Laundry detergent compositions containing structural polypeptides

Structural polypeptides in laundry detergents form protective coatings on textiles, addressing fiber protection and microplastic issues, enhancing durability and reducing the need for additional care products.

JP2026507455APending Publication Date: 2026-03-04AMSILK
View PDF 0 Cites 0 Cited by

Patent Information

Authority / Receiving Office
JP · JP
Patent Type
Applications
Current Assignee / Owner
Filing Date
2024-02-01
Publication Date
2026-03-04

AI Technical Summary

Technical Problem

Modern laundry detergents face challenges in providing effective fiber protection, maintaining textile properties, and reducing microplastic emissions while being environmentally friendly and compatible with existing formulations.

Method used

Incorporation of structural polypeptides, particularly silk polypeptides, into laundry detergent compositions that form uniform coatings on fibers, enhancing mechanical and optical properties, and reducing microfiber release.

Benefits of technology

The compositions improve textile durability, eliminate the need for additional care products, and are biocompatible, non-toxic, and environmentally friendly, with reduced microfiber shedding.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 2026507455000016
    Figure 2026507455000016
  • Figure 2026507455000017
    Figure 2026507455000017
  • Figure 2026507455000018
    Figure 2026507455000018
Patent Text Reader

Abstract

The present invention relates to laundry detergent compositions comprising structural polypeptides, methods of cleaning soiled fabrics in a washing machine using the laundry detergent compositions, the use of structural polypeptides in laundry detergent compositions, and the use of the laundry detergent compositions in treating soiled fabrics.
Need to check novelty before this filing date? Find Prior Art

Description

[Technical Field]

[0001] The present invention relates to laundry detergent compositions comprising structural polypeptides, methods of cleaning soiled fabrics in a washing machine using the laundry detergent compositions, the use of structural polypeptides in laundry detergent compositions, and the use of the laundry detergent compositions in treating soiled fabrics. [Background technology]

[0002] Washing textiles using washing machines and suitable detergents has been known for over 100 years. Modern laundry detergents generally consist of complex functional ingredient formulations, typically containing a mixture of detergent-active compounds selected from anionic, nonionic, amphoteric, and cationic surfactants, as well as various additional ingredients such as builders, stain removers / antiredeposition agents, enzymes, and bleaching agents. A practical detergent must meet complex requirements, and excellent cleaning performance is only one of them. To be accepted by customers, today's detergents must also fulfill the requirement of sustainable and environmentally compatible products. This includes maximizing the lifespan of textiles while maintaining properties such as comfort, color, and fit for as long as possible. To maintain mechanical properties, it is important to protect fabric fibers from mechanical stress both during washing and use. This objective is achieved through finishes / coatings that reduce mechanical stress on fibers and inhibit the resulting degradation due to natural wear and fibrillation. Customers prefer laundry detergent compositions that impart these beneficial properties to fibers during normal washing, rather than finishes that must be added separately to the washing machine or applied to fabrics outside the washing machine. Such finishes must be biodegradable and / or harmless to people, animals, and the environment. Furthermore, reducing microplastic emissions in all sectors is a global goal. This includes reducing the amount of microfibers released during washing.

[0003] There is a need for additives that are effective at very low use frequencies and / or whose effectiveness persists after one or more additive-free washes. These additives must be compatible with the complex formulation of today's laundry detergent compositions and be capable of being formulated into laundry detergent compositions in a variety of formats known in the art, including liquid detergents, gels, tablets, capsules, water-soluble pouches, and water-soluble containers.

[0004] Regenerated silk fibroin is known to be suitable for surface modification of textile materials by deposition. H.-T. Ngo and T. Bechtold reported in J. Appl. Polym. Sci. 2017, DOI: 10.1002 / APP.45098 that fibroin-coated textiles were prepared by a complex process of depositing fibroin-calcium complexes in a CaCl2 / water / ethanol medium onto fabric samples made from man-made fibers such as viscose and polyamide. In this process, a destabilizing agent is added to the medium, and the resulting mixture is padded onto the fabric, which is then dried. This paper presents the results of fundamental research and does not address practical textile coating processes for everyday use.

[0005] Surprisingly, it has been found that structural polypeptides, such as silk polypeptides, are suitable for preparing laundry detergent compositions with improved application properties. Silk polypeptides are polymers that exhibit excellent application properties and can impart a variety of benefits to laundry detergent formulations, such as the ability to form uniform coatings on various fibers, good fiber protection, and improved or maintained mechanical and / or usage properties, including optical and tactile properties, of textiles. Surprisingly, structural polypeptides deposit on fibers at extremely low dosages, even under the harsh conditions of a wash cycle. It is also surprising that structural polypeptides form uniform coatings on fibers under these application conditions. Furthermore, structural polypeptides, particularly silk polypeptides, have been shown to be effective in preventing and / or minimizing the formation of uniform coatings on fibers. Surprisingly, the silk polypeptides are compatible with known commercial laundry detergent products without causing adverse effects such as precipitation. Structural polypeptides such as silk polypeptides are biocompatible, non-toxic, and environmentally friendly, and are suitable for the preparation of laundry detergent compositions in all forms, including liquids, gels, and single-dose formulations. Summary of the Invention

[0006] A first object of the present invention is a laundry detergent composition comprising the following ingredients: a) structural polypeptides, in particular silk polypeptides, and b) at least one surfactant One preferred embodiment is a laundry detergent composition comprising the following ingredients: a) at least one structural polypeptide; b) at least one anionic surfactant b1), and optionally at least one nonionic surfactant b2), c) optionally at least one builder; d) optionally at least one enzyme; e) optionally at least one polymeric anti-redeposition agent; f) optionally at least one bleaching agent; g) optionally at least one further additive different from components a) to f), preferably selected from surfactants different from anionic surfactants and nonionic surfactants, rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, fragrances, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, anti-redeposition agents, antimicrobial components, antioxidants and mixtures thereof, h) optionally at least one organic solvent; i) optionally water In one preferred embodiment, the laundry detergent compositions of the present invention are liquids. In another preferred embodiment, the laundry detergent compositions of the present invention are unit dose products.

[0007] A further object of the present invention is a method for washing laundry in a washing machine, wherein the laundry to be washed is contacted with a laundry detergent composition as defined above and below.

[0008] A further object of the present invention is the use of structural polypeptides, in particular silk polypeptides, as defined above and below, in laundry detergent compositions.

[0009] It is yet another object of the present invention to apply the laundry detergent composition defined above and below to the treatment of laundry in a washing machine. -improving or maintaining the properties of textiles, in particular improving or maintaining at least one property selected from the following: i) the mechanical and / or use properties of the fabric; ii) the optical properties of the fabric; iii) the texture of the fabric and / or iv) Odor characteristics of textiles -Extending the life of fabrics, -reducing the amount of microfibers released during washing; - Eliminates the need for additional laundry care products.

[0010] This summary is not necessarily an exhaustive list of all features of the present invention, and other embodiments will become apparent upon reference to the following detailed description.

[0011] Detailed Description of the Invention Before describing the details of the present invention below, it is to be understood that the present invention is not limited to the specific methods, protocols, and methods described herein. It should be understood that the present invention is not limited to the cols and reagents. It should also be understood that the terms used herein are used only for the purpose of describing particular embodiments, and are not intended to limit the scope of the present invention solely by the appended claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art.

[0012] Preferably, the terms used herein follow the definitions set out in "A multilingual glossary of biotechnological terms: (IUPAC Recommendations)" edited by Leuenberger, HGW, Nagel, B. and Kolbl, H. (1995, Helvetica Chimica Acta, CH-4010 Basel, Switzerland).

[0013] Several documents are cited throughout the text of this specification. Each document cited herein (including patents, patent applications, scientific articles, manufacturer's specifications, instruction manuals, sequence entries with GenBank accession numbers, etc.), whether cited above or below, is hereby incorporated by reference in its entirety. Nothing herein should be construed as an admission that the present invention is not entitled to antedate such disclosure by virtue of prior art.

[0014] Each element of the present invention is described below. These elements are listed with specific embodiments. However, it should be understood that they can be combined in any combination and in any number to create further embodiments. The various examples and preferred embodiments described herein should not be construed as limiting the invention to only the explicitly described embodiments. The description should be understood as supporting and encompassing embodiments that combine any disclosed and / or preferred elements with the explicitly described embodiments. Furthermore, any permutation or combination of all elements described in this application should be considered to be disclosed by the description of this application, unless the context dictates otherwise.

[0015] Structural polypeptides such as silk polypeptides are particularly advantageous for use in laundry detergent compositions that must meet a complex property profile. The laundry detergent compositions of the present invention have at least one, and preferably two, three or more of the following advantages: Structural polypeptides, and in particular silk polypeptides, are polymers that exhibit excellent application properties and can impart various benefits to laundry detergent formulations. The composition is effective even at very low application rates and under the harsh conditions of the wash cycle, as the structural polypeptides are able to form a uniform coating on the fabric under these application conditions. The compositions of the invention are capable of improving or maintaining the properties of textiles, in particular the mechanical and / or use properties of textiles, the optical properties of textiles, the feel of textiles and / or the odor properties of textiles. The compositions are suitable for providing excellent cleaning properties for laundry, improving soil removal and / or preventing re-soiling of laundry. The compositions of the invention are suitable for providing textiles with fiber protection against mechanical stress during washing and wear. The natural wear and fibrillation degradation of the fibers is improved. The composition is suitable for extending the life of textiles. The composition is also suitable for reducing the amount of microfibers released during laundry. The use of structural polypeptides, especially silk polypeptides, in laundry detergent compositions eliminates the need for additional laundry care products and remains effective even after one or more washes without the need for additives. - The structural polypeptides, especially silk polypeptides, are compatible with existing laundry detergent products without adverse effects such as precipitation. The structural polypeptides, particularly silk polypeptides, are suitable for use in a variety of laundry detergent formulations, including liquid detergents, gels, tablets (tabs), capsules (caps), water-soluble pouches (liquid tubs), and water-soluble containers. They are suitable for single-compartment and multi-compartment products containing liquid and solid components, or entirely liquid products. The formulations effectively prevent degradation or precipitation of the structural polypeptides, particularly silk polypeptides, and allow for controlled release of effective amounts into the liquid medium of the rinse cycle. The structural polypeptides, particularly silk polypeptides, contained in the laundry detergent compositions of the present invention are biocompatible, non-toxic, environmentally friendly, and safe for humans and animals. Silk proteins, in particular, are derived exclusively from renewable resources, are 100% biodegradable, and are microplastic-free, offering regulatory and environmental advantages over compositions based on traditional ingredients. - the structural polypeptides, in particular silk polypeptides, are suitable for use in phosphate-free formulations.

[0016] Without wishing to be bound by any theory, it is believed that the structural polypeptides used, particularly silk polypeptides, are suitable for forming coatings on textile fibers and improving textile properties. The structural polypeptides adhere to the fiber surface and improve mechanical properties such as tensile strength. The coating on textile fibers acts as an anti-friction agent, reducing fiber wear during the washing cycle. The coating is also believed to contribute to the fiber protection observed during use of the textile.

[0017] The laundry detergent compositions of the present invention can be in any form, preferably liquid, gel, tablet (tab), capsule (cap), water-soluble pouch (liquid tab), water-soluble container, etc. In particular, a water-soluble film-forming polymer with special release properties can be used as a sheath or coating for the entire laundry detergent composition or at least one of its components. The capsule or container can have a single compartment or multiple compartments.

[0018] In a preferred embodiment, the laundry detergent composition according to the present invention is liquid. Liquid laundry detergent compositions generally contain water or a mixture of water and at least one organic solvent that is at least partially water-miscible as the solvent. Liquid laundry detergent compositions typically contain a builder, although builder-free formulations are also known. In particular embodiments, the builder comprises up to 40% by weight or more of a nonionic surfactant. Further typical components of liquid laundry detergent compositions are hydrotropes and / or anti-redeposition polymers, which are present in some embodiments and absent in other embodiments. Liquid laundry detergent compositions are suitable for preparation as concentrates with a lower water content compared to conventional products.

[0019] In a more preferred embodiment, the laundry detergent composition of the present invention is in the form of a unit dose formulation. A unit dose formulation is intended for a single use and product. In the household sector, so-called "monodose" products, which contain a laundry detergent preparation in an amount sufficient for one wash, are popular. In the context of this application, the terms "unit dose", "monodose" and "single pack" are used synonymously.

[0020] The unit-dose laundry detergent compositions of the present invention can be in the form of single-compartment or multi-compartment (multi-chamber) formulations. The laundry detergent compositions are suitable for all common types of unit-dose formulations, such as those sold as tablets (tabs), water-soluble pouches (also known as capsules, caps, liquid tabs, liquitabs, pods, or packs), or water-soluble containers. A water-soluble film-forming polymer can be used as a sheath or coating for the entire laundry detergent composition or at least one component thereof. Suitable water-soluble polymers are known to those skilled in the art and include, for example, polyvinyl alcohol, milk protein, and polyvinylpyrrolidone. The water-soluble polymer may be selected from the group consisting of polyalkylene oxides, blends and copolymers of polyalkylene oxides and acrylic acid (esters), cellulose, cellulose ethers, cellulose esters, etc. An example of a representative water-soluble polymer is a homopolymer or copolymer of polyvinyl alcohol (PVOH). The use and amount of specific comonomers (vinyl esters, e.g., vinyl acetate, alkyl acrylates, e.g., methyl or ethyl (meth)acrylate, etc.) can provide specific release characteristics, such as dissolution time in water at a specific temperature.

[0021] In particular embodiments, the laundry detergent composition is contained in a water-soluble, multi-chamber unit dose form. The unit dose may be in the form of a film or molding having one, two, three, four, five, six, or more individual sections. Unit doses coated or packaged with a water-soluble polymer film or contained in a container made from a water-soluble polymer are preferred. Each compartment (section) of the multi-compartment formulation can be independently filled with a liquid, powder, granules, gel, paste, or a combination thereof. Thus, ingredients with stability issues, for example, due to hygroscopicity or incompatibility with other ingredients, can be used even in complex laundry detergent compositions. Thus, the laundry detergent composition of the present invention may contain two or more forms, for example, a mixture of a gel component and a powder component. In a possible embodiment, the structural polypeptide a) can be distributed in separate compartments of a multi-compartment formulation.

[0022] Laundry detergent compositions in the form of unit dose formulations according to the present invention may be entirely liquid (i.e., consisting of one or more liquid ingredients), or may comprise liquid and solid ingredients, or may be entirely solid (i.e., consisting of one or more solid ingredients).

[0023] The unit dose formulation contains no or only a small amount of added water to ensure stability of the water-soluble polymer before the pack is used for laundry. In one embodiment, the laundry detergent composition of the present invention in the form of a unit dose formulation contains up to 10% by weight, more preferably 5% by weight, particularly 1% by weight, and especially 0.5% by weight of water, based on the total weight of the composition. In a particular embodiment, the laundry detergent composition does not contain any added water.

