manufacturer) and fitted using linear regression using GraphPad Prism. The log(MFI) of the cells was then used to interpolate the log(receptor number) of the cells, and these data are reported as antibody binding capacity (ABC) or antibody bound per cell. As shown in Table 24, a wide range of expression was observed across cancer cell lines, with the highest number of CEACAM5 molecules per cell in MKN-45 cells.

[0404] [Table 24]

[0405] Quantification of TriNKET binding to CEACAM5 on tumor cell lines MKN-45 and HPAF-II human cancer cell lines were diluted in FACS buffer, and 100,000 cells of each cell type were seeded in duplicate per well in a 96-well plate for FACS staining. Cells were washed with PBS, incubated in a 1:2000 dilution of Live / Dead dye in PBS for 15 minutes, and then washed with FACS buffer. AB0264, AB0411, AB0466, and AB0621 were diluted in FACS buffer, and 50 μl of each diluted TriNKET solution was added to the cells. After incubation on ice for 30-120 minutes, the cells were washed with FACS buffer. Anti-human IgG-Fc secondary antibody was diluted in FACS buffer and added at 50 μl per well for detection of bound TriNKET. Cells were incubated on ice for 30-60 minutes and then washed with FACS buffer. 50 μl of fixation buffer was added to each well, and the cells were incubated at room temperature for 10 minutes. Cells were washed with FACS buffer and resuspended in FACS buffer for analysis on a Thermo Fisher Attune NxT, BD FACS Celesta SN#H66034400085 or BD FACS Celesta SN#H66034400160.

[0406] Cells of interest were identified using a plot of FSC vs. SSC, and an appropriately shaped gate was drawn around the cells. Within the gated cells, doublet cells were excluded by viewing an FSC-H vs. FSC-A plot. Live cells were gated within the single-cell population. Within the live gate, the median fluorescence intensity (MFI) of each sample and secondary-only control was calculated. Fold over background (FOB) was calculated as the ratio of the test article MFI to the secondary-only background MFI. Data were fitted to a four-parameter nonlinear regression curve using GraphPad Prism 7.0.

[0407] The binding potency (EC50) and maximum loading (Max FOB) of CEACAM5 TriNKET for MKN-45 and HPAF-II human cancer cell lines are shown in Table 25. For AB0261, the binding potency was similar for MKN-45 and HPAF-II, with EC50s of 20.6 nM and 18.1 nM, respectively. The maximum loading was 51.32 and 24.92 FOB, respectively, consistent with high and moderate expression of CEACAM5 in these cell lines.

[0408] [Table 25]

[0409] Comparison of TriNKET and mAb binding to CEACAM5 on tumor cell lines Using the above method, the binding of CEACAM5 TriNKETs was compared to their respective monoclonal antibodies across five human cancer cell lines (Table 26). MKN-45 and SK-CO-1 cells displayed higher CEACAM5 expression levels, while LoVo and BxPC-3 displayed intermediate expression, and KATO-III displayed low CEACAM5 expression. Similar binding patterns were observed across the five cell lines. AB0264 and AB0411 displayed reduced EC50s compared to AB0755 and AB0509, respectively. AB0755 is a humanized mAb against CEACAM5 with a Fab sequence corresponding to the scFV anti-CEACAM5 present in AB0264. AB0509 is a humanized mAb against CEACAM5 with a Fab sequence corresponding to the scFV anti-CEACAM5 present in AB0411. However, both TriNKETs consistently loaded to higher maximum FOBs than their corresponding mAbs.

[0410] [Table 26]

[0411] CEACAM5 TriNKET binding to Ba / F3 cells expressing CEACAM family proteins To examine the binding specificity of TriNKET for CEACAM5 compared to other CEACAM family members, Ba / F3 cells were engineered to express one of human CEACAM1, CEACAM6, CEACAM8, or cynomolgus monkey CEACAM5. CEACAM5 TriNKET was assayed by flow cytometry starting at 1600 nM followed by seven 5-fold dilutions.

[0412] AB0264 and AB0621 bound to cynomolgus monkey CEACAM5, whereas AB0466 and AB0411 did not (Figure 36D). AB0264 and AB0621 did not cross-react with Ba / F3 cells expressing human CEACAM1, CEACAM6, or CEACAM8 (Figures 36A-36C). However, both AB0411 and AB0466 showed cross-reactive binding to Ba / F3 cells expressing human CEACAM1 (Figure 36A), and AB0411 also showed cross-reactive binding to Ba / F3 cells expressing human CEACAM6 (Figure 36B). CEACAM5 TriNKET did not bind to parental BA / F3 cells lacking expression of CEACAM family member proteins (Figure 36E).

[0413] Example 15: Cell-based cytotoxicity and activity assays Isolation and preparation of primary PBMCs and NK cells Human blood was obtained from Stanford Blood Bank or Biological Specialty Corporation (#225-11-04). Whole cynomolgus monkey blood from three animals was obtained from BioIVT (#NHP01WBNHUZN). Both human and cynomolgus monkey PBMCs were isolated by density gradient centrifugation. After purification, PBMCs were used immediately or frozen for later use. Human primary NK cells were purified by negative depletion using EasySep™ (StemCell, #17955) or RosetteSep™ (StemCell, #15065) according to the manufacturer's protocol. Alternatively, frozen NK cells were purchased from BioIVT (#HUMAN-HL65-U-200429). Primary NK cells were cultured overnight in RPMI primary cell medium before use in assays, such as the DELFIA assay.

[0414] Transduction of KHYG-1-CD16V cells KHYG-1 cells (DSMZ, #ACC-725) were retrovirally transduced to express human CD16a variant 158V (UniProtP08637). Cells were selected under puromycin, and a resistant population positive for human CD16 was identified by FACS analysis. KHYG-1-CD16V cells were cultured at 0.2 × 10 in the presence of 10 ng / mL recombinant human IL-2. 6 ~1.0×10 6 They were routinely maintained in RPMI medium at a density of 1000 / mL.

[0415] CD8 + Preparation of T cells Thaw frozen PBMCs and place them in a 25 cm 2 At 1 μg / mL ConA in culture medium in a flask, 20–25 × 10 cells per 10 ml were cultured. 6 The cells were stimulated for 18 hours at 37°C. ConA was then removed and the PBMCs were incubated at 25 cm with 25 units / mL IL-2. 2 The cells were cultured in flasks at 37°C for 4 days. +T cells were purified using a negative selection technique with magnetic beads (EasySep™ Human CD8+ T Cell Isolation Kit, StemCell) according to the manufacturer's instructions. + Before use, for example, in a cytolytic assay, T cells were cultured in a 96-well round-bottom plate at 37°C for 6 to 10 days in medium containing 10 ng / mL IL-15 at 100,000 cells / 200 μL / well. + T cells, CD3 + CD8 + Cell purity and NKG2D and CD16 expression were analyzed by flow cytometry. + T cell activity was measured in the DELFIA cytotoxicity assay described below.

[0416] DELFIA cytotoxicity assay CEACAM-5-expressing target cancer cells were dissociated from the culture vessel, pelleted, washed with 1x HBS, and incubated for 10 min. 6 The cells were resuspended in pre-warmed cell culture medium at 1000 cells / mL. BATDA (bis(acetoxymethyl) 2,2':6',2"-terpyridine-6,6"-dicarboxylate) reagent was diluted 1:400 into the cell suspension. The cells were mixed and incubated for 15-20 min at 37 °C with 5% CO2. The labeled target cells were washed three times with 1x HBS and resuspended to the final desired concentration in cell culture medium.

[0417] Resting effector cells, such as human NK cells, KHYG1-CD16V or activated CD8 + T cells were removed from culture, pelleted, and resuspended in RPMI primary cell culture medium. TriNKET was titrated in RPMI primary cell culture medium. Assays were set up in round-bottom 96-well plates containing the desired amounts of labeled target cells, effector cells, and TriNKET.

[0418] Background control wells were prepared using 100 μl of supernatant from pelleted labeled target cells and an additional 100 μl of RPMI primary cell culture medium. Spontaneous release wells were prepared by adding 100 μl of labeled target cells to wells containing 100 μl of RPMI primary cell culture medium. Maximum release wells were prepared by adding 100 μl of labeled target cells to wells containing 80 μl of RPMI primary cell culture medium and 20 μl of 10% Triton X-100 solution. The assay plate was incubated at 37°C and 5% CO2 for 2-3 hours.

[0419] At the end of the assay, 20 μl of supernatant was removed from each well and transferred to a clean 96-well DELFIA assay plate. 200 μl of europium solution was added to each well and further incubated for 15 minutes at room temperature on a plate shaker at 250 RPM. The assay plate was read using a SpectraMaxi 3x or Envision® HTRF cartridge. The average of the background samples was calculated and subtracted from the values ​​from all sample wells. Specific lysis calculations were performed using the following formula: % specific lysis = (sample-spontaneous) / (maximum-spontaneous)*100%.

[0420] Efficacy of CEACAM5 TriNKET in cytotoxicity assays using NK cells and tumor cell lines Human NK cells were rested overnight. The next day, for the DELFIA assay, resting NK cells were cocultured with BATDA-labeled CEACAM5-expressing target cancer cells at a 10:1 (SK-CO-1) or 5:1 ratio (LS-174T, ZR-75-30, and HPAF-II). Data were fitted to a four-parameter nonlinear regression model to generate potency values.

[0421] In a 2.5-hour short-term DELFIA assay using SK-CO-1 target cells, CEACAM5 TriNKET induced effective target cell lysis by resting primary NK cells derived from healthy human donors (Figure 37A). Similar results for LS-174T, HPAF-II, and ZR075-30 are shown in Figures 37B-37D. RSV-targeted TriNKET (F3'-TriNKET-palivizumab) and the human IgG1 isotype control (palivizumab-IgG1) resulted in minimal target cell death, suggesting that the cytolytic effect was dependent on engagement of the anti-CEACAM5 arm with the target cells. The concentrations of AB0411, AB0466, and AB0621 required to produce half-maximal killing (EC50) were 4.55 nM, 9.07 nM, and 1.02 nM, respectively (Table 27).

[0422] [Table 27]

[0423] AB0264 enhances the activity of IL-2-stimulated human NK cells The ability of AB0264 to activate primary human NK cells was characterized. Purified frozen human NK cells were thawed and either rested or activated overnight in culture with IL-2. The following day, NK cells were co-cultured with labeled ZR-75-30 target cells for the DELFIA assay. Dose titrations of AB0264 or AB0755 (a humanized mAb against CEACAM5 with a Fab sequence corresponding to the scFV anti-CEACAM5 present in AB0264) were prepared starting at 50 nM and added to co-cultures of resting or activated human NK cells and ZR-75-30 target cells. Specific lysis was plotted versus concentration, and the data were fitted to a four-parameter nonlinear regression model to generate potency values.

[0424] Lysis of ZR-75-30 target cells by resting and IL-2-activated hNK cells derived from the same healthy donor was compared (Figure 38). EC50 and maximum lysis values ​​are summarized in Table 28. IL-2-activated NK cells demonstrated more potent killing of ZR-75-30 cancer cells compared to resting NK cells. A larger difference was observed in maximum lysis of ZR-75-30 target cells, where AB0264 demonstrated 4-fold higher lysis of IL-2-activated target cells compared to resting NK cells.

[0425] The same analysis was applied to two additional CEACAM-5-expressing human cancer cell lines, HPAF-II and LS-174T. Both showed improved EC50s and higher maximal killing when IL-2-activated NK cells were used as effectors compared to resting NK cells. Killing EC50s and maximal lysis values ​​are summarized in Table 28.

[0426] [Table 28]

[0427] TriNKET exhibits greater cytolytic activity compared to the corresponding mAb Using a short-term primary NK cell cytotoxicity assay, the ability of AB0264 and AB0411 CEACAM-TriNKET to lyse CEACAM5-expressing human cancer cells was compared with AB0755 and AB0509, respectively. AB0755 is a humanized mAb against CEACAM5 with a Fab sequence corresponding to the scFV anti-CEACAM5 present in AB0264. AB0509 is a humanized mAb against CEACAM5 with a Fab sequence corresponding to the scFV anti-CEACAM5 present in AB0411. Purified human NK cells were thawed and allowed to rest overnight. The next day, resting NK cells were co-cultured with labeled (A) MKN-45, (B) SK-CO-1, (C) LS-174T, (D) ZR-75-30, and (E) HPAF-II target cells for the DELFIA assay. Dose titrations of AB0264 and AB0411 TriNKET or their corresponding mAbs, starting at 20 nM, were prepared and added to the co-cultures of human NK cells and target cells. Specific lysis was plotted against the concentration of each TriNKET or mAb, and the data were fitted to a four-parameter nonlinear regression model to generate potency values. AB0264 (Figures 39A-39E) and AB0411 (Figures 40A-40E) demonstrated high potency in killing the five cancer cell lines, outperforming their corresponding mAbs. All results are summarized in Table 29.

[0428] [Table 29]

[0429] NK-mediated killing of CEACAM5-expressing tumor cells depends on co-engagement of TriNKET binding arms to CD16, NKG2D, and CEACAM5 Variants of AB0264 were created with mutations in their different binding arms. AB0754 is a CD16-silent variant of AB0264 engineered to abrogate FcγR binding by introducing mutations into the CH2 domain. AB0752 is an NKG2D death variant with a mutation in the NKG2D binding arm. To abolish binding to CEACAM5 on target cells, we generated AB0444, an F3'-TriNKET containing a palivizumab-based scFv in place of the CEACAM5 binding arm.

[0430] KHYG-1-CD16V cells were incubated overnight. The next day, they were co-cultured with labeled MKN-45 target cells for the DELFIA assay. Dose titrations of AB0264 or loss-of-function variants, starting at 20 nM, were prepared and added to the co-cultures of KHYG-1-CD16V cells and MKN-45 target cells. Specific lysis was plotted versus concentration, and the data were fitted to a four-parameter nonlinear regression model to generate potency values.