[0024] The unit-dose laundry detergent compositions of the present invention that are entirely liquid or contain at least one liquid component generally contain at least one organic solvent instead of or in addition to water. Preferred solvents are organic solvents that are fully miscible in water or at least partially miscible in water.

[0025] In a typical embodiment, a laundry detergent composition in the form of a unit dose formulation includes at least one builder. In solid preparations only, water-insoluble ingredients may be included, such as water-insoluble builders (such as zeolites), fillers, etc.

[0026] In a particular embodiment, the laundry detergent composition comprises said structural polypeptide a) in the form of a hydrogel.

[0027] The laundry detergent composition of the present invention is preferably phosphate-free. As used herein, "phosphate-free" means that the composition contains less than 1% by weight, preferably less than 0.1% by weight, and particularly less than 0.05% by weight of phosphate, based on the total weight of the composition. "Phosphate-free" means that the laundry detergent composition does not contain alkali metal orthophosphates and polyphosphates, particularly sodium pentaphosphate (sodium tripolyphosphate, STPP).

[0028] Component a) (Structural Polypeptide) In the context of the present invention, the terms "polypeptide" and "protein" are used interchangeably and refer to a long chain of amino acids with peptide bonds, for example at least 30 amino acids in length.

[0029] The term "structural polypeptide" as used herein refers to any polypeptide comprising repeating units (repeating building blocks) of amino acids. The structural polypeptide preferably has the ability to self-assemble the polypeptide. In particular, the structural polypeptide is capable of forming protein complexes (aggregates) in preparations, such as hydrogels in aqueous preparations. The structural polypeptide may be selected from the group consisting of silk polypeptides (including fibroin), keratin, collagen, and elastin, or variants or combinations thereof. The structural polypeptide is particularly a recombinant or synthetic structural polypeptide. The structural polypeptide is preferably a (recombinant or synthetic) silk polypeptide, such as a (recombinant or synthetic) spider silk polypeptide. Exemplary methods for producing silk polypeptides are described in WO2006 / 008163 and WO2011 / 120690.

[0030] As used herein, the term "silk polypeptide" refers to a polypeptide that exhibits a highly specific amino acid composition compared to other polypeptides. In particular, silk polypeptides contain large amounts of hydrophobic amino acids, such as glycine and alanine. Furthermore, silk polypeptides contain highly repetitive amino acid sequences or repeating units (repeat units, modules), particularly in their large core domains. DNA analysis has shown that all silk polypeptides are composed of chains of repeating units and contain a limited number of characteristic short peptide motifs. Herein, the terms "peptide motif" and "consensus sequence" can be used interchangeably. In general, silk consensus sequences can be classified into four major categories: GPGXX, GGX, Ax or (GA)n, and spacer. These categories of peptide motifs in silk polypeptides have been assigned structural roles. For example, the GPGXX motif has been suggested to be involved in a β-turn spiral and may confer elasticity. The GGX motif is known to involve a glycine-rich 31-helix. Both the GPGXX and GGX motifs are thought to be involved in the formation of an amorphous matrix that connects crystalline regions, imparting elasticity to the fibers. The alanine-rich motifs typically contain 6-9 residues and are known to form crystalline beta sheets. The spacer usually contains a charged group and serves to separate the repeating peptide motifs into clusters. Silk polypeptides are capable of self-assembly of polypeptides.

[0031] Fibroin is a structural polypeptide within the meaning of the present invention and is also a silk polypeptide.

[0032] The silk polypeptide is in particular a recombinant or synthetic silk polypeptide.

[0033] Preferably, the (recombinant or synthetic) silk polypeptide is a (recombinant or synthetic) spider silk polypeptide.

[0034] As used herein, the term "polypeptide assembly" refers to the process by which a disordered system of pre-existing polypeptides forms organized structures or patterns as a result of specific local interactions between the polypeptides (e.g., van der Waals forces, hydrophobic interactions, hydrogen bonds, and / or salt bridges). This process occurs without external direction or trigger, although external factors can influence the rate and nature of polypeptide assembly. This is particularly true when two or more disordered and / or unfolded polypeptides come into contact, where they interact with each other and This means that a three-dimensional structure is formed as a result. The change from a disordered system to an organized structure or pattern during self-polypeptide assembly is characterized by a transition from a fluid state to a gel-like and / or solid state, and an accompanying increase in viscosity. The transition from a fluid state to a gel-like state can be monitored, for example, by optical or rheological measurements. These techniques are known to those skilled in the art. The transition from a fluid state to a solid state can be monitored, for example, using optical methods.

[0035] Preferably, the structural polypeptide-conducting polypeptide assembly is a (recombinant or synthetic) silk polypeptide, such as a (recombinant or synthetic) spider silk polypeptide.

[0036] As used herein, the term "polypeptide aggregate" (or polypeptide complex) refers to a polypeptide structure formed as a result of polypeptide self-assembly. During polypeptide self-assembly, multiple copies / units of a polypeptide self-assemble to form a body or mass without external guidance or trigger, although external factors may affect the rate and nature of polypeptide self-assembly. In polypeptide aggregates, different polypeptides are bound or attached to each other via covalent bonds (e.g., disulfide bonds) and / or non-covalent bonds (e.g., van der Waals forces, hydrophobic interactions, hydrogen bonds, and / or salt bridges). It is clear that a polypeptide aggregate comprises at least two polypeptides. In the context of the present invention, the self-assembly of (recombinant or synthetic) silk polypeptides is described. During the process of silk polypeptide self-assembly, silk polypeptide aggregates (silk polypeptide complexes) are formed.

[0037] As used herein, the term "hydrogel" refers to a structure formed when the concentration of structural polypeptides is sufficiently high to create a continuous network that immobilizes a liquid component. The network is preferably formed by a polypeptide aggregate of the structural polypeptides that form the basis of the hydrogel. In particular, a hydrogel is a hydrophilic polymer network of structural polypeptides. The network is stabilized by chemical and / or physical interactions between the structural polypeptides. The network is dispersed throughout an immobilized aqueous phase. The hydrophilicity and stability of the hydrogel allow for water penetration and absorption (swelling) without dissolution, thus maintaining its three-dimensional (3D) structure and function.

[0038] A preferred embodiment of the hydrogel is a flowable hydrogel. As used herein, the term "flowable hydrogel" refers to a hydrogel that is capable of flowing, especially when exposed to gravity. A flowable hydrogel is in a liquid state (meaning that it is not yet self-supporting and retains an assigned shape without a shape-stabilizing coating). The conformability of a hydrogel can be easily determined by one skilled in the art, for example, by rheological or viscometric measurements. The conformability measurements are preferably carried out under standard conditions (20°C). Methods for measuring the viscosity of a gel are described in detail below.

[0039] Alternatively, the hydrogel may be a non-flowable hydrogel, which can be converted into a flowable hydrogel by shear thinning, as is the case for solid-state structural polypeptides within the meaning of the present invention.

[0040] The structural polypeptides used in the present invention are preferably in the form of an aqueous gel. More preferably, the structural polypeptide in the form of an aqueous gel is a silk polypeptide. Particularly preferably, the structural polypeptide in the form of an aqueous gel is a recombinant or synthetic silk polypeptide.

[0041] The structural polypeptide used in the present invention is preferably in the form of a fluid aqueous gel. More preferably, the structural polypeptide is a fluid aqueous gel of silk. Particularly preferred, the structural polypeptide in the form of a fluid aqueous gel is a recombinant or synthetic silk polypeptide.

[0042] Hereinafter, this aqueous gel is also referred to as silk gel. Methods for producing aqueous gels are described in, for example, WO2020035361, WO2022258500, or WO2022258499.

[0043] In a preferred embodiment, the laundry detergent compositions of the present invention contain structural polypeptides capable of forming polypeptide aggregates, particularly polypeptides that have the potential to form fibrous structures (i.e., fibrous aggregates (complexes) of the structural polypeptides).

[0044] The structural polypeptide is preferably a silk polypeptide, keratin, collagen, elastin, or a combination thereof. In one embodiment, the silk polypeptide is fibroin. In particular, the structural polypeptide is a recombinant polypeptide, such as a recombinant silk polypeptide, recombinant keratin, recombinant collagen, or recombinant elastin.

[0045] Preferred structural polypeptides are silk polypeptides, particularly recombinant silk polypeptides.

[0046] In a preferred embodiment, the (recombinant) silk polypeptide is a spider silk polypeptide. Suitable spider silk polypeptides are major gland silk polypeptides (e.g., dragline silk polypeptides), minor gland silk polypeptides, or flagelliform silk polypeptides of orbicularis spiders. In particular, the silk polypeptide is a spider silk polypeptide, and more preferably a recombinant spider silk polypeptide.

[0047] In a preferred embodiment, the silk polypeptide consists of or comprises 25 to 4000 amino acids. In a more preferred embodiment, the silk polypeptide consists of or comprises 30 to 1500 amino acids, particularly 35 to 1200 amino acids. In a particular embodiment, the silk polypeptide consists of or comprises 60 to 600 amino acids.

[0048] In one preferred embodiment, the silk polypeptide is composed of a single amino acid unit. This embodiment is characterized in that the protein chain does not contain multiple (at least two) units of the same or similar sequence motif. In this embodiment, the silk polypeptide preferably consists of 25 to 250 amino acids, and particularly preferably consists of 30 to 150 amino acids.

[0049] In another preferred embodiment, the silk polypeptide is a polypeptide having an amino acid sequence at least 50% of which consists of or comprises multiple copies of repeat units. The amino acid sequence may be up to 100% of which consists of multiple copies of repeat units. More preferably, the silk polypeptide is a polypeptide having an amino acid sequence at least 50%, particularly at least 60%, particularly at least 65%, particularly at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, or particularly at least 99%, or even 100%, of which consists of or comprises multiple copies of repeat units. The repeat units may be identical or different.

[0050] When the amino acid sequence of the silk polypeptide is a polypeptide consisting of or comprising multiple copies of repeat units, each repeat unit preferably consists of or comprises 25 to 250 amino acids, in particular 30 to 150 amino acids. Includes:

[0051] When the amino acid sequence of the silk polypeptide consists of or is a polypeptide comprising multiple copies of a repeat unit, the total number of amino acids in all repeat units is preferably 25 to 3000 amino acids, more preferably 30 to 1500 amino acids, particularly 35 to 1200 amino acids, and especially 60 to 600 amino acids.

[0052] In a preferred embodiment, the silk polypeptide consists of or comprises at least two identical repeating units, for example, the silk polypeptide comprises 2 to 96 repeating units, for example, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 1 consisting of or comprising 9, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95 or 96 repeat units.

[0053] In particular, the repeating units are independently selected from the group consisting of: - module C: having the amino acid sequence SEQ ID NO: 1 (GSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGP) or a variant thereof; -Module C Cys :having the amino acid sequence SEQ ID NO:2 (GSSAAAAAAAASGPGGYGPENQGPCGPGGYGPGGP) or a variant thereof; -Module C Lys :Having the amino acid sequence SEQ ID NO:3 (GSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGP) or a variant thereof.

[0054] Module C Cys (SEQ ID NO:2) is a variant of module C (SEQ ID NO:1). In this module, the amino acid Ser at position 25 is replaced with the amino acid Cys. Module C Lys (SEQ ID NO:3) is also a variant of module C (SEQ ID NO:1), in which the amino acid Glu at position 20 is replaced by the amino acid Lys.

[0055] A variant of module C differs by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or up to 15 amino acid changes (i.e., substitutions, additions, insertions, deletions, N-terminal truncations, and / or C-terminal truncations) in amino acid sequence compared to the reference module C from which it is derived. Such a module variant may alternatively or additionally be characterized by a particular degree of sequence identity to the reference module from which it is derived. That is, variants of module C have at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 99.9% sequence identity to the corresponding reference module C. Preferably, the sequence identity exists over at least 5, 10, 15, 18, 20, 24, 27, 28, 30, 34 or more consecutive amino acids, preferably over the entire length of the corresponding reference module C.

[0056] The sequence identity may be at least 80%, at least 85%, at least 90%, or at least It may be 95%, at least 98%, or at least 99%. Alternatively, the sequence identity may be at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% over at least 5, 10, 15, 18, 20, 24, 28, or 30 consecutive amino acids of the corresponding reference module C.

[0057] Fragment (or deletion) variants of module C preferably have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or up to 15 amino acids deleted at their N-terminus and / or C-terminus. Deletions may also be internal.

[0058] Furthermore, a variant or fragment of module C is considered to be a variant or fragment of module C in the context of the present invention only if modifications to the amino acid sequence underlying the variant or fragment do not adversely affect the dishwasher-cleaning ability of the silk polypeptide. A skilled artisan can easily assess whether a silk polypeptide comprising a module C variant or fragment maintains dishwasher-cleaning ability. In this regard, reference is made to the examples provided in the Examples section of this patent application.

[0059] C Cys or C Lys Variants of the formula C may also be included within the scope of the present invention. Cys or C Lys With respect to the variants of module C, the explanations and definitions given above with respect to the variants of module C apply analogously (see above).

[0060] More preferably, the silk polypeptide is (C)m, (C)mC Cys , (C)mC Lys , C Cys (C)m, C Lys (C)m, (C Cys )m and (C Lys ) m, where m is an integer from 1 to 96.