[0431] In the absence of target cell binding, no activity was observed with AB0444, demonstrating the contribution of CEACAM5 binding to NK-mediated target cell lysis. AB0754 and AB0752 showed little or no activity, demonstrating that CD16 and NKG2D binding are more important for the killing activity of AB0264 (Figure 41).

[0432] IFNγ ELISA assay Assay plates were set up similarly to the DELFIA assay, but with a longer incubation time of 48 to 72 hours. Freshly isolated human NK cells were rested overnight. The following day, resting NK cells were co-cultured with SK-CO-1 at a 10:1 ratio. A dose titration of CEACAM5 TriNKET was prepared, starting at a final concentration of 133 nM in a series of 1:5 dilutions. After incubation, assay plates were briefly spun down, and IFNγ in the supernatants from assay wells was quantified using the hIFNγ Quantikine® Kit (R&D, #SIF50) according to the manufacturer's protocol. Data were fitted to a four-parameter nonlinear regression model to generate potency values. EC50 and maximum IFNγ release levels were generated by averaging results from three independent NK donors.

[0433] The ability of CEACAM5 TriNKET to induce IFNγ production in the co-culture system was assessed 48 hours after treatment. While the control palivizumab-TriNKET did not induce significant amounts of IFNγ, significant amounts of IFNγ were induced by CEACAM5 TriNKET in a dose-dependent manner (Figure 42A). The EC50 and maximum induction of IFNγ by TriNKET are summarized in Table 30. [Table 30]

[0434] IFNγ and CD107a activation assays TriNKET or hIgG1 control was diluted in culture medium. CEACAM-5-expressing human cancer cells, resting human primary NK cells, or PBMCs were harvested from culture and diluted to 1 × 10 in culture medium. 6The cells were resuspended at 1000 cells / mL. Recombinant hIL-2 and fluorophore-conjugated anti-CD107a antibody were added to NK cells or PBMCs for activation culture. For intracellular cytokine staining, brefeldin-A (BFA) and monensin were diluted in culture medium to block protein export from the cells. CEACAM5-expressing MKN-45 tumor cells and primary NK or PBMC effector cells were mixed at a 1:1 ratio. Assay plates were cultured for 4 hours to allow NK cell activation, after which cells were stained and analyzed by flow cytometry. CD107a and IFNγ staining were compared with CD3 - CD56 + Human NK cell activation was assessed in the population analyzed. Induced IFNγ + CD107 + The percentage of NK cells was plotted against concentration and the data was fitted to a four-parameter nonlinear regression model to generate potency values.

[0435] Isotype human IgG1 showed little basal induction of CD107a degranulation or intracellular IFNγ accumulation after 4 hours. Addition of AB0264 to the coculture resulted in a robust induction of IFNγ production and CD107a degranulation in a dose-responsive manner (Figure 42B).

[0436] The ability of the CEACAM5 TriNKET molecule to enhance cynomolgus monkey NK cell activation was evaluated in a co-culture assay using primary cynomolgus monkey PBMCs and human cancer cell lines. The assay using cynomolgus monkey PBMCs was set up in a similar manner to the human assay described above. Frozen cynomolgus monkey PBMCs were thawed and placed in culture medium at 37°C and 5% CO2. MKN-45 or SK-CO-1 human cancer cell lines were mixed with resting cynomolgus monkey PBMCs at a 5:1 effector-to-target cell ratio, along with the desired concentration of TriNKET or hIgG1 control. For activation cultures, BFA, monensin, rhIL-2, and fluorophore-conjugated anti-CD107a were added to the PBMCs. After 4 hours of incubation at 37°C and 5% CO2, samples were prepared for flow cytometry analysis to measure NK cell CD107a degranulation in the NK and tumor cell co-culture system. CD107a+ CD8 + The percentage of NK cells was plotted against TriNKET or control concentration, and the data was fitted to a four-parameter nonlinear regression model to generate potency values.

[0437] Cynomolgus monkey-NKG2D expression is - In contrast to NK cells, CD8 + It was consistently found only on NK cells. + CD14 - CD20 - CD3 - CD8 + Apply a gating strategy using cynomolgus monkey CD8 + Defined NK cells. All tested CEACAM5-TriNKETs expressed CD8 in each of the three cynomolgus monkey PBMC samples tested. + It demonstrated a dose-response activity in enhancing NK cell degranulation (Figures 42C-D). In contrast, the hIgG1 isotype control showed similar levels of CD107a staining as untreated samples at all concentrations evaluated. Table 31 summarizes the potency and maximum percentage of CD107a degranulation induced by CEACAM-5TriNKET in cynomolgus monkey and human NK cells.

[0438] [Table 31]

[0439] Efficacy in short-term killing assays using resting primary human NK and patient-derived primary lung tumor organoid lines NSCLC10910 and NSCLC3222 were two tumor organoid lines derived from primary non-small cell lung cancer (NSCLC) patients. Flow cytometry analysis using an unconjugated anti-CEACAM5 mAb (labetuzumab) and a PE-conjugated secondary antibody demonstrated surface expression of CEACAM5 in these two lines at much lower levels compared to SK-CO-1 (Figure 43A). Using a short-term DELFIA assay, we quantified the ability of CEACAM5 TriNKET to induce NK-mediated cytolysis in these two primary NSCLC organoid lines. Freshly isolated human NK cells were rested overnight. The following day, resting NK cells were co-cultured with NSCLC10910 or NSCLC3222 at a 10:1 ratio. Dose titrations of TriNKET and control molecules were prepared in a series of 1:5 dilutions, starting at a final concentration of 133 nM. The data were fitted to a four-parameter nonlinear regression model to generate potency values. Despite differences in CEACAM5 expression levels, human primary NK cells induced potent tumor cell lysis in both lines (Figures 43B-C, Table 32).

[0440] [Table 32]

[0441] activated CD8 + Efficacy in short-term killing assays using T cells and MKN45 Beyond NK cells, NKG2D is also expressed on cytotoxic T cells. + T cells can be directly induced by NKG2D stimulation. Cytokine-stimulated CD8 T cells were generated using the scheme shown in Figure 44A. In vitro activated human CD8 T cells were generated using the scheme shown in Figure 44A. +T cells were co-cultured with MKN-45 cells at an E:T ratio of 20:1. Specific lysis was plotted against concentration, and the data were fitted to a four-parameter nonlinear regression model to generate potency values. Activated T cells did not exhibit basal lysis of target cells. Addition of the corresponding mAb or NKG2D silent variants unable to agonize NKG2D did not trigger any T cell activation. In contrast, AB0264 inhibited the CD8 subunit of MKN-45 target cells. + There was a dose-dependent induction in T cell-mediated cytolysis (Figure 44B).

[0442] Example 16: Antitumor activity of mouse surrogate TriNKETmAB0621 in hCEACAM5Tg mice bearing B16F10-hCEACAM5 tumors transgenic mice B6.Cg-Tg(hCEACAM5)2682Wzm / Ieg mice express human CEACAM5 under the control of the human CEACAM5 promoter (Eades-Perner, 1994). Female heterozygous mice, approximately 7 to 12 weeks old and weighing an average of 21.7 g, were obtained from a breeding colony maintained at Taconic Laboratory (Germantown, NY). These mice contain approximately 2.5 copies per haploid genome of a 33 kb cosmid clone insert containing the complete human CEACAM5 gene and flanking sequences, based on a recent reassessment of copy number by quantitative PCR.

[0443] The distribution of human CEACAM5 expression in these mice is comparable to that in humans, with low levels of mRNA detected in the colon, ileum, cecum, and stomach. Human CEACAM5 protein expression was observed throughout the entire mucosa of the colon of hCEACAM5 transgenic mice, with most colonic epithelial cells staining positive. In comparison, CEACAM5 expression in the human colon is primarily localized in the upper mucosa, particularly along the luminal surface.

[0444] Antibody Reagents and Formulations A mouse surrogate duobody, designated mAB0621, was generated using the human anti-CEACAM5 Fab arm of the human TriNKET molecule AB0621 integrated into a heterodimeric antibody (duobody) with the mouse anti-mouse NKG2D binder clone 13, which forms a second Fab arm linked together on the mouse IgG2a isotype. Mutations from Genmab DuoBodies were used in the CH3 domain of mouse IgG2a to form the bispecific duobody TriNKET molecule. An isotype control mouse surrogate duobody, TriNKET, was similarly generated using the Synagis anti-human RSV Fab sequence in place of the AB0621 Fab. The mouse surrogate duobody, TriNKET, was produced by a recombinant cell line, formulated in 20 mM Na acetate, 9% sucrose, pH 5.5, and stored as a frozen (-80°C) stock.

[0445] Tumor cell line generation The B16F10 murine melanoma tumor cell line was engineered to stably express human hCEACAM5 using the pRG-RV2-5 retroviral vector without selection. The B16F10-hCEACAM5 clone 7-2B11 was confirmed by IHC to express high levels of hCEACAM5 on tumors grown subcutaneously (SC) in mice, and tumor-bearing mice had elevated levels of soluble CEACAM5 in their serum. Binding of mAB0621 to the hCEACAM5-B16F10 cell line was assessed by flow cytometry. mAB0621 exhibited an EC50 value of 21.8 nM.

[0446] Preparation and implantation of tumor cell lines B16F10-hCEACAM5 clone 7-2B11 cells from frozen stocks were maintained in vitro as monolayer cultures in DMEM medium supplemented with 10% heat-inactivated fetal bovine serum (FBS), 1X glutamine, and 1X MEM non-essential amino acids at 37°C in an atmosphere of 5% CO2 in air. Cells growing in exponential phase with 80% confluence were harvested and washed. 1.5 x 10 6Cells were injected subcutaneously (SC) in a volume of 100 μL of DMEM basal medium in the dorsal right flank of each mouse.

[0447] Tumor and body weight measurements Tumors were measured the day before the first dose and twice weekly thereafter. Tumor length and width were measured using electronic calipers, and tumor volume was calculated using the formula volume (mm 3 ) = 0.5 x length x width 2 The tumor volume was determined using the formula (where length is the longer dimension). Mice were weighed periodically to monitor their general health. Prior to treatment, mice were weighed and tumors from individual mice were measured. To prevent bias, outliers by weight or tumor volume were removed, and the remaining mice were distributed into treatment groups of equivalent mean tumor size. The mean tumor volume of B16F10-hCEACAM5 tumor-bearing mice was approximately 104 mm 8 days after implantation. 3 (80~120mm 3 Dosing began when the serum saturation reached 100% (range 0.01 to 0.01). Animals were dosed with the duobody TriNKET as follows:

[0448] Dosing Solution Preparation, Administration, and Analysis Frozen stocks of the TriNKET duobody to be tested in animal models were thawed and transferred to wet ice. Each TriNKET duobody stock solution was diluted to the nominal concentration in the appropriate diluent and immediately administered. B16F10-hCEACAM5 tumor-bearing hCEACAM5-Tg mice were administered mAB0621 duobody TriNKET or isotype control duobody TriNKET at doses of 15, 5, 1.5, or 0.5 mg / kg SC every 3–4 days for a total of six doses. Each treatment group contained 15 animals. After administration, animals were continuously monitored, and tumor volumes were measured twice weekly. The antitumor activity of mAB0621 was assessed by two parameters: the percentage of animals remaining at day 26 after mAB0621 treatment, as determined by Kaplan-Meier analysis, and tumor volume measurements after group assignment. Statistical analysis was performed on day 26 using the log-rank test (*: p<0.05, ***: p<0.001, ****: p<0.0001; ns=not significant).

[0449] Figure 45 shows Kaplan-Meier curves assessing the proportion of animals remaining over time. 3 Animals bearing tumors exceeding a volume of 100 mg / kg were euthanized. On day 26, the number of remaining animals was significantly higher in mice treated with mAB0621 at 15 mg / kg (p<0.0001), 5 mg / kg (p=0.0004), and 1.5 mg / kg (p=0.0274) compared to the isotype control group.

[0450] Figure 46 shows the individual B16F10-hCEACAM5 tumor volumes measured for each animal in the five treatment groups. Tumor volumes were measured twice weekly. Comparisons of tumor volumes between different treatment groups were performed across all time points using the area under the curve (AUC) as a summary measure for each tumor. Differences between the two treatment groups were assessed by the Wilcoxon-type nonparametric test for growth curves under dependent right censoring proposed by Vardi et al., 2001.

[0451] Individual curves of tumor volume in B16F10-hCEACAM5 tumor-bearing mice in the hCEACAM5 transgenic model are shown after administration of 15 mg / kg (Figure 46A) isotype control or 15 mg / kg (Figure 46B), 5 mg / kg (Figure 46C), 1.5 mg / kg (Figure 46D), or 0.5 mg / kg (Figure 46E) mAB0621 up to day 26. Statistically significant tumor regression was observed in the different groups treated with mAB0621 at 15 mg / kg (p=0.00050), 5 mg / kg (p=0.00145), and 0.5 mg / kg (p=0.02870) compared to the control group. The group treated with 1.5 mg / kg mAB0261 did not show significant tumor regression (p=0.07865). On day 26, complete tumor regression (CR) was observed in the 5 mg / kg (4 mice) and 15 mg / kg (2 mice) mAB0621 treatment groups.

[0452] Example 17: Antitumor activity of mouse surrogate TriNKETmAB0621 in combination with anti-PD-1 antibody in hCEACAM5 Tg mice bearing B16F10-hCEACAM5 tumors transgenic mice B6.Cg-Tg(hCEACAM5)2682Wzm / Ieg mice are described in Example 16. Female heterozygous mice, approximately 8-12 weeks old and weighing an average of 23.2 g, were obtained from a breeding colony maintained at Taconic Laboratory (Germantown, NY).