[0061] Most preferably, the silk polypeptides are C1, C2, C3, C4, C5, C6, C7, C8, C9, C10, C11, C12, C13, C14, C15, C16, C17, C18, C19, C20, C21, C22, C23, C24, C25, C26, C27, C28, C29, C30, C31, C32, 10 , C 11 , C 12 , C 13 , C 14 , C 15 , C 16 , C 17 , C 18 , C 19 , C20 、C 21 、C 22 、C 23 、C 24 、C 25 、C 26 、C 27 、C 28 、C 29 、C 30 、C 31 、C 32 、C 33 、C 34 、C 35 、C 36 、C 37 、C 38 、C 32 、C 39 、C 40 、C 41 、C 42 、C 43 、C 44 、C 45 、C 46 、C 47 、C 48 、 (C)1C Cys 、(C)2C Cys 、(C)3C Cys 、(C)4C Cys 、(C)5C Cys 、(C)6C Cys 、(C)7C Cys 、(C)8C Cys 、(C)9C Cys 、(C) 10 C Cys 、(C) 11 C Cys 、(C) 12 C Cys 、(C) 13 C Cys 、(C) 14 C Cys 、(C) 15 C Cys 、(C) 16 C Cys 、(C) 17 C Cys 、(C) 18 C Cys 、(C) 19 C Cys 、(C) 20 C Cys 、(C) 21 C Cys、(C) 22 C Cys 、(C) 23 C Cys 、(C) 24 C Cys 、(C) 25 C Cys 、(C) 26 C Cys 、(C) 27 C Cys 、(C) 28 C Cys 、(C) 29 C Cys 、(C) 30 C Cys 、(C) 31 C Cys 、(C) 32 C Cys 、(C) 33 C Cys 、(C) 34 C Cys 、(C) 35 C Cys 、(C) 36 C Cys 、(C) 37 C Cys 、(C) 38 C Cys 、(C) 32 C Cys 、(C) 39 C Cys 、(C) 40 C Cys 、(C) 41 C Cys 、(C) 42 C Cys 、(C) 43 C Cys 、(C) 44 C Cys 、(C) 45 C Cys 、(C) 46 C Cys 、(C) 47 C Cys 、(C) 48 C Cys 、 (C)1C Lys 、(C)2C Lys 、(C)3C Lys 、(C)4C Lys 、(C)5C Lys 、(C)6C Lys 、(C)7CLys 、(C)8C Lys 、(C)9C Lys 、(C) 10 C Lys 、(C) 11 C Lys 、(C) 12 C Lys 、(C) 13 C Lys 、(C) 14 C Lys 、(C) 15 C Lys 、(C) 16 C Lys 、(C) 17 C Lys 、(C) 18 C Lys 、(C) 19 C Lys 、(C) 20 C Lys 、(C) 21 C Lys 、(C) 22 C Lys 、(C) 23 C Lys 、(C) 24 C Lys 、(C) 25 C Lys 、(C) 26 C Lys 、(C) 27 C Lys 、(C) 28 C Lys 、(C) 29 C Lys 、(C) 30 C Lys 、(C) 31 C Lys 、(C) 32 C Lys 、(C) 33 C Lys 、(C) 34 C Lys 、(C) 35 C Lys 、(C) 36 C Lys 、(C) 37 C Lys 、(C) 38 C Lys 、(C) 32 C Lys 、(C)39 C Lys 、(C) 40 C Lys 、(C) 41 C Lys 、(C) 42 C Lys 、(C) 43 C Lys 、(C) 44 C Lys 、(C) 45 C Lys 、(C) 46 C Lys 、(C) 47 C Lys 、(C) 48 C Lys 、 C Cys (C)1、C Cys (C)2、C Cys (C)3、C Cys (C)4、C Cys (C)5、C Cys (C)6、C Cys (C)7、C Cys (C)8、C Cys (C)9、C Cys (C) 10 、C Cys (C) 11 、C Cys (C) 12 、C Cys (C) 13 、C Cys (C) 14 、C Cys (C) 15 、C Cys (C) 16 、C Cys (C) 17 、C Cys (C) 18 、C Cys (C) 19 、C Cys (C) 20 、C Cys (C) 21 、C Cys (C) 22 、C Cys (C) 23 、C Cys (C) 24 、C Cys (C) 25 、C Cys(C) 26 、C Cys (C) 27 、C Cys (C) 28 、C Cys (C) 29 、C Cys (C) 30 、C Cys (C) 31 、C Cys (C) 32 、C Cys (C) 33 、C Cys (C) 34 、C Cys (C) 35 、C Cys (C) 36 、C Cys (C) 37 、C Cys (C) 38 、C Cys (C) 39 、C Cys (C) 40 、C Cys (C) 41 、C Cys (C) 42 、C Cys (C) 43 、C Cys (C) 44 、C Cys (C) 45 、C Cys (C) 46 、C Cys (C) 47 、C Cys (C) 48 、 C Lys (C)1、C Lys (C)2、C Lys (C)3、C Lys (C)4、C Lys (C)5、C Lys (C)6、C Lys (C)7、C Lys (C)8、C Lys (C)9、C Lys (C) 10 、C Lys (C) 11 、C Lys (C) 12 、C Lys (C)13 、C Lys (C) 14 、C Lys (C) 15 、C Lys (C) 16 、C Lys (C) 17 、C Lys (C) 18 、C Lys (C) 19 、C Lys (C) 20 、C Lys (C) 21 、C Lys (C) 22 、C Lys (C) 23 、C Lys (C) 24 、C Lys (C) 25 、C Lys (C) 26 、C Lys (C) 27 、C Lys (C) 28 、C Lys (C) 29 、C Lys (C) 30 、C Lys (C) 31 、C Lys (C) 32 、C Lys (C) 33 、C Lys (C) 34 、C Lys (C) 35 、C Lys (C) 36 、C Lys (C) 37 、C Lys (C) 38 、C Lys (C) 39 、C Lys (C) 40 、C Lys (C) 41 、C Lys (C) 42 、C Lys (C) 43 、C Lys (C) 44 、C Lys (C) 45, C Lys (C) 46 , C Lys (C) 47 and C Lys (C) 48 is selected from the group consisting of:

[0062] In one embodiment, the silk polypeptide has an amino-terminal TAG, for example, consisting of the amino acid sequence MASMTGGQQMG (SEQ ID NO:4). In another embodiment, the silk polypeptide has an amino-terminal TAG and a linker, for example, consisting of the amino acid sequence RGSM (SEQ ID NO:5).

[0063] In one example, the silk polypeptide has 16 modules C (=C 16 ) and the amino acid sequence is according to SEQ ID NO: 6 (when having a TAG according to SEQ ID NO: 4 and a linker according to SEQ ID NO: 5 at the N-terminus)."

[0064] In another example, the silk polypeptide comprises 16 CLys modules (C Lys 16 ) (SEQ ID NO:7).

[0065] In another example, the silk polypeptide has 17 modules, with the first module (N-terminus) or the last module (C-terminus) being C Cys The other 16 modules are C modules (SEQ ID NO: 1). 16 C Cys (SEQ ID NO:8).

[0066] In another example, the silk polypeptide has 17 modules, the first module (N-terminus) or the last module (C-terminus) is a CLys module (SEQ ID NO:3), and the other 16 modules are C modules (SEQ ID NO:1).

[0067] An exemplary silk polypeptide based on the large C module is silk polypeptide C, whose amino acid sequence is according to SEQ ID NO: 9. 32 (32 C modules) and silk polypeptide C whose amino acid sequence is according to SEQ ID NO: 10 48 (48 C modules).

[0068] In particular, the silk polypeptide is composed only of repeat units. In other words, the silk polypeptide does not specifically include or have non-repeated units. The only component that may be further present as part of the silk polypeptide is a tag or moiety that allows, for example, easy transcription of the silk polypeptide in an expression system and / or allows the silk polypeptide to be easily isolated from an expression system. The tag may be a histidine tag (His tag) or a flag tag.

[0069] The laundry detergent composition of the present invention preferably contains at least one structural polypeptide (component a)) in an amount of 0.0005 to 2.5% by mass, more preferably 0.001 to 2.0% by mass, and particularly preferably 0.05 to 1.5% by mass, based on the total mass of the composition. Specifically, it may contain 0.0005, 0.0006, 0.0007, 0.0008, 0.0009, 0.001, 0.002, 0.003, 0.004, 0.005, 0.006, 0.007, 0.008, 0.009, 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, or 2.5% by mass.

[0070] In preparing the laundry detergent compositions of the present invention, structural polypeptide a) can be used in the form of a solid, such as a powder. Alternatively, structural polypeptide a) can be used in the form of a solution. Preferred solvents are water, organic solvents at least partially miscible with water, and mixtures thereof. Furthermore, structural polypeptide a) can be used in the form of a gel. The gel preferably contains 0.5 to 30% by weight, more preferably 1 to 20% by weight, of the structural polypeptide based on the total weight of the gel. Specifically, the gel contains 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30% by weight.

[0071] Surfactant (ingredient b) Applicable surfactants b) include anionic surfactants, nonionic surfactants, cationic surfactants, amphoteric surfactants and mixtures thereof.

[0072] Preferably, the laundry detergent composition of the present invention contains at least one anionic surfactant b1). In a particular embodiment, the laundry detergent composition contains only anionic surfactant b1) as the surfactant.

[0073] In another particular embodiment, the laundry detergent composition of the present invention comprises: b1) at least one anionic surfactant, and b2) optionally containing at least one non-ionic surfactant.

[0074] Preferably, the laundry detergent composition of the present invention contains 3 to 60% by weight, more preferably 5 to 50% by weight, especially 7 to 45% by weight, of at least one anionic surfactant b1) based on the total weight of the composition.

[0075] When the laundry detergent composition of the present invention is formulated as a concentrate, it preferably contains 10 to 60% by weight, more preferably 20 to 60% by weight, of at least one anionic surfactant b1), based on the total weight of the composition.

[0076] Preferably, the laundry detergent composition of the present invention contains 0 to 40% by weight, more preferably 1 to 30% by weight, and especially 2.5 to 25% by weight, of at least one nonionic surfactant b2) based on the total weight of the composition.

[0077] Applicable anionic surfactants b) include alkylbenzenesulfonates, soaps, olefinsulfonates, fatty acid ester sulfonates, sulfonated fatty acids, alkyl sulfates, monoalkyl and dialkyl sulfosuccinates, monoalkyl and dialkyl sulfosuccinamides, sulfotriglycerides, amide soaps, ether carboxylic acids and their salts, acyl isethionates, acyl sarcosinates, acyltaurates, acylmethyl taurates, alkylsuccinic acids, N-acylamino acids, acyl tartrates, acyl glutamates, acylaspartates, alkyl polyglucoside sulfates, alkyl glucose carboxylates, protein fatty acid condensates, and alkyl (ether) phosphates.

[0078] Applicable anionic surfactants b) also include surfactants having polyether groups. Preferably, they are selected from alkyl polyether sulfates, aryl polyether sulfates, alkylaryl polyether sulfates, alkyl polyether sulfonates, aryl polyether sulfonates, alkylaryl polyether sulfonates, alkyl polyether phosphates, aryl polyether phosphates, alkylaryl polyether phosphates, glyceryl ether sulfonates, glyceryl ether sulfates, monoglyceride (ether) sulfates, fatty acid amide ether sulfates, and mixtures thereof. The polyether groups are generally derived from ethylene oxide (EO), 1,2-propylene oxide (PO), 1,2-butylene oxide (BO), 1,2-pentylene oxide, and mixtures thereof. The polyether groups are preferably derived from ethylene oxide and mixtures of ethylene oxide and propylene oxide. The different alkylene oxide groups may be randomly distributed or arranged in blocks. In a specific embodiment, the polyether groups are derived solely from ethylene oxide (EO).

[0079] Anionic surfactants can be added to laundry detergent compositions in the form of salts. Suitable cations in these salts include alkali metal ions such as sodium, potassium, and lithium, as well as ammonium cations. Suitable ammonium cations include, for example, hydroxyalkylammonium, di(hydroxyalkyl)ammonium, and tri(hydroxyalkyl)ammonium, with hydroxyethylammonium, di(hydroxyethyl)ammonium, and tri(hydroxyethyl)ammonium salts being particularly preferred. A specific embodiment includes monoethanolamine salts (MEA salts), such as LAS MEA salts.

[0080] Examples of suitable alkylbenzene sulfonates b1) include linear alkylbenzene sulfonates ("LAS") and alkyltoluene sulfonates. Preferably, linear C8-C 22Alkylbenzene sulfonate, more preferably linear C9-C 20 In certain embodiments, the alkylbenzene sulfonate is a linear C 11 ~C 15 Sodium and potassium alkylbenzene sulfonates.

[0081] In the context of the present application, the term "soap" refers to a salt of a fatty acid. Suitable fatty acids have a straight or branched chain and preferably contain 8 to 24 carbon atoms, more preferably 10 to 20 carbon atoms. The average carbon chain length of the fatty acid soap is preferably 12 to 18 carbon atoms, more preferably 14 to 16 carbon atoms. Suitable salts of fatty acids are alkali metal, ammonium and hydroxyalkylammonium salts, especially sodium and potassium salts, more especially sodium salts.

[0082] The fatty acids of the soap can be derived from naturally occurring sources, such as vegetable or animal esters. Examples include coconut oil, palm oil, palm kernel oil, olive oil, peanut oil, corn oil, sesame oil, rice bran oil, cottonseed oil, babassu oil, soybean oil, castor oil, tallow oil, fish oil, grease, lard, and mixtures thereof. Preferred fatty acids are those derived from coconut oil, tallow oil, palm oil (palm stearin oil), palm kernel oil, and mixtures thereof. Suitable fatty acids can also be synthetically prepared by processes such as petroleum oxidation and carbon monoxide hydrogenation via the Fischer-Tropsch process. Examples of useful soaps include the sodium and potassium salts of fatty acid mixtures derived from coconut oil and tallow oil, i.e., sodium and potassium tallow and coconut soaps.

[0083] In the context of the present application, the term olefinsulfonates also includes olefindisulfonates. Suitable olefinsulfonates b1) are C8-C 24Also suitable are mixtures of alkene sulfonates and hydroxyalkane sulfonates and / or their corresponding disulfonates.

[0084] Examples of suitable fatty acid ester sulfonates (bl) include fatty acid methyl ester sulfonates (FAME sulfonates). Examples of suitable alkyl sulfates b1) include fatty alcohol sulfates, preferably fatty alcohols having 8 to 22 carbon atoms, more preferably 10 to 18 carbon atoms. The alcohol moiety can be derived from a single alcohol having a specific number of carbon atoms within the range, or from a mixture of alcohols within the range. In certain embodiments, alkyl sulfates b1) are C9-C 11 Alcohol sulfate, C 12 -C 14 Alcohol sulfate, C 12 -C 18 In a particular embodiment, the anionic surfactant b1) consists of or comprises sodium dodecyl sulfate (SDS).

[0085] Examples of N-acylamino acids (b1) include acyl lactylates. Examples of suitable alkyl polyether sulfates (also known as alkyl ether sulfates, AES) b1) include sulfated alkyloxylated C8-C22 alcohols, preferably C 10 ~C 18 In one embodiment, sulfated ethoxylated C8-C 22 Alcohol, preferably C 10 ~C 18Alcohols and their salts. Examples of specific alkyl polyether sulfates b1) are sodium dodecylpoly(oxyethylene) sulfate (SLES: sodium lauryl ether sulfate) and the monoethanolamine salt of ethoxylated lauryl sulfate (MEA - laureth sulfate).

[0086] In a particular embodiment, the anionic surfactant b1) is an alkylbenzene sulfonate. , soap, alkyl sulfates, alkyl polyether sulfates and mixtures thereof.

[0087] Suitable nonionic surfactants b2) are generally nonionic surfactants having at least one nonpolar group and at least one polar group, including a polyether group. These can be obtained by modifying hydrophobic compounds with hydrophilic alkylene oxide moieties. In general, any hydrophobic compound having a hydroxyl, carboxyl, amino, or amide group and a reactive hydrogen atom can be condensed with alkylene oxide or its polyhydration products to form a nonionic surfactant. The alkylene oxide is preferably selected from ethylene oxide (EO), 1,2-propylene oxide (PO), 1,2-butylene oxide (BO), 1,2-pentylene oxide, and mixtures thereof. The ether component here may be derived from random copolymers and block copolymers. In a preferred embodiment, the alkylene oxide is selected from ethylene oxide and mixtures of ethylene oxide with propylene oxide and / or butylene oxide.