[0453] Antibody Reagents and Formulations The mAB0621 murine surrogate duobody TriNKET and isotype control TriNKET are described in Example 16. The murine surrogate duobody TriNKET and the anti-mouse PD-1 murine IgG1 antibody (muDX400) were produced by recombinant cell lines, formulated in 20 mM Na acetate, 9% sucrose, pH 5.5, and stored as frozen (-80°C) stocks.

[0454] Tumor cell lines, preparation, and implantation B16F10-hCEACAM5 clone 7-2B11 and the culture, preparation, and injection of these cells into mice were as described in Example 16.

[0455] Tumor measurements and weight Tumors were measured the day before the first dose and twice weekly thereafter. Tumor length and width were measured using electronic calipers, and tumor volume was calculated using the formula volume (mm 3 ) = 0.5 x length x width 2 The tumor volume was determined using the formula (where length is the longer dimension). Mice were weighed periodically to monitor their general health. Prior to treatment, mice were weighed and tumors from individual mice were measured. To prevent bias, outliers by weight or tumor volume were removed, and the remaining mice were distributed into treatment groups with comparable mean tumor size. The mean tumor volume in B16F10-hCEACAM5 tumor-bearing mice was approximately 237 mm 7 days after implantation. 3 (220~270mm 3Dosing began when the serum creatinine concentration reached 100 mg / kg / day (range 0.01 to 0.1 mg / kg / day) and animals were dosed with the duobody TriNKET as described below.

[0456] Preparation and administration of dosing solutions Frozen stocks of the duobody TriNKET or muDX400 anti-PD-1 antibodies to be tested in the animal model were thawed and transferred to wet ice. The stock solutions of each duobody TriNKET were diluted to their nominal concentrations in the appropriate diluent and administered immediately.

[0457] Administration and Results B16F10-hCEACAM5 tumor-bearing hCEACAM5-Tg mice were administered a 5 mg / kg dose of either a control isotype antibody or mAB0621 or anti-PD1muDX400 as single agents or combination treatments, administered subcutaneously every 3–4 days for a total of six doses. Each treatment group contained 15 animals. After administration, animals continued to be monitored, and tumor volumes were measured twice weekly. The antitumor activity of mAB0621 was assessed by two parameters: the proportion of animals remaining at 37 days post-treatment, as determined by Kaplan-Meier analysis, and measurements of tumor volume after group assignment. Statistical analysis was performed at 37 days using the log-rank test.

[0458] Kaplan-Meier curves assessing the proportion of animals remaining over time are shown in Figure 47. 3 Animals bearing tumors exceeding a volume of 100 mg / kg were euthanized. At day 37, the number of remaining animals was significantly greater in mice treated with the combination of mAB0621 and anti-PD-1 muDX400 compared to isotype control (p<0.0001), anti-PD-1 single-agent treatment (p=0.0356), and mAB0621 single-agent treatment (p=0.0368).

[0459] Figure 48 shows the individual B16F10-hCEACAM5 tumor volumes measured for each animal in the four treatment groups. Tumor volumes were measured twice weekly. Comparisons of tumor volumes between different treatment groups were performed across all time points using the AUC as a summary measure for each tumor. Differences between the two treatment groups were assessed using the Wilcoxon-type nonparametric test for growth curves under dependent right censoring proposed by Vardi et al., 2001.

[0460] The combination treatment demonstrated statistically significant tumor regression compared to the isotype control (p<0.0001) and the single-agent treatment groups, mAB0621 (p=0.0270) and anti-PD-1 (p=0.00490), respectively. Individual curves of tumor volume in B16F10-hCEACAM5 tumor-bearing mice in the hCEACAM5 gene-transfected model are shown after administration of 5 mg / mg of isotype control (Figure 48A) or 5 mg / kg of anti-PD-1 muDX400 (Figure 48B), or 5 mg / kg of mAB0621 (Figure 48C), or a combination of mAB0621 and anti-PD-1 muDX400 (Figure 48D) up to day 37. At day 37, complete tumor regression was observed with mAB0621 in combination with anti-PD-1 (11 mice), with anti-PD-1 alone (2 mice), and with mAB0621 alone (3 mice).

[0461] Example 18: Pharmacokinetics of AB0264 and AB0411 in cynomolgus monkeys The PK of AB0264 and AB0411 was studied in biologically naive cynomolgus monkeys. AB0264 and AB0411 were obtained as frozen (-80°C) stocks from an internal source. The dosing solutions were transferred from a nominal -80°C to a nominal 4°C the night before dosing. The dosing solutions were allowed to come to room temperature for at least 1 hour prior to dosing and were inverted 5-10 times to ensure uniform mixing before the formulation was transferred from the tubing to the syringe.

[0462] To understand target-mediated drug disposition due to cross-reactivity to cynomolgus monkey CEACAM5, the PK of AB0264 was tested at doses of 0.1, 1, and 10 mg / kg. Six cynomolgus monkeys were divided into three dose groups, with one male and one female in each group. AB0411 does not cross-react with cynomolgus monkey CEACAM5. Therefore, the PK of AB0411 was tested at the 10 mg / kg dose in only two female and two male cynomolgus monkeys. On day 0, these cynomolgus monkeys were administered AB0264 or AB0411 intravenously.

[0463] Serum samples were collected at the indicated time points up to 14 days post-dose. Drug concentrations were measured by two ligand binding assays: free drug was measured using recombinant human CEACAM5 and anti-hNKG2D arm anti-id antibody pairs; total drug was measured with anti-human Fc and anti-human IgG antibody pairs.

[0464] Concentration-time PK profiles of free and total drug are plotted as the mean concentration for each group versus time (AB0264 PK profile in Figure 49A and AB0411 PK profile in Figure 49B). Both AB0264 and AB0411 showed similar PK profiles in cynomolgus monkeys. They were stable in vivo, with similar free and total drug exposure over the study period. No gender differences in exposure were observed. For AB0264, serum exposure was linear from 0.1 mg / kg to 10 mg / kg doses.

[0465] [Example 19] Pharmacokinetics in hCEACAM5 transgenic mice The PK of AB0621, AB0411, and AB0466 was studied. To allow for evaluation of the effect of human CEACAM5 expression on TriNKET PK, studies were performed in the female heterozygous B6.Cg-Tg(hCEACAM5)2682Wzm / Ieg mouse strain described in Example 16. Dosing solutions of AB0621, AB0411, and AB0466 were prepared following the same procedure as described for the cynomolgus monkey PK study above.

[0466] On day 0, hCEACAM5 transgenic mice were intravenously administered AB0621, AB0411, and AB0466 at doses of 1 mg / kg and 10 mg / kg, respectively. Serum samples were collected at the indicated time points up to 14 days post-dose. Drug concentrations were measured by two ligand binding assays. Free drug was measured using a recombinant human CEACAM5 and anti-hNKG2D arm anti-id antibody pair. Total drug was measured with an anti-human Fc and anti-human IgG antibody pair.