[0088] The nonionic surfactants b2) are preferably selected from alkyl polyoxyalkylene ethers, EO / PO block copolymers derived from polyhydric initiators, alkoxylated animal and / or vegetable fats and / or oils, fatty amine alkoxylates, ethoxylated polyethyleneimines, fatty acid amide alkoxylates, fatty acid diethanolamide alkoxylates, polyoxyethylene sorbitan fatty acid esters, rhamnolipids, sophorolipids and mixtures thereof.

[0089] In one embodiment, the nonionic surfactant b2) is selected from alkoxylated alcohols. Suitable nonionic surfactants b2) are condensation products obtained by reacting one mole of a saturated or unsaturated, linear or branched alcohol having 1 to 30 carbon atoms, preferably 4 to 24 carbon atoms, and in particular 8 to 22 carbon atoms. The starting alcohol may be of natural origin (e.g., natural fats and oils) or synthetic origin (e.g., Oxo, Fischer-Tropsch, or Guerbet alcohols). Guerbet alcohols are a group of alcohols with a branch at the β-position. The alkoxylated chain is derived from ethylene oxide units, 1,2-propylene oxide units, 1,2-butylene oxide units, 1,4-butylene oxide units, 1,2-pentylene oxide units, and mixtures thereof. In alkoxylated chains based on two or more different alkylene oxides, the alkylene oxide units can be randomly distributed or arranged in blocks. In one embodiment, the alkoxylated chain is composed exclusively of ethoxyl groups. In another embodiment, the alkoxylated chain comprises ethoxyl groups and propoxyl and / or butoxyl groups. The alkoxylated alcohols b2) preferably have an alkylene oxide chain length of 1 to 100 mol, more preferably 2 to 50 mol, in particular 3 to 25 units.

[0090] Examples of commercially available compounds of this type include C 13 Rich in iso-C 11 -C 14Ethoxylates of alcohols, such as Genapol® X089 sold by Clariant, are also available. Further examples include C 2 hydroxybenzoates, available under the Lutensol® AT brand from BASF SE. 16 C 18 Further examples include fatty alcohol ethoxylates, such as C 10, commercially available under the Lutensol® AO brand from BASF SE. 13 C 15 Further examples include oxo alcohol ethoxylates, such as C 100, available under the Lutensol® M brand from BASF SE. 10 C 18 Further examples include alcohol ethoxylates, such as those commercially available under the Lutensol® TO brand from BASF SE. 13 Further examples include Lutensol® XP and Lutensol® ethoxylates from BASF SE. ) Guerbet Alcohol Alkoxylate, available commercially as the XL brand.

[0091] In another embodiment, the nonionic surfactant b2) is selected from the condensation products of one mole of a saturated or unsaturated, linear or branched alcohol having 6 to 30, preferably 8 to 24, carbon atoms with at least one further alkylene oxide selected from ethylene oxide, propylene oxide, butylene oxide, or a mixture thereof. Preference is given to ethoxylated, propoxylated, and / or butoxylated C6-C18 fatty alcohols. The degree of ethoxylation is preferably 2 to 50, more preferably 3 to 30. The degree of propoxylation is preferably 1 to 10, more preferably 1 to 5, in particular 1, 2, or 3. If present, the degree of butoxylation is preferably 1 or 2, in particular 1.

[0092] Examples of commercially available compounds of this type include certain Genapol® surfactants sold by Clariant, such as the lauryl alcohol EO / PO adduct Genapol® EP 2454 and the C12 / C15 oxo alcohol EO / PO adduct Genapol® EP 2464. Further examples include EP / PO, EO / PO / EO, and PO / EO / PO block copolymers, which are sold by BASF SE under the Pluronic® PE and RPE brands.

[0093] In another embodiment, the nonionic surfactant b2) is selected from EO / PO block copolymers based on at least one polyhydric initiator, preferably selected from ethylene glycol, propylene glycol, glycerol, trimethylolpropane, ethylenediamine, polyethyleneimine, and mixtures thereof. Furthermore, tetrafunctional block copolymers derived from the sequential addition of propylene oxide and ethylene oxide to ethylenediamine are also suitable as nonionic surfactant b2). The number-average molecular weight of the propylene oxide units ranges from about 500 to about 7000, and the number-average molecular weight of the hydrophilic ethylene oxide units ranges from about 10% to about 80% by weight of the molecule. Examples of commercially available compounds of this type include Tetronic® compounds sold by BASF SE.

[0094] Also suitable as nonionic surfactants b2) are hydroxyl-containing polyoxyalkylene ethers and polyoxyalkylene esters, including, for example, lauryl alcohol polyoxyethylene acetate.

[0095] Further suitable nonionic surfactants b2) are ethoxylated polyethyleneimines. Suitable ethoxylated polyethyleneimine polymers comprise a polyethyleneimine backbone in which nitrogen atoms are modified by ethoxylation. Depending on whether internal or terminal nitrogen atoms are ethoxylated, the polymer contains one or two ethoxylated modifications per nitrogen atom. The total degree of ethoxylation is preferably in the range of 1 to 200, more preferably 2 to 150, and especially 5 to 100. Optionally, the nitrogen atoms may be partially or completely quaternized. The degree of quaternization is preferably 0 to 50%, for example 0.1 to 40%, or 0.5 to 30%.

[0096] Suitable nonionic surfactants b2) are also alkoxylated animal and / or vegetable fats and / or oils, such as corn oil ethoxylates, castor oil ethoxylates, tallow ethoxylates, fatty amine alkoxylates, alkoxylates of fatty acid amides and fatty acid diethanolamides, in particular their ethoxylates, and polyoxyalkylene sorbitan fatty acid esters.

[0097] Further examples of nonionic surfactants b2) include glyceryl esters, such as glyceryl monostearate, sugar surfactants, sorbitol esters, such as sorbitan fatty acid esters (sorbitan monooleate, sorbitan tristearate), polyoxyethylene sorbitan fatty acid esters, alkyl polyglycosides, N-alkyl gluconamides, alkyl methyl sulfoxides, alkyl dimethyl phosphine oxides, such as tetradecyl dimethyl phosphine oxide.

[0098] Suitable surfactants b) also include amphoteric surfactants b3).In the context of this application, amphoteric surfactants also include zwitterionic surfactants.Examples of suitable amphoteric surfactants b3) include alkyl betaines, alkylamidopropyl betaines, alkyl sulfobetaines, alkyl glycinates, alkyl carboxyglycinates, alkyl amphoacetates or alkyl amphopropionates, alkyl amphodiacetates or alkyl amphodipropionates.For example, cocodimethylsulfopropyl betaine, lauryl betaine, cocamidopropyl betaine, sodium cocoamphopropionate or tetradecyldimethylamine oxide can be used.

[0099] A particular embodiment of surfactant b3) is zwitterionic polyamine.Suitable zwitterionic polyamines include those described in EP3342847A1, which is incorporated herein by reference.More suitable ones include zwitterionic quaternized hexamethylenediamines, such as those described in WO 01 / 62882 A1, which is incorporated herein by reference.

[0100] Preferably, the laundry detergent composition contains 0 to 10.0% by weight, more preferably 0.1 to 7.0% by weight, especially 0.5 to 5.0% by weight, of at least one amphoteric surfactant b3), based on the total weight of the composition.

[0101] Suitable surfactants b) also include cationic surfactants b4). Suitable cationic surfactants b4) include, for example, quaternary ammonium compounds (especially alkyltrimethylammonium and dialkyldimethylammonium halides and alkyl sulfates), and pyridine and imidazoline derivatives (especially alkylpyridinium halides). For example, behenyl or cetyltrimethylammonium chloride can be used.

[0102] Preferably, the laundry detergent composition of the present invention contains 0 to 10.0% by weight, more preferably 0.1 to 7.0% by weight, especially 0.5 to 5.0% by weight, of at least one cationic surfactant b4) based on the total weight of the composition.

[0103] Component c) (builder) The laundry detergent compositions of the present invention may include at least one builder (component c)).

[0104] Builders (also known as chelating agents or sequestering agents) are generally used to improve the performance of surfactants in detergents. They remove metal ions, primarily calcium and magnesium, from the cleaning solution, reducing water hardness and inhibiting the formation of insoluble salts. They may also have one or more additional functions, such as dispersing or preventing redeposition.

[0105] In one embodiment, the laundry detergent composition of the present invention comprises at least one builder (component c)). Preferably, the laundry detergent composition comprises at least 0.1 wt. %, more preferably at least 0.5 wt. %, especially at least 1 wt. % of one builder, based on the total weight of the composition.

[0106] The maximum amount of builder included in the laundry detergent compositions of the present invention will depend on the type of formulation.

[0107] In one preferred embodiment, the laundry detergent composition is liquid and comprises at least one builder in an amount of 0.1 to 20% by weight, more preferably 0.5 to 15% by weight, especially 1.0 to 10% by weight, based on the total weight of the composition.

[0108] In another preferred embodiment, the laundry detergent composition of the present invention is a fully liquid unit dose formulation and comprises at least one builder in an amount of 0.1 to 10% by weight, more preferably 0.2 to 7.5% by weight, and especially 0.5 to 5.0% by weight, based on the total weight of the composition.

[0109] In another preferred embodiment, the laundry detergent composition of the present invention is a solid unit dose formulation and comprises at least one builder in an amount of 5 to 80 wt %, more preferably 10 to 65 wt %, and especially 15 to 50 wt %, based on the total weight of the composition. In a particular embodiment, the solid unit dose formulation comprises at least one aluminosilicate, especially at least one zeolite, as a builder.

[0110] Suitable builders may be organic or inorganic. Examples of classes of suitable builders are hydroxycarboxylic acids and their salts, polyhydroxycarboxylic acids (sugar acids) and their salts, phosphonic acids and their salts, preferably hydroxyalkylphosphonic acids, aminophosphonic acids and their salts, aminopolycarboxylic acids and their salts, polycarboxylic acids and their salts, aluminosilicates, alkaline silicates, inorganic carbonates, phosphates and polyphosphates containing carboxylic acid groups and their salts, and mixtures thereof.

[0111] Suitable organic builders also include hydroxycarboxylic and polyhydroxycarboxylic acids (sugar acids), as well as salts of these (poly)hydroxycarboxylic acids. These include C4-C20 hydroxycarboxylic acids, such as malic acid, tartaric acid, gluconic acid, mucinic acid, lactic acid, glutaric acid, citric acid, tartronic acid, glucoheptonic acid, lactobionic acid, and sucrose monocarboxylic, dicarboxylic, and tricarboxylic acids. Particularly preferred is citric acid and its salts. Preferred salts include sodium citrate.

[0112] Further suitable organic builders include phosphonic acid and its salts, such as hydroxyalkylphosphonic acid, aminophosphonic acid and their salts. These include, for example, phosphonobutanetricarboxylic acid, aminotris(methylenephosphonic acid) (ATMP), ethylenediaminetetramethylenephosphonic acid (EDTMP), hexamethylenediaminetetramethylenephosphonic acid (HDTMP), diethylenetriaminepentamethylenephosphonic acid (DTPMP), morpholinomethanediphosphonic acid, 1-hydroxyethane-1,1-diphosphonic acid (HEDP) and mixtures thereof. Particularly preferred is 1-hydroxyethane-1,1-diphosphonic acid and its salts.

[0113] Further suitable organic builders include aminopolycarboxylic acids, such as nitrilotriacetic acid (NTA), nitrilomonoacetic acid dipropionic acid, nitrilotripropionic acid, β-alaninediacetic acid (β-ADA), ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid, 1,3-propylenediaminetetraacetic acid, 1,2-propylenediaminetetraacetic acid, N-(alkyl)ethylenediaminetriacetic acid, N-(hydroxyalkyl)ethylenediaminetriacetic acid, ethylenediaminetriacetic acid, cyclohexylene-1,2-diaminetetraacetic acid, iminodisuccinic acid, ethylenediaminedisuccinic acid, serinediacetic acid, isoserinediacetic acid, L-asparaginediacetic acid, L-glutaminediacetic acid (GLDA), methylglycinediacetic acid (MGDA), and salts of these aminopolycarboxylic acids, as well as mixtures thereof. Particularly preferred are ethylenediaminetetraacetic acid (EDTA) and its salts, L-glutaminediacetic acid (MGDA), methylglycine ... Examples of suitable glycine diacetate include methylglycine diacetic acid (GLDA) and its salts, methylglycine diacetic acid (MGDA) and its salts, and mixtures thereof.

[0114] Further suitable organic builders include iminodisuccinic acid (IDS), ethylenediamine-N,N'-disuccinic acid (EDDS), oxydisuccinic acid, aminopolycarboxylates, alkylpolyaminocarboxylates, aminopolyalkylenephosphonates, polyglutamates, hydrophobically modified citric acids (e.g., agaric acid), poly-α-hydroxyacrylic acid, N-acylethylenediamine triacetates (e.g., lauroylethylenediamine triacetate), and alkylamides of ethylenediaminetetraacetic acid (e.g., EDTA tallowamide).

[0115] Further suitable organic builders include C4-C30 dicarboxylic, tricarboxylic and tetracarboxylic acids, such as succinic acid, itaconic acid, propanetricarboxylic acid, butanetetracarboxylic acid, cyclopentanetetracarboxylic acid, and alkylsuccinic and alkenylsuccinic acids with C2-C20 alkyl or alkenyl radicals.

[0116] Suitable inorganic builders c) include, for example, crystalline or amorphous aluminosilicates with ion-exchange properties, such as zeolites. Various types of zeolites are suitable, particularly zeolites A, X, Y, P (also known as zeolite B), MAP, and HS. The zeolites may be in sodium form or in forms in which the sodium is partially replaced by other cations, such as lithium, potassium, calcium, magnesium, or ammonium. In a particular embodiment, the laundry detergent composition according to the present invention is a solid unit dose formulation and may contain 5 to 80% (more preferably 10 to 65%, particularly 15 to 50%) of at least one aluminosilicate by weight of the total composition.

[0117] Suitable inorganic builders c) further include crystalline or amorphous silicates, such as metasilicates, disilicates or sheet silicates (layered sodium disilicate δ-Na2Si2O5, e.g. SKS 6 or SKS 7 from Weyl Chem), which can be used in the form of their alkali metal, alkaline earth metal or ammonium salts, preferably sodium, lithium and magnesium silicates.

[0118] Suitable inorganic builders further include carbonates and bicarbonates, which can be used in the form of their alkali metal, alkaline earth metal or ammonium salts. Preferably, sodium, lithium or magnesium carbonates or bicarbonates are used, in particular sodium carbonate and / or sodium bicarbonate.