[0467] The concentration-time PK profiles of AB0621 (Figure 50A), AB0411 (Figure 50B), and AB0466 (Figure 50C) are plotted as the mean concentration of each group versus time. AB0621, AB0411, and AB0466 exhibited antibody-like PK profiles in hCEACAM5 transgenic mice. Total and free drug exposures were aligned for all three TriNKETs tested, indicating that they are stable in vivo. The PK of AB0621 was linear from 1 mg / kg to 10 mg / kg. AB0411 and AB0466 exhibited nonlinear PK from 1 mg / kg to 10 mg / kg, likely due to hCEACAM5-mediated pharmacokinetics at the 1 mg / kg dose.

[0468] Incorporation by Reference Unless otherwise stated, the entire disclosure of each of the patent documents and scientific articles referred to herein is incorporated by reference for all purposes.

[0469] equivalent The present invention may be embodied in other specific forms without departing from its spirit or essential characteristics. Accordingly, the foregoing embodiments should be considered in all respects as illustrative rather than limiting the invention described herein. The scope of the present invention is therefore indicated by the appended claims, rather than the above description, and all modifications within the meaning and scope of the claims are intended to be embraced.

Claims

1. (a) a first antigen-binding site that binds to NKG2D; (b) a second antigen-binding site that binds to CEACAM5; and (c) a third antigen-binding site that binds to CD16, or an antibody Fc domain or a portion thereof, wherein the second antigen-binding site that binds to CEACAM5 comprises a heavy chain variable domain (VH) comprising complementarity-determining region (CDR) 1 (CDRH1), CDRH2, and CDRH3, and a light chain variable domain (VL) comprising CDR1 (CDL1), CDRL2, and CDRL3, wherein: (i) CDRH1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 3 and 102; (ii) CDRH2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 37, 104, and 718; (iii) CDRH3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 38, and 105; (iv) CDRL1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 7, 40, and 107; (v) CDRL2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 8, 41, and 108; and (vi) CDRL3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 42, and 109; protein.

2. (a) the CDRH1, CDRH2, and CDRH3 of the second antigen-binding site are (i) SEQ ID NOs: 3, 37 and 38, respectively; (ii) SEQ ID NOs: 3, 718, and 6, respectively; or (iii) SEQ ID NOs: 102, 104 and 105, respectively And, (b) CDRL1, CDRL2 and CDRL3 of the second antigen-binding site are (i) SEQ ID NOs: 7, 8 and 9, respectively; (ii) SEQ ID NOs: 40, 41, and 42, respectively; or (iii) SEQ ID NOs: 107, 108 and 109, respectively The protein of claim 1 ,

3. wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2 and CDRL3 are (i) SEQ ID NOs: 3, 37, 38, 40, 41 and 42, respectively; (ii) SEQ ID NOs: 3, 718, 6, 7, 8, and 9, respectively; or (iii) SEQ ID NOs: 102, 104, 105, 107, 108 and 109, respectively The protein of claim 2,

4. the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 704, 708, 711, and 715; and the VL comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 591, 705, 712 and 716; The protein according to any one of claims 1 to 3.

5. The VH and VL are (i) SEQ ID NOs: 704 and 705, respectively; (ii) SEQ ID NOs: 708 and 591, respectively; (iii) SEQ ID NOs: 711 and 712, respectively; or (iv) SEQ ID NOs: 715 and 716, respectively The protein according to any one of claims 1 to 4,

6. 6. The protein of any one of claims 1 to 5, wherein the second antigen-binding site is a single-chain variable fragment (scFv), wherein the scFv comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 703, 707, 710 and 714.

7. The protein of any one of claims 1 to 6, wherein the second antigen-binding site binds to a human CEACAM5 variant comprising the amino acid sequence of SEQ ID NO:

391.

8. The protein according to any one of claims 1 to 7, wherein the protein comprises an antibody Fc domain or a portion thereof that binds to CD16.

9. The protein according to any one of claims 1 to 8, wherein the first antigen-binding site that binds to NKG2D is a Fab fragment, and the second antigen-binding site that binds to CEACAM5 is an scFv.

10. The protein of any one of claims 1 to 8, wherein the first antigen-binding site that binds to NKG2D is an scFv, and the second antigen-binding site that binds to CEACAM5 is a Fab fragment.

11. The protein of any one of claims 1 to 10, further comprising an additional antigen-binding site that binds to CEACAM5.

12. The protein of claim 11 , wherein the first antigen-binding site that binds to NKG2D is an scFv, and the second and additional antigen-binding sites that bind to CEACAM5 are each Fab fragments.

13. The protein of claim 11 , wherein the first antigen-binding site that binds to NKG2D is an scFv, and the second and additional antigen-binding sites that bind to CEACAM5 are each scFv.

14. The protein according to any one of claims 6 to 13, wherein the scFv that binds to CEACAM5 and / or the scFv that binds to NKG2D comprises a heavy chain variable domain and a light chain variable domain.

15. The protein of any one of claims 6 to 14, wherein the scFv is linked to an antibody Fc domain or a portion thereof that binds to CD16 via a hinge comprising Ala-Ser or Gly-Ser.

16. The protein of claim 15, wherein the hinge further comprises the amino acid sequence Thr-Lys-Gly.

17. The protein of any one of claims 6 to 16, wherein the heavy chain variable domain of the scFv forms a disulfide bridge with the light chain variable domain of the scFv.

18. 18. The protein of claim 17, wherein the disulfide bridge is formed between C44 of the heavy chain variable domain and C100 of the light chain variable domain, numbered according to the Kabat numbering scheme.

19. The protein of any one of claims 6 to 18, wherein the heavy chain variable domain of the scFv is linked to the light chain variable domain of the scFv via a flexible linker.

20. 20. The protein of claim 19, wherein the flexible linker comprises (G4S)4 (sequence number 532).

21. 21. The protein of any one of claims 14 to 20, wherein within the scFv, the heavy chain variable domain is located C-terminal to the light chain variable domain.

22. 21. The protein of any one of claims 14 to 20, wherein within the scFv, the heavy chain variable domain is located N-terminal to the light chain variable domain.

23. The protein of any one of claims 9 to 12 and 14 to 22, wherein the Fab is not located between the antigen binding site and the antibody Fc domain or portion thereof.

24. 24. The protein of any one of claims 1 to 23, wherein the first antigen-binding site that binds to NKG2D comprises a VH comprising an amino acid sequence that is at least 90% identical to a VH sequence selected from Table 1, and a VL comprising an amino acid sequence that is at least 90% identical to a VL sequence selected from Table 1, wherein the VH sequence and VL sequence selected from Table 1 are derived from the same clone.

25. The protein of any one of claims 1 to 23, wherein the first antigen-binding site that binds to NKG2D comprises a VH comprising CDRH1, CDRH2, and CDRH3 comprising the amino acid sequences of SEQ ID NOs: 495, 496, and 510, respectively, and a VL comprising CDRL1, CDRL2, and CDRL3 comprising the amino acid sequences of SEQ ID NOs: 530, 224, and 499, respectively.