[0119] In addition to, or instead of, the aforementioned builders, the laundry detergent composition may contain at least one polymeric builder. In one embodiment, the laundry detergent composition contains 0.1 to 10 wt. %, more preferably 0.2 to 7.5 wt. %, and especially 0.3 to 5.0 wt. %, of at least one polymeric builder, based on the total weight of the composition.

[0120] Suitable polymer builders are polymeric compounds having carboxylic acid groups. Examples include homopolymers and copolymers of acrylic acid and salts thereof. The number average molecular weight of the acrylic acid homopolymer is preferably in the range of 800 to 70,000 g / mol, more preferably 900 to 50,000 g / mol, and particularly preferably 1,000 to 20,000 g / mol. The term "acrylic acid homopolymer" also includes polymers in which some or all of the carboxylic acid groups are neutralized.

[0121] Suitable polymeric builders further include oligomaleic acid and its salts.

[0122] Further suitable polymeric builders include copolymers of unsaturated C4-C8 dicarboxylic acids, such as maleic acid, fumaric acid, itaconic acid and citraconic acid, with comonomers, such as single-bond unsaturated C3-C8 monocarboxylic acids (e.g. acrylic acid, methacrylic acid, crotonic acid, vinylacetic acid), single-bond unsaturated C2-C22 olefins, vinyl alkyl ethers with C1-C8 alkyl groups, styrene, vinyl esters of C1-C8 carboxylic acids, (meth)acrylamide, vinylpyrrolidone, (meth)acrylic acid esters of C1-C6 alcohols, (meth)acrylonitrile, (meth)acrylamides of C1-C8 amines, N-vinylformamide and N-vinylimidazole.

[0123] Suitable polymeric builders further include copolymers of maleic acid with acrylic acid, copolymers of itaconic acid with acrylic acid, terpolymers of maleic acid, acrylic acid and vinyl esters of C1-C3 carboxylic acids, and copolymers of maleic acid with C2-C8 olefins (e.g. ethylene, propylene or isobutene).

[0124] Suitable polymeric builders also include copolymers of C3-C6 monocarboxylic acids (e.g., acrylic acid and methacrylic acid) with ethylenically unsaturated sulfonic acids (e.g., 2-acrylamido-2-methyl-1-propanesulfonic acid (AMPS), 2-methacrylamido-2-methyl-1-propanesulfonic acid, 2-methacrylamido-2-hydroxypropanesulfonic acid, allylsulfonic acid, methallyl sulfonic acid, allyloxybenzenesulfonic acid, methallyloxybenzenesulfonic acid, 2-hydroxy-3-(2-propenyloxy)propanesulfonic acid, 2-methyl-2-propene-1-sulfonic acid, styrenesulfonic acid, vinylsulfonic acid, 3-sulfopropyl acrylate, 3-sulfopropyl methacrylate) and salts of these acids. A preferred embodiment is a copolymer of acrylic acid and 2-acrylamido-2-methyl-1-propanesulfonic acid (AMPS) (commercially available from Dow Chemical Company under the trade name ACUSOL 588).

[0125] Suitable polymeric builders also include graft polymers of unsaturated carboxylic acids and low molecular weight carbohydrates or hydrogenated carbohydrates. Suitable graft substrates include acid- or enzymatically degraded starch, degraded polysaccharides such as inulin or cellulose, protein hydrolysates, and further reduced (hydrogenated or hydrogenated aminated) degraded polysaccharides.

[0126] Further suitable polymeric builders include polyglyoxylic acid, polyamidocarboxylic acid, modified polyamidocarboxylic acid, polyaspartic acid, or condensation copolymers of aspartic acid with other amino acids, C4-C25 mono- or di-carboxylic acids, and / or C4-C25 mono- or di-amines.

[0127] A preferred class of polymeric builders are polymeric compounds containing carboxylic acid groups. Particularly preferred builders are polyacrylic acid homopolymers and copolymers, which may exist in partially or fully neutralized form.

[0128] One preferred embodiment of the builder system of the liquid laundry detergent composition comprises a total of 1.0 to 10 wt % of one or more of the following components, based on the total weight of the composition: at least one (poly)hydroxycarboxylic acid or a salt thereof, preferably citric acid or a citrate, in particular sodium citrate, at least one aminopolycarboxylic acid or its salt, preferably selected from methylglycine diacetic acid (MGDA) and its salts, ethylenediaminetetraacetic acid (EDTA) and its salts, and L-glutamine diacetic acid (GLDA) and its salts, at least one phosphonic acid and / or salt thereof, preferably selected from aminotris(methylenephosphonic acid) (ATMP), ethylenediaminetetramethylenephosphonic acid (EDTMP), hexamethylenediaminetetramethylenephosphonic acid (HDTMP), diethylenetriaminepentamethylenephosphonic acid (DTPMP), morpholinomethanediphosphonic acid, 1-hydroxyethane-1,1-diphosphonic acid (HEDP) and mixtures thereof, at least one inorganic builder selected from silicates, carbonates, bicarbonates and mixtures thereof;

[0129] One preferred embodiment of a builder system for a fully liquid unit dose laundry detergent composition comprises a total of 0.1 to 3.0 wt. % of one or more of the following components, based on the total weight of the composition: at least one phosphonic acid and / or salt thereof, preferably selected from aminotris(methylenephosphonic acid) (ATMP), ethylenediaminetetramethylenephosphonic acid (EDTMP), hexamethylenediaminetetramethylenephosphonic acid (HDTMP), diethylenetriaminepentamethylenephosphonic acid (DTPMP), morpholinomethanediphosphonic acid, 1-hydroxyethane-1,1-diphosphonic acid (HEDP) and mixtures thereof, at least one inorganic builder selected from silicates, carbonates, bicarbonates and mixtures thereof, at least one aminopolycarboxylic acid or its salt, preferably selected from methylglycine diacetic acid (MGDA) and its salts, ethylenediaminetetraacetic acid (EDTA) and its salts, and L-glutamine diacetic acid (GLDA) and its salts;

[0130] One preferred embodiment of a builder system for a solid unit dose laundry detergent composition comprises 15 to 50 wt. % of at least one aluminosilicate, especially at least one zeolite, based on the total weight of the composition.

[0131] Component d) (enzyme) The laundry detergent compositions of the present invention may also comprise at least one enzyme (component d)).

[0132] Suitable enzymes are those commonly used as industrial enzymes, particularly those that exhibit optimum activity in the neutral to alkaline pH range.

[0133] When the laundry detergent composition comprises at least one enzyme, the amount of enzyme protein is preferably at least 0.001 wt-%, more preferably at least 0.01 wt-%, especially at least 0.05 wt-%, based on the total weight of the composition.

[0134] The laundry detergent composition of the present invention preferably contains at least one enzyme in an amount of at least 0.001 to 10% by mass, more preferably 0.005 to 8% by mass, and particularly preferably 0.01 to 5% by mass, as enzyme protein, based on the total mass of the composition.

[0135] Enzymes are often used in dishwashing preparations not as pure active enzyme protein, but in combination with a carrier and / or coated (encapsulated), and optionally with other additives. The amounts of enzyme mentioned above refer to the amount of active enzyme protein, free of other ingredients.

[0136] Enzymes include aminopeptidase, amylase, arabinase, carbohydrase, carboxypeptidase, catalase, cellulase, chitinase, cutinase, cyclodextrin glycosyltransferase, deoxyribonuclease, esterase, and glycosidase. Preferably, the enzyme is selected from lactanase, α-galactosidase, β-galactosidase, glucanase, glucoamylase, α-glucosidase, β-glucosidase, haloperoxidase, hydrolase, invertase, isomerase, keratinase, laccase, lipase, mannanase, mannosidase, oxidase, pectinase (pectinolytic enzyme), peptidoglutaminase, peroxidase, peroxygenase, phytase, polyphenol oxidase, protease (proteolytic enzyme), ribonuclease, transglutaminase, transferase, xylanase, and mixtures thereof.

[0137] In particular, the laundry detergent compositions of the present invention preferably comprise one or more enzymes selected from amylase, arabinase, carbohydrase, cellulase (e.g., endoglucanase), cutinase, deoxyribonuclease, galactanase, haloperoxygenase, lipase, mannanase, oxidase (e.g., laccase and / or peroxidase), pectinase, pectin lyase, protease, xylanase, xanthanase, xyloglucanase, oxidoreductase, and mixtures thereof. More preferably, the laundry detergent compositions of the present invention comprise at least one enzyme selected from amylase, arabinase, carbohydrase, cellulase, galactanase, lipase, mannanase, pectinase, pectin lyase, protease, and mixtures thereof.

[0138] In particular embodiments, the laundry detergent composition comprises at least one amylase. When the composition comprises at least one amylase and at least one additional enzyme, the additional enzyme is preferably a protease and / or a lipase.

[0139] Proteases The composition may comprise one or more proteases of bacterial, fungal, plant, viral, or animal origin. Proteases of microbial origin are preferred. The protease may be an alkaline protease, such as a serine protease or a metalloprotease. The serine protease may be, for example, one belonging to the S1 family (e.g., trypsin) or the S8 family (e.g., subtilisin). The metalloprotease may be, for example, thermolysin, which belongs to the M4 family, or other metalloproteases belonging to the M5, M7, or M8 families.

[0140] Examples of metalloproteases are neutral metalloproteases, such as those from Bacillus amyloliquefaciens, as described in WO 2007 / 044993 (Genencor Int.).

[0141] Examples of suitable naphthease enzymes that are commercially available include: Alcalase®, Duralase TM , Durazym TM , Relase®, Relase® Ultra, Savinase®, Savinase® Ultra, Primase®, Polarzyme®, Kannase®, Liquanase®, Liquanase® Ultra, Ovozyme®, Coronase®, Coronase® Ultra, Blaze®, Blaze Evity® 100T, Blaze Evity® 125T, Blaze Evity® 150T, Neutrase®, Everlase®, Esperase®, Progress® Uno, Progress® Excel (manufactured by Novozymes A / S), Maxatase®, Maxacal®, Maxapem®, Purafect® TM, Purafect® Ox, Purafect® OxP, Purafect Prim e®, Puramax®, FN2®, FN3®, FN4®, Excellase®, Excellenz P1000 TM , Excellentenz P1250 TM , Eraser®, Preferenz® P100, Preferenz® P110, Effectenz P1000 TM , Effectenz P1050 TM , Effectenz P2000 TM , Purafast®, Properase®, Opticlean® and Optimase® (Danisco / DuPont), Axapem TM (Gist-Brocases NV), BLAP (shown in the sequence of FIG. 29 of US Pat. No. 5,352,604) and its variants (Henkel AG), KAP (Bacillus alkalophilus subtilisin) (Kao).

[0142] Lipase and chitinase (catinase) Suitable lipases and chitinases include those of bacterial or fungal origin, including chemically modified and engineered mutant enzymes. Lipases from Thermomyces, such as those from T. lanuginosus (formerly Humicola lanuginosa) (described in EP 258068 and EP 305216); chitinases from Humicola, such as H. insolens (WO 96 / 13580); lipases from Pseudomonas strains (some now renamed Burkholderia), such as P. alcaligenes or P. pseudoalcaligenes (EP 218272), P. cepacia (EP 331376), P. sp. strain SD705 (WO 95 / 06720 and WO 96 / 27002), P. wisconsinensis (WO 96 / 12012); GDSL-type Streptomyces lipases (WO 2010 / 065455); Magnaporthe grisea chitinase (WO2010 / 107560); Pseudomonas mendocina chitinase (US 5,389,536); Thermobifida fusca lipase (WO2011 / 084412); Geobacillus stearothermophilus lipase (WO2011 / 084417); Bacillus subtilis lipase (WO2011 / 084599); and Streptomyces griseus (WO2011 / 150157) and S. pristinaespiralis lipase (WO2012 / 137147).

[0143] Preferred commercially available lipase products include Novozymes A / S: Lipolase TM , Lipex TM , Lipolex TM , Lipoclean TM , Lumafast (formerly Genencor), and Lipomax (formerly Gist-Brocades).

[0144] Furthermore, lipases known as acyltransferases and perhydrolases are also applicable, for example: acyltransferases homologous to Candida antarctica lipase A (WO2010 / 111143), acyltransferases from Mycobacterium smegmatis (WO2005 / 056782), perhydrolases from the CE7 family (WO2009 / 067279) and variants of M. smegmatis perhydrolases, in particular the commercial product Gentle Power An example is the S54V mutant used in Bleach (Huntsman Textile Effects Pte Ltd) (WO2010 / 100028).

[0145] amylase Suitable amylases that can be used in combination with proteases include α-amylases or glucoamylases of bacterial or fungal origin, including chemically modified and engineered mutants, such as α-amylases from the genus Bacillus. and those obtained from specific strains of Bacillus licheniformis (details of which are given in GB 1,296,839).

[0146] Suitable amylases include those having SEQ ID NO:2 as set forth in WO95 / 10603, or variants of SEQ ID NO:3 having 90% sequence identity thereto. Preferred variants include those set forth in WO94 / 02597, WO94 / 18314, WO97 / 43424, and as set forth in SEQ ID NO:4 of WO99 / 19467, including variants having substitutions at one or more of the following positions: 15, 23, 105, 106, 124, 128, 133, 154, 156, 178, 179, 181, 188, 190, 197, 201, 202, 207, 208, 209, 211, 243, 264, 304, 305, 391, 408, 444.

[0147] Further suitable amylases include the amylase having SEQ ID NO:6 described in WO02 / 10355 or variants having 90% sequence identity to SEQ ID NO:6. Preferred variants of SEQ ID NO:6 include those with deletions at positions 181 and 182 and a substitution at position 193.

[0148] Further suitable amylases include hybrid α-amylases combining residues 1-33 of the α-amylase from B. amyloliquefaciens (SEQ ID NO:6 of WO 2006 / 066594) with residues 36-483 of the B. licheniformis α-amylase (SEQ ID NO:4 of WO 2006 / 066594), or variants with 90% sequence identity thereto. Preferred variants of this hybrid α-amylase have substitutions, deletions, or insertions at one or more of the following positions: G48, T49, G107, H156, A181, N190, M197, I201, A209, and Q264. The most preferred hybrid α-amylase variant is a hybrid comprising residues 1-33 of the α-amylase from B. amyloliquefaciens (SEQ ID NO:6 of WO2006 / 066594) and residues 36-483 of SEQ ID NO:4, with the following substitutions: M197T, H156Y+A181T+N190F+A209V+Q264S, or G48A+T49I+G107A+H156Y+A181T+N190F+I201F+A209V+Q264S.

[0149] Further suitable amylases include those having the sequence of SEQ ID NO:6 of WO99 / 19467, or variants having 90% sequence identity to SEQ ID NO:6. Preferred variants of SEQ ID NO:6 have substitutions, deletions, or insertions at one or more of the following positions: R181, G182, H183, G184, N195, I206, E212, E216, K269. Particularly preferred amylases have deletions of R181 and G182, or deletions of H183 and G184.

[0150] Further suitable amylases that can be used include those having SEQ ID NO: 1 of WO96 / 23873 and amylases having the sequences of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:2, SEQ ID NO:7, or variants having 90% sequence identity to SEQ ID NO:1, 2, 3, 7. Preferred variants of SEQ ID NO:1, 2, 3, 7 have substitutions, deletions, or insertions at one or more of the following positions (numbering using SEQ ID NO:2 of WO 96 / 23873): 140, 181, 182, 183, 184, 195, 206, 212, 243, 260, 269, 304, 476. More preferred variants have deletions at two positions selected from 181, 182, 183, 184, e.g., 181 and 182, 182 and 183, or 183 and 184. Most preferred amylase variants of SEQ ID NO:1, SEQ ID NO:2, or SEQ ID NO:7 have a deletion at positions 183 and 184 and a substitution at any one or more of positions 140, 195, 206, 243, 260, 304, and 476.

[0151] Further suitable amylases that can be used are those having SEQ ID NO:2 of WO2008 / 153815 or SEQ ID NO:10 of WO01 / 66712, or variants having 90% homology to the respective sequences. Preferred variants of SEQ ID NO:10 of WO01 / 66712 have substitutions, deletions or insertions at any one or more positions 176, 177, 178, 179, 190, 201, 207, 211, and 264.

[0152] Further suitable amylases include those having SEQ ID NO:2 of WO2009 / 061380 or variants having 90% homology to that sequence. Preferred variants of SEQ ID NO:2 include C-terminal truncations and / or one or more substitutions, deletions or insertions at any of the following positions: Q87, Q98, S125, N128, T131, T165, K178, R180, S181, T182, G183, M201, F202, N225, S243, N272, N282, Y305, R309, D319, Q320, Q359, K444, G475. More preferred variants are those having one or more substitutions at any of positions Q87E, R, Q98R, S125A, N128C, T131I, T165I, K178L, T182G, M201L, F202Y, N225E, R, N272E, R, S243Q, A, E, D, Y305R, R309A, Q320R, Q359E, K444E, G475K, and / or a deletion of R180 and / or S181, or T182 and / or G183. Most preferred variants have a C-terminal truncation, optionally further including a substitution at position 243 and / or a deletion at positions 180 and / or 181, and have the following substitutions: N128C+K178L+T182G+Y305R+G475K, N128C+K178L+T182G+F202Y+Y305R+D319T+G475K, S125A+N128C+K178L+T182G+Y305R+G475K, or S125A+N128C+T131I+T165I+K178L+T182G+Y305R+G475K.

[0153] Further suitable amylases are those having SEQ ID NO: 1 of WO2013 / 184577 or variants having 90% sequence identity to SEQ ID NO: 1. Preferred variants of SEQ ID NO: 1 have substitutions, deletions or insertions at one or more of the following positions: K176, R178, G179, T180, G181, E187, N192, M199, I203, S241, R458, T459, D460, G476, G477. More preferred variants are those having substitutions at one or more of the following positions: K176L, E187P, N192FYH, M199L, I203YF, S241QADN, R458N, T459S, D460T, G476K, G477K, and / or deletions of R178 and / or S179, or T180 and / or G181. Most preferred variants have the following substitutions: E187P+I203Y+G476K E187P+I203Y+R458N+T459S+D460T+G476K Additionally, it may optionally contain a substitution at position 241 and / or a deletion at positions 178 and / or 179.

[0154] Further suitable amylases include amylases having SEQ ID NO:1 of WO2010 / 104675, or variants having 90% sequence identity to SEQ ID NO:1. Preferred variants of SEQ ID NO:1 are those that have substitutions, deletions, or insertions at one or more of the following positions: N21, D97, V128, K177, R179, S180, I181, G182, M200, L204, E242, G477, and G478.

[0155] A further suitable amylase is the α-amylase having SEQ ID NO:12 of WO01 / 66712, or a variant having at least 90% sequence identity to SEQ ID NO:12. Preferred amylase variants are those that have substitutions, deletions, or insertions at one or more of the following positions: R28, R118, N174; R181, G182, D183, G184, G186, W189, N195, M202, Y298, N299, K302, S303, N306, R310, N314; R320, H324, E345, Y396, R400, W439, R444, N445, K446, Q449, R458, N471, N484 of SEQ ID NO:12 of WO01 / 66712. Particularly preferred amylases are mutants with deletions of D183 and G184 and further with substitutions of R118K, N195F, R320K, and R458K, as well as mutants with substitutions at one or more positions selected from the group consisting of M9, G149, G182, G186, M202, T257, Y295, N299, M323, E345, and A339, and most preferred are mutants with substitutions at all of these positions.

[0156] Suitable commercially available amylases include Duramyl TM , Termamyl TM , Fungamyl TM , Stainzyme TM , Stainzyme Plus TM , Natalase TM , Liquozyme X, BAN TM , Amplify® and Amplify® Prime (manufactured by Novozymes A / S), and Rapidase TM , Purastar TM / Effectenz TM , Powerase, Preferenz S1000, Preferenz S100, and Preferenz S110 (manufactured by Genencor International Inc. / DuPont).

[0157] Deoxyribonuclease (DNase) Suitable deoxyribonucleases (DNases) are enzymes that catalyze the hydrolysis of phosphodiester bonds in the DNA backbone, degrading DNA. DNases derived from bacteria are preferred, and DNases derived from Bacillus species are particularly preferred. More specifically, DNases derived from Bacillus subtilis or Bacillus licheniformis are preferred. Examples of such DNases are described in WO2011 / 098579 and WO2014 / 087011.

[0158] oxidoreductase In certain embodiments, the compositions may include an oxidoreductase, which is an enzyme that catalyzes an oxidation-reduction reaction. A preferred oxidoreductase is superoxide dismutase.

[0159] Enzymes can be formulated as a separate component of the laundry detergent composition, for example, in a separate compartment of a multi-compartment composition, or can be used in the form of an enzyme-containing film.

[0160] Preferably, the laundry detergent composition comprises at least one protease and / or amylase.

[0161] In certain embodiments, the mixture comprises at least one enzyme, for example, an enzyme mixture comprising or consisting of the following enzymes is preferred: proteases and amylases, proteases and lipases (or lipolytic enzymes), proteases and cellulases, amylase, cellulase and lipase (or lipolytic enzymes), proteases, amylases and lipases (or lipolytic enzymes), Proteases, lipases (or fat-degrading enzymes) and cellulases.

[0162] The enzymes may be adsorbed onto a carrier material to prevent premature decomposition. If desired, the laundry detergent composition may also contain enzyme stabilizers. Examples of these include calcium propionate, sodium formate, boric acid, boric acid and its salts (e.g., 4-formylphenylboronic acid), peptides and peptide derivatives (e.g., peptide aldehyde), polyols (e.g., propane-1,2-diol), and mixtures thereof.

[0163] High-molecular-weight anti-redeposition agent (ingredient e) The laundry detergent composition of the present invention may contain at least one anti-redeposition polymer (=component e)).

[0164] Anti-redeposition ability refers to the ability to prevent soils that have been removed from textiles by washing from re-adhering to the same textiles. Generally, the polymer builder materials (e.g., the aforementioned polymer builder c)) have multiple functions and can be used as anti-redeposition agents and / or anti-soiling agents. Examples of specific polymer compounds that can be advantageously used as anti-redeposition agents are listed below. However, other polymer builders c) are also suitable for this purpose.

[0165] Suitable examples of anti-redeposition polymeric agents e) include graft copolymers of polyalkylene oxide and vinyl acetate, styrene-maleic anhydride copolymers, acrylic acid-maleic acid copolymers, and cellulose derivatives such as hydroxyethyl cellulose, hydroxypropyl cellulose, and carboxymethyl cellulose.

[0166] The laundry detergent composition of the present invention preferably contains an anti-redeposition agent in an amount of at least 0 to 20% by mass, preferably 0.1 to 15% by mass, and particularly preferably 0.5 to 10% by mass, based on the total mass of the composition.

[0167] bleach (ingredient f) The term "bleaching agent" as used herein is intended to include bleaching systems when they include bleach activators, bleach catalysts and / or bleach stabilizers.

[0168] When the laundry detergent composition of the present invention contains at least one bleaching agent (component f), it preferably contains 0 to 30% by weight, more preferably 0 to 25% by weight, based on the weight of the total composition. When the laundry detergent composition contains at least one bleaching agent, it preferably contains at least 0.5% by weight, more preferably at least 1% by weight, based on the weight of the total composition. When the bleaching agent contains multiple components, the above amounts refer to the sum of all components of the bleaching system.

[0169] Examples of suitable bleaching agents include carboxylic acid peroxides such as diperoxododecanedicarboxylic acid, phthalimidopercaproic acid, or monoperoxophthalic or terephthalic acid, salts of carboxylic acid peroxides (e.g., sodium percarbonate), adducts of hydrogen peroxide with inorganic salts (e.g., sodium perborate monohydrate, sodium perborate tetrahydrate, sodium percarbonate, sodium perphosphate), adducts of hydrogen peroxide with organic compounds (e.g., urea peroxide), or inorganic peroxide salts (e.g., alkali metal persulfates and perdisulfates).

[0170] Examples of suitable bleach activators include polyacylated sugars (e.g., pentaacetylglucose), acyloxybenzenesulfonic acid and its alkali metal salts, alkali. Earth metal salts (e.g., sodium p-nonanoyloxybenzenesulfonate, sodium p-benzoyloxybenzenesulfonate), N,N-diacylated and N,N,N',N'-tetraacylated amines (e.g., N,N,N',N'-tetraacetylmethylenediamine, N,N,N',N'-tetraacetylethylenediamine (TAED), N,N-diacetylaniline, N,N-diacetyl-p-toluidine), 1,3-diacylated hydantoins (e.g., 1,3-diacetyl-5,5-dimethylhydantoin), N-alkyl-N-sulfonylcarbamate, N-acylated cyclic hydrazides (e.g., N-methyl-N-mesylacetamide, N-methyl-N-mesylbenzamide), N-acylated cyclic hydrazides, acylated triazoles, or urazoles (e.g., monoacetylmaleic hydrazide), O,N,N-trisubstituted hydroxylamines (e.g., O-benzoyl-N,N-succinylhydroxylamine, O-acetyl-N,N-succinylhydroxylamine, O,N,N-triacetylhydroxylamine), N,N'-diacylsulfurylamides (e.g., N,N'-dimethyl-N,N'-diacetylsulfurylamide, N, N'-diethyl-N,N'-dipropionylsulfurylamide), acylated lactams (e.g., acetylcaprolactam, octanoylcaprolactam, benzoylcaprolactam, carbonylbiscaprolactam), anthranil derivatives (e.g., 2-methylanthranil, 2-phenylanthranil), triacylcyanurates (e.g., triacetylcyanurate, tribenzoylcyanurate), oxime esters and bisoxime esters (e.g., O-acetylacetone oxime, bisisopropyliminocarbonate), acid anhydrides (e.g., acetic anhydride , benzoic anhydride, m-chlorobenzoic anhydride, phthalic anhydride), enol esters (e.g., isopropenyl acetate), 1,3-diacyl-4,5-diacyloxyimidazolines (e.g., 1,3-diacetyl-4,5-diacetoxyimidazoline), tetraacetyl glycoluril, tetrapropionyl glycoluril, diacylated 2,5-diketopiperazines (e.g., 1,4-diacetyl-2,5-diketopiperazine), ammonium-substituted nitriles (e.g., N-methylmorpholinioacetonitrile methyl sulfate), propylene diurea and 2,Acylation products of 2-dimethylpropylene diurea (e.g., tetraacetylpropylene diurea), α-acyloxypolyacylmalonamides (e.g., α-acetoxy-N,N'-diacetylmalonamide), diacylated dioxohexahydro-1,3,5-triazines (e.g., 1,5-diacetyl-2,4-dioxohexahydro-1,3,5-triazine), benzo(4H)-1,3-oxazin-4-ones (those with an alkyl or aromatic group at the 2-position, e.g., methyl, phenyl).

[0171] Bleaching systems consist of a bleaching agent, a bleach activator, and may also contain a bleach catalyst. Examples of suitable bleach catalysts include quaternized imines and sulfonimines (e.g., as described in U.S. Pat. No. 5,360,569 and EP-A-453003). Particularly effective bleach catalysts include manganese complexes (e.g., as described in WO 94 / 21777). In addition to the aforementioned bleaching systems consisting of a bleaching agent, a bleach activator, and an optional bleach catalyst, systems based on enzymatic peroxide release can also be used.

[0172] Other additives (ingredient g) The laundry detergent composition of the present invention may contain at least one additive different from the components a) to f).

[0173] The additives suitable for the laundry detergent composition of the present invention are, in principle, typical additives known to those skilled in the art. In the following, application examples and preferred embodiments of some additives are specified in detail.

[0174] The laundry detergent composition of the present invention may contain at least one additive (component g)) different from components a) to f) in an amount of preferably 0 to 90 mass %, more preferably 0 to 80 mass %, based on the total mass of the composition. This amount is based on the total amount of all additives. Specific contents of each additive are shown below. Note that when the laundry detergent composition contains at least one If further additives are included, the amount thereof is preferably at least 0.01% by weight, more preferably at least 0.1% by weight, based on the total weight of the composition.

[0175] Further additives are preferably selected from rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, flavorings, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, antimicrobial components, antioxidants, and mixtures thereof.

[0176] Rheology Modifiers At least one rheology modifier can be used to impart a desired viscosity to liquid, particularly water-containing laundry detergent compositions. In the present context, the terms "rheology modifier" and "thickener" are used interchangeably.

[0177] The laundry detergent composition of the present invention preferably contains at least one rheology modifier in an amount of 0 to 10% by weight, more preferably 0 to 8% by weight, and particularly preferably 0 to 6% by weight, based on the total weight of the composition. When the laundry detergent composition contains at least one bleaching agent, the amount of the rheology modifier is preferably at least 0.1% by weight, more preferably at least 0.3% by weight, based on the total weight of the composition.

[0178] In principle, any known rheology modifier (thickener) can be used and applied as long as it does not adversely affect the function of the detergent composition.

[0179] Suitable thickening agents include those of natural origin or synthetic origin.

[0180] Examples of naturally occurring thickeners include xanthan, carob seed flour, guar flour, carrageenan, agar, tragacanth, gum arabic, alginates, modified starches (e.g., hydroxyethyl starch, starch phosphate esters, or starch acetate), dextrin, pectin, and also cellulose derivatives (e.g., carboxymethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose, methylcellulose, etc.).