26. 26. The protein of any one of claims 24 to 25, wherein the VH of the first antigen-binding site comprises an amino acid sequence at least 90% identical to SEQ ID NO: 508, and the VL of the first antigen-binding site comprises an amino acid sequence at least 90% identical to SEQ ID NO:

493.

27. The protein of any one of claims 24 to 26, wherein the VH of the first antigen-binding site comprises the amino acid sequence of SEQ ID NO: 508, and the VL of the first antigen-binding site comprises the amino acid sequence of SEQ ID NO:

493.

28. The protein of any one of claims 1 to 27, wherein the antibody Fc domain is a human IgG1 antibody Fc domain.

29. 29. The protein of claim 28, wherein the antibody Fc domain or portion thereof comprises an amino acid sequence that is at least 90% identical to SEQ ID NO:

531.

30. 30. The protein of claim 28 or 29, wherein at least one polypeptide chain of the antibody Fc domain or portion thereof comprises one or more mutations at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the EU numbering system, relative to SEQ ID NO:

531.

31. at least one polypeptide chain of the antibody Fc domain or portion thereof is selected from the group consisting of Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366L, T366M, T366K, T366H ... 6W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K392D, K392E, T394F, D399R, D399K, D399V, S400K, S400R, D401K, F405A, F405T, Y407A, Y407I, Y407V, K409F, K409W, K409D, T411D, T411E, K439D, and K439E. The protein of any one of claims 28 to 30, comprising one or more mutations selected from the group consisting of:

32. one polypeptide chain of the antibody Fc domain or a portion thereof has one or more amino acids at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the EU numbering system, with respect to SEQ ID NO: 531 The protein of any one of claims 29 to 31, wherein the other polypeptide chain of the antibody Fc domain or portion thereof comprises one or more mutations at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, S364, T366, L368, K370, N390, K392, T394, D399, D401, F405, Y407, K409, T411, and K439 relative to SEQ ID NO:

531.

33. 33. The protein of claim 32, wherein one polypeptide chain of the antibody Fc domain or portion thereof comprises K360E and K409W substitutions relative to SEQ ID NO: 531, numbered according to the EU numbering system, and the other polypeptide chain of the antibody Fc domain or portion thereof comprises Q347R, D399V and F405T substitutions relative to SEQ ID NO:

531.

34. 34. The protein of claim 32 or 33, wherein one polypeptide chain of the antibody heavy chain constant region comprises a Y349C substitution relative to SEQ ID NO: 531, numbered according to the EU numbering system, and the other polypeptide chain of the antibody heavy chain constant region comprises a S354C substitution relative to SEQ ID NO:

531.

35. (a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 549; and (b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 550; and (c) a third polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 702, 706, 709, and 713; and Proteins, including:

36. 36. An isolated nucleic acid molecule or a plurality of isolated nucleic acid molecules encoding a protein according to any one of claims 1 to 35.

37. 37. An expression vector comprising the isolated nucleic acid molecule or a plurality of isolated nucleic acid molecules of claim 36.

38. 37. A plurality of expression vectors collectively comprising a plurality of the isolated nucleic acid molecules of claim 36.

39. 39. A host cell comprising an expression vector according to claim 37 or a plurality of expression vectors according to claim 38.

40. 40. The host cell of claim 39, wherein the host cell is a Chinese hamster ovary (CHO) cell.

41. (a) a first antigen-binding site that binds to NKG2D; (b) a second antigen-binding site that binds to CEACAM5; and (c) a third antigen-binding site that binds to CD16, or an antibody Fc domain or portion thereof; A method for producing a protein comprising: The method comprises: (i) providing a host cell according to claim 39; (ii) culturing the host cell in a culture medium under conditions suitable for expression of the protein; (iii) isolating the protein from the medium; and A method comprising:

42. 1. A method for producing a protein comprising a first, second and third polypeptide, comprising: (a) providing one or more host cells, wherein said one or more host cells comprise: (i) a first isolated nucleic acid molecule encoding the first polypeptide comprising the amino acid sequence of SEQ ID NO:549; and (ii) a second isolated nucleic acid molecule encoding the second polypeptide comprising the amino acid sequence of SEQ ID NO: 550; and (iii) a third nucleic acid molecule encoding the third polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 702, 706, 709, and 713; (b) culturing the one or more cells in a culture medium under conditions suitable for expression of the first, second, and third polypeptides; (c) recovering the polypeptide from the host cell and / or culture medium; and (d) purifying the recovered polypeptide under conditions thereby producing the protein; a first polypeptide, a second polypeptide, and a third polypeptide,

43. A pharmaceutical composition comprising the protein of any one of claims 1 to 35 and a pharmaceutically acceptable carrier.

44. 44. A method of enhancing tumor cell death in a subject with cancer, said method comprising exposing said tumor cells and natural killer cells to an effective amount of a protein according to any one of claims 1 to 35 or a pharmaceutical composition according to claim 43.

45. 44. A method for treating cancer, said method comprising administering to a patient in need thereof an effective amount of a protein according to any one of claims 1 to 35 or a pharmaceutical composition according to claim 43.

46. 36. Use of a protein according to any one of claims 1 to 35 in the manufacture of a medicament for the treatment of cancer in a human subject in need thereof.

47. 1. Use of a protein in the manufacture of a medicament for treating cancer in a human subject in need thereof, wherein said protein comprises: (a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 549; and (b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 550; and (c) a third polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 702, 706, 709, and 713; use.

48. 48. The method of claim 44 or claim 45, or the use of claim 46 or claim 47, wherein the cancer is selected from the group consisting of gastrointestinal cancer, colorectal cancer, pancreatic cancer, non-small cell lung cancer and esophageal cancer.

49. 48. The method of claim 44 or claim 45, or the use of claim 46 or claim 47, wherein the cancer expresses CEACAM5.

50. A combination therapy for treating cancer, comprising administering to a subject in need thereof a therapeutically effective amount of the protein of any one of claims 1 to 35 or the pharmaceutical composition of claim 43 and a therapeutically effective amount of a checkpoint inhibitor.

51. 51. The combination therapy of claim 50, wherein the checkpoint inhibitor is an anti-PD1 antibody or an anti-PD-L1 antibody.

52. 51. The combination therapy of claim 50, wherein the checkpoint inhibitor is pembrolizumab.

53. A protein comprising an antigen-binding site that binds to CEACAM5, wherein the antigen-binding site comprises a VH comprising CDRH1, CDRH2, and CDRH3, and a VL comprising CDRL1, CDRL2, and CDRL3; (i) CDRH1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 3 and 102; (ii) CDRH2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 37, 104, and 718; (iii) CDRH3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 38, and 105; (iv) CDRL1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 7, 40, and 107; (v) CDRL2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 8, 41, and 108; and (vi) CDRL3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 42, and 109; protein.

54. (a) the CDRH1, CDRH2, and CDRH3 are (i) SEQ ID NOs: 3, 37 and 38, respectively; (ii) SEQ ID NOs: 3, 718, and 6, respectively; or (iii) SEQ ID NOs: 102, 104 and 105, respectively and (b) said CDRL1, CDRL2 and CDRL3 are (i) SEQ ID NOs: 7, 8 and 9, respectively; (ii) SEQ ID NOs: 40, 41, and 42, respectively; or (iii) SEQ ID NOs: 107, 108 and 109, respectively 54. The protein of claim 53,

55. wherein the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2 and CDRL3 are (i) SEQ ID NOs: 3, 37, 38, 40, 41 and 42, respectively; (ii) SEQ ID NOs: 3, 718, 6, 7, 8, and 9, respectively; or (iii) SEQ ID NOs: 102, 104, 105, 107, 108 and 109, respectively 55. The protein of claim 54,

56. the VH comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 704, 708, 711, and 715; and the VL comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 591, 705, 712 and 716; 56. A protein according to any one of claims 53 to 55.

57. The VH and VL are (i) SEQ ID NOs: 704 and 705, respectively; (ii) SEQ ID NOs: 708 and 591, respectively; (iii) SEQ ID NOs: 711 and 712, respectively; or (iv) SEQ ID NOs: 715 and 716, respectively The protein according to any one of claims 53 to 56,

58. 58. The protein of any one of claims 53 to 57, wherein the antigen-binding site is a Fab fragment or an scFv.

59. 59. The protein of claim 58, wherein the antigen-binding site is an scFv comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 703, 707, 710 and 714.

60. 60. The protein of any one of claims 53 to 59, wherein the antigen-binding site binds to a human CEACAM5 variant comprising the amino acid sequence of SEQ ID NO:

391.

61. The protein of any one of claims 53 to 60, wherein the protein comprises an antibody Fc domain or a portion thereof that binds to CD16.

62. 62. The protein of claim 61, wherein the antibody Fc domain or portion thereof that binds to CD16 is linked to the antigen-binding site via a hinge comprising Ala-Ser or Gly-Ser.

63. 63. The protein of claim 62, wherein the hinge further comprises the amino acid sequence Thr-Lys-Gly.

64. The protein of claim 59, wherein the VH domain of the scFv forms a disulfide bridge with the VL domain of the scFv.

65. 65. The protein of claim 64, wherein the disulfide bridge is formed between C44 of the VH and C100 of the VL, numbered according to the Kabat numbering scheme.

66. 66. The protein of any one of claims 58 to 65, wherein the VH of the scFv is linked to the VL of the scFv via a flexible linker.

67. 67. The protein of claim 66, wherein the flexible linker comprises (G4S)4 (sequence number 532).

68. 68. The protein of any one of claims 58 to 67, wherein within the scFv, the VH is located C-terminal to the VL.

69. 68. The protein of any one of claims 58 to 67, wherein within the scFv, the VH is located N-terminal to the VL.

70. The protein of any one of claims 61 to 69, wherein the antibody Fc domain is a human IgG1 antibody Fc domain.

71. 71. The protein of claim 70, wherein the antibody Fc domain or portion thereof comprises an amino acid sequence that is at least 90% identical to SEQ ID NO:

531.

72. 72. The protein of claim 70 or 71, wherein at least one polypeptide chain of the antibody Fc domain or portion thereof comprises one or more mutations at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, N390, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the EU numbering system, relative to SEQ ID NO:

531.

73. at least one polypeptide chain of the antibody Fc domain or portion thereof is selected from the group consisting of Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366L, T366M, T366K, T366H ... 6W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M, K392V, K392F, K392D, K392E, T394F, D399R, D399K, D399V, S400K, S400R, D401K, F405A, F405T, Y407A, Y407I, Y407V, K409F, K409W, K409D, T411D, T411E, K439D, and K439E. The protein of any one of claims 70 to 72, comprising one or more mutations selected from the group consisting of:

74. One polypeptide chain of the antibody Fc domain or a portion thereof contains one or more mutations at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, K392, T394, D399, S400, D401, F405, Y407, K409, T411, and K439, numbered according to the EU numbering system, relative to SEQ ID NO:

531.

74. The protein of any one of claims 71 to 73, wherein the other polypeptide chain of the antibody Fc domain or portion thereof comprises one or more mutations at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, S364, T366, L368, K370, N390, K392, T394, D399, D401, F405, Y407, K409, T411, and K439 relative to SEQ ID NO:

531.

75. 75. The protein of claim 74, wherein one polypeptide chain of the antibody Fc domain or portion thereof comprises K360E and K409W substitutions relative to SEQ ID NO: 531, numbered according to the EU numbering system, and the other polypeptide chain of the antibody Fc domain or portion thereof comprises Q347R, D399V and F405T substitutions relative to SEQ ID NO:

531.

76. 76. The protein of claim 74 or claim 75, wherein one polypeptide chain of the antibody heavy chain constant region comprises a Y349C substitution relative to SEQ ID NO: 531, numbered according to the EU numbering system, and the other polypeptide chain of the antibody heavy chain constant region comprises a S354C substitution relative to SEQ ID NO:

531.

77. 77. The protein of any one of claims 53 to 76, further comprising a second antigen-binding site that binds to CEACAM5.

78. An isolated nucleic acid molecule encoding a protein according to any one of claims 53 to 77.

79. 79. An expression vector comprising the isolated nucleic acid molecule of claim 78.

80. 80. A host cell comprising the expression vector of claim 79.

81. 81. The host cell of claim 80, wherein the host cell is a Chinese hamster ovary (CHO) cell.

82. A method for producing a protein, comprising: (a) providing a host cell according to claim 80 or claim 81; (b) culturing the host cell in a medium under conditions suitable for expression of the protein; (c) isolating the protein from the medium; and A method comprising:

83. A pharmaceutical composition comprising the protein of any one of claims 53 to 77 and a pharmaceutically acceptable carrier.

84. 84. A method of enhancing tumor cell death in a subject having cancer, said method comprising exposing said tumor cells and natural killer cells to an effective amount of a protein according to any one of claims 53 to 77 or a pharmaceutical composition according to claim 83.

85. 84. A method for treating cancer, said method comprising administering to a patient in need thereof an effective amount of a protein according to any one of claims 53 to 77 or a pharmaceutical composition according to claim 83.

86. 80. Use of a protein according to any one of claims 53 to 77 in the manufacture of a medicament for the treatment of cancer in a human subject in need thereof.

87. 87. The method of claim 83 or claim 84, or the use of claim 86, wherein the cancer is selected from the group consisting of gastrointestinal cancer, colorectal cancer, pancreatic cancer, non-small cell lung cancer, and esophageal cancer.

88. 87. The method of claim 83 or claim 84, or the use of claim 86, wherein the cancer expresses CEACAM5.

89. A combination therapy for treating cancer, comprising administering to a subject in need thereof a therapeutically effective amount of the protein of any one of claims 53 to 77 or the pharmaceutical composition of claim 83 and a therapeutically effective amount of a checkpoint inhibitor.

90. 90. The combination therapy of claim 89, wherein the checkpoint inhibitor is an anti-PD1 antibody or an anti-PD-L1 antibody.

91. 90. The combination therapy of claim 89, wherein said checkpoint inhibitor is pembrolizumab.

Images