[0181] Examples of synthetic thickeners include polyacrylic and polymethacrylic compounds. Such compounds include (partially) crosslinked homopolymers of acrylic acid crosslinked with allyl ethers of sucrose or pentaerythritol, or with propylene (known as carbomers). Examples of these carbomers include Lubrizol's Carbopol® products and 3V Sigma's Polygel® products. Other examples include copolymers of ethylenically unsaturated monocarboxylic or dicarboxylic acids, such as acrylic acid, methacrylic acid, or maleic acid, with methyl acrylate or ethyl acrylate, and (meth)acrylates derived from long-chain ethoxylated alcohols. Examples of such copolymers include the Acusol® products from Dow. Further examples include copolymers of two or more monomers selected from acrylic acid, methacrylic acid, and their C1-C4 alkyl esters. Examples of such copolymers include copolymers of methacrylic acid, butyl acrylate, and methyl methacrylate, or copolymers of butyl acrylate and methyl methacrylate. Examples of these include Dow's Aculyn® and Acusol® products. Yet another example is a crosslinked high molecular weight acrylic acid copolymer, such as a copolymer of a C10-C30 alkyl acrylate and one or more members selected from acrylic acid, methacrylic acid, and their C1-C4 alkyl esters, crosslinked with an allyl ether of sucrose or pentaerythritol.

[0182] Suitable synthetic thickeners also include reaction products of maleic acid polymers with ethoxylated long chain alcohols, polyethylene glycols, polyamides, polyimines, and polycarboxylic acids.

[0183] Mixtures of two or more of the above thickeners are also suitable.

[0184] Preferred thickeners are xanthan and the polyacrylic and polymethacrylic acid compounds mentioned above.

[0185] pH adjuster Laundry detergent compositions may contain at least one pH adjuster (pH modifier) ​​to adjust the pH of the composition and / or the pH of the resulting rinse solution under use conditions. In some embodiments, the laundry detergent composition contains at least one pH adjuster selected from acids, bases, and pH buffer systems. The laundry detergent composition can be formulated to provide a desired pH value for the rinse solution when used, for example, in an aqueous solution during a dishwashing process. For example, liquid laundry detergents desirably have a pH value of 7.0 to 10.0, preferably 7.0 to 9.0. Techniques for controlling pH at recommended use levels, i.e., the use of acids, bases, buffers, etc., are well known to those skilled in the art.

[0186] Suitable bases (also called alkalinity sources or alkali retention agents) are alkali metal hydroxides, alkaline earth metal hydroxides, alkali metal carbonates, alkaline earth metal carbonates, ammonium carbonate, alkali metal bicarbonates, alkaline earth metal bicarbonates, ammonium bicarbonate, alkali metal silicates, and mixtures of the above.

[0187] Suitable acids are carboxylic acids, hydroxycarboxylic acids, and phosphoric acids. Preferred acids are selected from citric acid, gluconic acid, tartaric acid, glucoheptonic acid, mucinic acid, galactonic acid, saccharinic acid, fumaric acid, succinic acid, glutaric acid, adipic acid, and phosphoric acid. Particularly preferred is citric acid.

[0188] Hydrotrope Hydrotropes are ingredients that function as viscosity modifiers, gel inhibitors, stabilizers, and / or dispersing aids. Commonly used hydrotropes include alcohols and their derivatives, including glycols and alkoxylated alcohols. Suitable hydrotropes for use in the present invention also include anionic hydrotropes, particularly sodium, potassium, and ammonium xylene sulfonate; sodium, potassium, and ammonium toluene sulfonate; sodium, potassium, and ammonium cumene sulfonate; dialkyl sulfosuccinates, alkyl naphthalene sulfonates; and mixtures thereof. Dialkyl sulfosuccinates and alkyl naphthalene sulfonates are also referred to as the aforementioned anionic surfactants. In particular, the hydrotrope may be selected from sodium cumene sulfonate, sodium xylene sulfonate, sodium toluene sulfonate, dihexyl sodium sulfosuccinate, dioctyl sodium sulfosuccinate, alkyl naphthalene sulfonates, and mixtures thereof.

[0189] The laundry detergent compositions of the present invention preferably contain 0 to 15 wt %, more preferably 0 to 12 wt %, and most preferably 0 to 10 wt % of at least one hydrotrope, based on the total weight of the composition. If the composition contains at least one hydrotrope, the amount is at least 0.1 wt %, more preferably at least 0.2 wt %, and most preferably at least 0.5 wt %, based on the total weight of the composition.

[0190] Optical brighteners The laundry detergent composition of the present invention may contain an optical brightener. The optical brightener is preferably selected from hydrophobic optical brighteners, stilbene-type optical brighteners, biphenyl-type optical brighteners, or mixtures thereof. Examples of suitable optical brighteners include distyrylbiphenyl compounds (e.g., Tinopal® CBS-X), diaminostilbene disulfonic acid compounds (e.g., Tinopal® DMS pure Xtra, Blankophor® HRH), pyrazoline compounds (e.g., Blankophor® SN), and coumarin compounds (e.g., Tinopal® SWN).

[0191] The content of the fluorescent brightener is usually in the range of 0.05 to 2% by mass, preferably 0.1 to 1.5% by mass, and more preferably 0.2 to 1.0% by mass, based on the total mass of the composition.

[0192] Antifoaming agents / foam suppressors / foam suppressors Useful suds suppressors (also called antifoam agents or suds suppressors) include, for example, silicone oil, alkyl phosphate esters, soap, paraffin, or combinations thereof.

[0193] The laundry detergent composition of the present invention preferably contains at least one antifoaming agent in an amount of 0 to 10% by mass, more preferably 0 to 5% by mass, and particularly preferably 0 to 1.5% by mass, based on the total mass of the composition. When the laundry detergent composition contains at least one antifoaming agent, the amount is at least 0.0001% by mass, more preferably at least 0.001% by mass, and particularly preferably at least 0.01% by mass, based on the total mass of the composition.

[0194] antibacterial agents In one embodiment, the laundry detergent composition of the present invention can include at least one antimicrobial agent (bactericide). Suitable antimicrobial agents include, in particular, quaternary ammonium compounds. Quaternary ammonium compounds and their use in rinse aid formulations are described in U.S. Patent Application No. US2022386598. Preferably, the antimicrobial quaternary ammonium compound is selected from C12-C16 alkyldimethylbenzylammonium chloride, didecyldimethylammonium chloride, dioctyldimethylammonium chloride, octyldecyldimethylammonium chloride, or a combination thereof. Further examples of quaternary ammonium compounds include benzethonium chloride, ethylbenzylalkonium chloride, myristyltrimethylammonium chloride, methylbenzethonium chloride, cetalkonium chloride, cetrimonium bromide (CTAB), carnitine, dophanium chloride, tetraethylammonium bromide (TEAB), domiphen bromide, benzododecinium bromide, benzoxonium chloride, choline, cocamidopropyl betaine (CAPB), denatonium, and mixtures thereof. These antimicrobial agents provide broad-spectrum antimicrobial activity against a wide variety of microorganisms, including aerobic and anaerobic microorganisms, gram-positive and gram-negative microorganisms, as well as bacteria, yeasts, molds, fungi, algae, and other problematic microorganisms.

[0195] Organic solvent (component h) Suitable organic solvents are selected from monohydric or polyhydric alcohols, alkanolamines, glycol ethers, preferably ethanol, n-propanol, isopropanol, n-butanol, isobutanol, n-pentanol, isopentanol, n-hexanol, isohexanol, glycol, propanediol, butanediol, glycerol, diglycol, propyl diglycol, butyl diglycol, hexylene glycol, ethylene glycol methyl ether, ethylene glycol ethyl ether, ethylene glycol propyl ether, ethylene glycol mono-n-butyl ether, diethylene glycol methyl ether, diethylene glycol ethyl ether, propylene glycol The organic solvent is selected from the group consisting of ethanol, n-propanol, isopropanol, n-butanol, glycerol, ethylene glycol, diethylene glycol, propylene glycol, polyethylene glycol, 1,3-butanediol, 1,4-butanediol, dipropylene glycol, and mixtures thereof.

[0196] In one embodiment, the laundry detergent composition of the present invention is a liquid preparation. Liquid laundry detergents generally contain water as a solvent. In addition, the liquid detergent composition may contain at least one organic solvent that is completely or at least partially miscible with water. Preferably, the liquid laundry detergent composition contains 0 to 10% by weight, more preferably 0 to 5% by weight, of at least one organic solvent, based on the total weight of the composition.

[0197] In one embodiment, the laundry detergent composition of the present invention is a unit dose formulation. Unit dose formulations generally contain at least one organic solvent instead of or in addition to water. In certain embodiments, the unit dose formulation contains at least one organic solvent and no added water. Preferably, the unit dose formulation of the laundry detergent composition contains 5 to 40 wt. %, more preferably 7.5 to 35 wt. %, and especially 10 to 30 wt. % of the at least one organic solvent, based on the total weight of the composition.

[0198] Water (component i) The laundry detergent compositions of the present invention may contain water or may not contain any added water.

[0199] In one embodiment, the laundry detergent composition of the present invention is a liquid preparation. The liquid laundry detergent preferably comprises 20 to 90% by weight, more preferably 40 to 80% by weight, of water, based on the total weight of the composition.

[0200] In another embodiment, the laundry detergent compositions of the present invention are unit dose formulations. As mentioned above, unit dose formulations contain no added water or only a small amount of water to ensure that the water-soluble polymer is stable before use in the wash. Preferably, laundry detergent compositions in the form of unit dose formulations comprise at most 10% by weight of water, more preferably at most 5% by weight, particularly at most 1% by weight, and even more particularly at most 0.5% by weight of water, based on the total weight of the composition. In particular embodiments, the unit dose formulations do not contain any added water.

[0201] In a particular embodiment, the liquid laundry detergent composition of the present invention comprises: a) 0.0005 to 2.5% by weight of at least one structural polypeptide, based on the total weight of the composition; b1) 10 to 50% by weight of at least one anionic surfactant, based on the total weight of the composition; b2) 3.0 to 15% by weight of at least one nonionic surfactant, based on the total weight of the composition; c) 1.0 to 15% by weight of at least one builder, based on the total weight of the composition; d) 0 to 8% by weight (preferably 0.005 to 8% by weight, in particular 0.01 to 5% by weight) of at least one enzyme, based on the proportion of enzyme protein in the total weight of the composition; e) 0 to 20% by weight (preferably 0.1 to 15% by weight, in particular 0.5 to 10% by weight) of at least one polymeric anti-redeposition agent, based on the total weight of the composition; f) 0 to 20% by weight (preferably at least 0.5% by weight, more preferably at least 1% by weight) of at least one bleaching agent, based on the total weight of the composition; g) 0 to 80% by weight (preferably at least 0.01% by weight, more preferably at least 0.1% by weight) of at least one additive different from components a) to f), based on the total weight of the composition, preferably selected from surfactants other than anionic surfactants and nonionic surfactants, rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, fragrances, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, antimicrobial components, antioxidants, and mixtures thereof; h) 0 to 10% by mass (preferably 5 to 10% by mass) of at least one organic solvent based on the total mass of the composition; i) 20 to 90 mass % of water based on the total mass of the composition Includes:

[0202] The composition may be in the form of a concentrated liquid with a low water content, preferably with a water content in the range of 10 to 40% by weight of the total weight.

[0203] A more particular embodiment is a (fully) liquid unit dose laundry detergent composition having a water-soluble packaging or coating, a) 0.0005 to 2.5% by weight of at least one structural polypeptide, based on the total weight of the composition; b1) 10 to 50% by weight of at least one anionic surfactant, based on the total weight of the composition; b2) 3 to 25% by weight of at least one nonionic surfactant, based on the total weight of the composition; c) 0.5 to 10.0% by weight of at least one builder, based on the total weight of the composition; d) 0 to 8% by weight (preferably 0.005 to 8% by weight, in particular 0.01 to 5% by weight) of at least one enzyme, based on the proportion of enzyme protein in the total weight of the composition; e) 0 to 5.0% by mass (preferably 0.1 to 5.0% by mass) of at least one polymeric anti-redeposition agent based on the total mass of the composition; g) 0 to 80% by weight (preferably at least 0.01% by weight, more preferably at least 0.1% by weight) of at least one further additive different from components a) to f), based on the total weight of the composition, preferably selected from surfactants other than anionic surfactants and nonionic surfactants, rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, fragrances, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, antimicrobial components, antioxidants and mixtures thereof; h) 5 to 40% by mass of at least one organic solvent, based on the total mass of the composition; i) at most 5% by weight, in particular at most 1% by weight, particularly preferably at most 0.5% by weight, of water, based on the total weight of the composition Includes:

[0204] A more particular embodiment is a (fully) solid unit dose laundry detergent composition having a water-soluble packaging or coating, a) 0.0005 to 2.5% by weight of at least one structural polypeptide, based on the total weight of the composition; b1) 10 to 50% by weight of at least one anionic surfactant, based on the total weight of the composition; b2) 3 to 15% by weight of at least one nonionic surfactant, based on the total weight of the composition; c) 1 to 80% by mass of at least one builder (preferably comprising at least one aluminosilicate, and optionally one or more further aluminosilicates) based on the total mass of the composition Builder), d) 0 to 8% by weight (preferably 0.005 to 8% by weight, in particular 0.01 to 5% by weight) of at least one enzyme, based on the proportion of enzyme protein in the total weight of the composition; e) 0 to 5% by mass (preferably 0.1 to 5.0% by mass) of at least one polymeric anti-redeposition agent based on the total mass of the composition; f) 0 to 30% by weight (preferably at least 0.5% by weight, more preferably at least 1% by weight) of at least one bleaching agent, based on the total weight of the composition; g) 0 to 80% by weight (preferably at least 0.01% by weight, more preferably at least 0.1% by weight) of at least one further additive different from components a) to f), based on the total weight of the composition, preferably selected from surfactants other than anionic surfactants and nonionic surfactants, rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, fragrances, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, antimicrobial components, antioxidants and mixtures thereof, h) up to 5% by weight of at least one organic solvent, based on the total weight of the composition; i) up to 5% by weight of water, based on the total weight of the composition Includes:

[0205] The solid unit dose laundry detergent composition preferably comprises at least one builder, more preferably at least one aluminosilicate, and especially at least one zeolite, in an amount of 5 to 80% by weight, more preferably 10 to 65% by weight, and especially 15 to 50% by weight, based on the total weight of the composition.

[0206] The solid unit dose laundry detergent composition preferably has a water content of less than 5% by weight, more preferably less than 1% by weight, especially less than 0.1% by weight, based on the total weight of the composition.

[0207] The solid unit dose laundry detergent composition preferably contains less than 5% by weight, more preferably less than 3% by weight, especially less than 1% by weight of organic solvent based on the total weight of the composition.

[0208] The above examples are intended to illustrate, but not limit, the possibilities for formulating laundry detergents of the present invention. Thus, laundry detergent compositions of the present invention can be in liquid unit dose form, fully solid unit dose form, or can include both liquid and solid components.

[0209] In all the above aspects / embodiments, the structural polypeptide, particularly the silk polypeptide, is preferably present in the laundry detergent composition in the form of a gel, particularly a hydrogel.

[0210] This invention is susceptible to various modifications and variations that will be apparent to those skilled in the art without departing from its scope. Although the invention has been described in connection with specific preferred embodiments, it should be noted that the invention as claimed should not be unduly limited to those specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the relevant fields are intended to be within the scope of the present invention. DETAILED DESCRIPTION OF THE INVENTION

[0211] 1.a) a structural polypeptide, and b) at least one surfactant A laundry detergent composition comprising:

[0212] 2. The laundry detergent of embodiment 1, wherein the structural polypeptide a) is a silk polypeptide. A detergent composition.

[0213] 3. The laundry detergent composition of embodiment 2, wherein the silk polypeptide is a recombinant silk polypeptide or a synthetic silk polypeptide, preferably a spider silk polypeptide.

[0214] 4. The silk polypeptide is - comprising or consisting of a protein chain that does not have at least two units of the same sequence motif (single unit of amino acid), or - comprising or consisting of at least two identical repeating units, 4. The laundry detergent composition of embodiment 2 or 3.

[0215] 5. The laundry detergent composition of any one of embodiments 2-4, wherein the silk polypeptide does not comprise any non-repeating units.

[0216] 6. The laundry detergent composition of embodiment 4 or 5, wherein the single or repeating units are independently selected from the group consisting of: - a module C having the amino acid sequence of SEQ ID NO: 1 or a variant thereof, - Module C having the amino acid sequence of SEQ ID NO: 2 or a variant thereof Cys - module C having the amino acid sequence of SEQ ID NO: 3 or a variant thereof Lys

[0217] 7. The silk polypeptide is (C)m, (C)mC Cys , (C)mC Lys , C Cys (C)m, C Lys (C)m, (C Cys )m and (C Lys 7. The laundry detergent composition of any one of embodiments 2-6, wherein the hydroxyl group is selected from the group consisting of hydroxyl group (C1) and hydroxyl group (D2), where m is an integer from 1 to 96.

[0218] The silk polypeptides are C1, C2, C3, C4, C5, C6, C7, C8, C 16 , C 32 , C 48 , (C)1C Cys , (C)2C Cys , (C)3C Cys , (C)4C Cys , (C)5C Cys , (C)6C Cys , (C)7C Cys , (C)8C Cys , (C) 16 C Cys , (C) 32 C Cys , (C) 48 C Cys , (C)1C Lys , (C)2C Lys , (C)3C Lys , (C)4C Lys , (C)5C Lys , (C)6C Lys , (C)7C Lys , (C)8C Lys , (C)16 C Lys 、(C) 32 C Lys 、(C) 48 C Lys 、C Cys (C)1、C Cys (C)2、C Cys (C)3、C Cys (C)4、C Cys (C)5、C Cys (C)6、C Cys (C)7、C Cys (C)8、C Cys (C) 16 、C Cys (C) 32 、C Cys (C) 48 、C Lys (C)1、C Lys (C)2、C Lys (C)3、C Lys (C)4、C Lys (C)5、C Lys (C)6、C Lys (C)7、C Lys (C)8、C Lys (C) 16 、C Lys (C) 32 、C Lys (C) 48 、C Cys 1、C Cys 2、C Cys 3、C Cys 4、C Cys 5、C Cys 6、C Cys 7、C Cys 8、C Cys 16 、C Cys 32 、C Cys 48 、C Lys 1、C Lys 2、C Lys 3、C Lys 4、C Lys 5、C Lys 6、C Lys 7、C Lys 8、C Lys 16 、C Lys 32 and C Lys 488. The laundry detergent composition of embodiment 7, wherein the composition is selected from the group consisting of:

[0219] 9. A laundry detergent composition according to any of the previous embodiments, comprising 0.0005 to 2.5% by weight, preferably 0.001 to 2.0% by weight, and particularly 0.005 to 1.5% by weight, of at least one structural polypeptide (component a)), based on the total weight of the composition.

[0220] 10.b1) at least one anionic surfactant, and b2) optionally at least one nonionic surfactant The laundry detergent composition according to any one of the preceding embodiments,

[0221] 11. The laundry detergent composition according to any of the previous embodiments, comprising 3 to 60% by weight, preferably 5 to 50% by weight, and in particular 7 to 45% by weight, of at least one anionic surfactant b1), based on the total weight of the composition.

[0222] 12. The laundry detergent composition of any of the previous embodiments, comprising 0 to 40% by weight, preferably 1 to 30% by weight, and in particular 2.5 to 25% by weight, of at least one nonionic surfactant b2), based on the total weight of the composition.

[0223] 13. A laundry detergent composition according to any of the previous embodiments, comprising at least one builder (component c)).

[0224] 14. The laundry detergent composition of any of the previous embodiments, comprising at least 0.1%, preferably at least 0.5%, and in particular at least 1% by weight of at least one builder (component c)), based on the total weight of the composition.

[0225] 15. A laundry detergent composition of any preceding embodiment comprising at least one enzyme (component d)).

[0226] 16. A laundry detergent composition according to any of the previous embodiments, comprising at least 0.001% by weight, preferably at least 0.01% by weight, particularly preferably at least 0.05% by weight, of at least one enzyme d) as enzyme protein, based on the total weight of the composition.

[0227] 17. A laundry detergent composition according to any of the previous embodiments, comprising at least one polymeric anti-redeposition agent (component e)).

[0228] 18. The laundry detergent composition according to any of the previous embodiments, comprising 0 to 20% by mass, preferably 0.1 to 15% by mass, and particularly 0.5 to 10% by mass of at least one polymer anti-redeposition agent (component e)), based on the total mass of the composition.

[0229] 19. A laundry detergent composition of any of the previous embodiments comprising at least one bleaching agent (component f)).

[0230] 20. The laundry detergent composition of any of the previous embodiments, comprising 0 to 30% by weight, preferably 0.1 to 25% by weight, of at least one bleaching agent (component f)), based on the total weight of the composition.

[0231] 21. The laundry detergent composition of any preceding embodiment, further comprising at least one additive (component g)) different from components a) to f), preferably selected from surfactants other than anionic surfactants and nonionic surfactants, rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, fragrances, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, antimicrobial components, antioxidants, and mixtures thereof.

[0232] 22. The laundry detergent composition of any preceding embodiment, comprising at least one organic solvent (component h)).

[0233] 23. A laundry detergent composition according to any of the previous embodiments, comprising water (component i)).

[0234] 24. The liquid laundry detergent composition according to any one of the above embodiments 1 to 23, a) 0.0005 to 2.5% by weight of at least one structural polypeptide, based on the total weight of the composition; b1) 10 to 50% by weight of at least one anionic surfactant, based on the total weight of the composition; b2) 3.0 to 15% by mass of at least one nonionic surfactant based on the total weight of the composition; c) 1.0 to 15% by mass of at least one builder based on the total weight of the composition; d) 0 to 8% by weight (preferably 0.005 to 8% by weight, in particular 0.01 to 5% by weight) of at least one enzyme, based on the proportion of enzyme protein in the total weight of the composition; e) 0 to 20% by weight (preferably 0.1 to 15% by weight, in particular 0.5 to 10% by weight) of at least one polymeric anti-redeposition agent, based on the total weight of the composition; f) 0 to 20% by weight (preferably at least 0.5% by weight, more preferably at least 1% by weight) of at least one bleaching agent, based on the total weight of the composition; g) 0 to 80% by weight (preferably at least 0.01% by weight, more preferably at least 0.1% by weight) of at least one additive different from components a) to f), based on the total weight of the composition, preferably selected from surfactants other than anionic surfactants and nonionic surfactants, rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, fragrances, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, antimicrobial components, antioxidants, and mixtures thereof; h) 0 to 10% by weight (preferably 5 to 10% by weight) of at least one organic solvent, based on the total weight of the composition; i) 20 to 90 mass % of water based on the total weight of the composition Includes:

[0235] 25. The laundry detergent composition of any one of embodiments 1-23 above, wherein the laundry detergent composition is a liquid unit dose formulation having a water-soluble packaging or coating, a) 0.0005 to 2.5% by weight of at least one structural polypeptide, based on the total weight of the composition; b1) 10 to 50% by weight of at least one anionic surfactant, based on the total weight of the composition; b2) 3 to 25% by weight of at least one nonionic surfactant, based on the total weight of the composition; c) 0.5 to 10.0% by weight of at least one builder, based on the total weight of the composition; d) 0 to 8% by weight (preferably 0.005 to 8% by weight, in particular 0.01 to 5% by weight) of at least one enzyme, based on the proportion of enzyme protein in the total weight of the composition; e) 0 to 5.0% by mass (preferably 0.1 to 5.0% by mass) of at least one polymeric anti-redeposition agent based on the total weight of the composition; g) 0 to 80% by weight (preferably at least 0.01% by weight, more preferably at least 0.1% by weight) of at least one additive different from components a) to f), based on the total weight of the composition, preferably selected from surfactants other than anionic surfactants and nonionic surfactants, rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, fragrances, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, antibacterial components, antioxidants, and mixtures thereof; h) 5 to 40% by weight of at least one organic solvent, based on the total weight of the composition; i) at most 5% by weight, in particular at most 1% by weight, particularly preferably at most 0.5% by weight, of water, based on the total weight of the composition Includes:

[0236] 26. The laundry detergent composition according to any one of the above embodiments 1 to 23 may be used in a water-soluble packaging material or is a solid unit dose formulation having a coating, a) 0.0005 to 2.5% by weight of at least one structural polypeptide, based on the total weight of the composition; b1) 10 to 50% by weight of at least one anionic surfactant, based on the total weight of the composition; b2) 3 to 15% by weight of at least one nonionic surfactant, based on the total weight of the composition; c) 1 to 80 mass % of at least one builder (preferably comprising at least one aluminosilicate, and optionally comprising one or more further builders), based on the total weight of the composition; d) 0 to 8% by weight (preferably 0.005 to 8% by weight, in particular 0.01 to 5% by weight) of at least one enzyme, based on the proportion of enzyme protein in the total weight of the composition; e) 0 to 5% by mass (preferably 0.1 to 5.0% by mass) of at least one polymeric anti-redeposition agent based on the total weight of the composition; f) 0 to 30% by weight (preferably 0.5% by weight or more, more preferably 1% by weight or more) of at least one bleaching agent based on the total weight of the composition; g) 0 to 80% by weight (preferably 0.01% by weight or more, more preferably 0.1% by weight or more) of at least one additive different from components a) to f), based on the total weight of the composition, preferably selected from surfactants other than anionic surfactants and nonionic surfactants, rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, fragrances, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, antibacterial components, antioxidants, and mixtures thereof; h) up to 5% by weight of an organic solvent, based on the total weight of the composition; i) up to 5% by weight of water, based on the total weight of the composition Includes:

[0237] 27. The laundry detergent composition of any of the above embodiments, wherein the laundry detergent composition is in liquid or gel form, or is a multi-compartment preparation, and the multi-compartment preparation comprises a structural polypeptide, preferably in gel form.

[0238] 28. A washing method using a washing machine, in which the laundry is brought into contact with the laundry detergent composition according to any one of the above embodiments 1 to 27 when washing the laundry.

[0239] 29. Use of a structural polypeptide, in particular a silk polypeptide, according to embodiments 2 to 8 in a laundry detergent composition.

[0240] 30. Use according to embodiment 29 of a structural polypeptide according to embodiments 2 to 8.

[0241] 31.- To improve or maintain the properties of textiles, in particular to improve or maintain at least one property selected from the following: i) the mechanical and / or use properties of the fabric; ii) the optical properties of the fabric; iii) the texture of the fabric and / or iv) Odor characteristics of textiles -Extending the life of fabrics, -reducing the amount of microfibers released during washing; - Eliminates the need for additional laundry care products; The use according to embodiment 29 or 30, characterized in that:

[0242] 32. Use of the laundry detergent composition of any one of embodiments 1 to 27 in treating laundry in a washing machine, -improving or maintaining the properties of textiles, in particular improving or maintaining at least one property selected from the following: i) the mechanical and / or use properties of the fabric; ii) the optical properties of the fabric; iii) the texture of the fabric and / or iv) Odor characteristics of textiles -Extending the life of fabrics, -reducing the amount of microfibers released during washing; - Eliminates the need for additional laundry care products; The use is characterized by: [Brief explanation of the drawings]

[0243] Please note that the following diagrams are for illustrative purposes only and are not intended to limit in any way the scope of the invention as defined in the appended claims.

[0244] [Figure 1] Figure 1 shows scanning electron microscopy (SEM) images of the surface structure of a virgin, untreated textile sample (65% polyester (PES) / 35% cotton (CO)) at 200x magnification, 500x magnification, and 1000x magnification, respectively. Abbreviations are in accordance with DIN EN ISO 2076:2014-03 (manmade fibers) and DIN 60001-1:2001-05 (natural fibers). [Figure 2] Figure 2 shows SEM images (A: 200x, B: 500x, C: 1000x) of the surface structure of a textile sample (65% PES / 35% CO) treated with Ecolabel LLD detergent. It can be seen that when treated with detergent alone (Figure 2), the textile sample is severely damaged compared to the untreated textile sample (see Figure 1). [Figure 3] Figure 3 shows SEM images of the surface structure of a textile sample (65% PES / 35% CO) treated with EcoLabel LLD detergent and silk gel (A: 200x, B: 500x, C: 1000x). Significant damage to the textile sample is evident when treated with detergent alone (Figure 2) compared to an untreated textile sample (see Figure 1). When treated with detergent alone (Figure 2), the combined use of detergent and silk gel (Figure 3) caused significantly less damage to the textile sample, demonstrating significantly better fiber protection. [Example]

[0245] The following examples are illustrative of laundry detergent compositions according to the present invention and are not intended to limit the scope of the invention described above.

[0246] Example 1 I) Detergent Preparations A liquid detergent composition was prepared using the following ingredients: [Table 1]

[0247] Comparative example: No structural protein used The present invention: A structural protein gel containing 3% by weight of silk protein is used. Even with the same detergent composition, it is possible to obtain a unit dose (detergent capsule, pod, pouch, etc.) detergent composition by replacing (almost) all of the water with an organic solvent such as glycol or glycerol.

[0248] II) Application examples 1.) Washing test conditions The washing test was carried out using a Bosch washing machine (Bosch Washmaschine Serie 6 WAG28400, 8 kg, 1400 U / min) on the "Jeans / Dunkle Wash" course with 3.5 kg of laundry.

[0249] The following standard fabric swatches (20 cm x 20 cm) were taken from normal textiles used in clothing manufacturing: 100% blue cotton (150 g / m 2 ), 100% blue polyester (PES, 150g / m 2 ), 100% blue polyamide (PA, 150g / m 2 In the test, these samples were washed 10 times using 35 mL of a laundry detergent without silk protein (comparative example) and a laundry detergent with silk protein (according to the present invention).

[0250] 2.) Fabric property testing Mechanical properties The fabrics were tested for tear strength according to EN ISO 13937 using a tensile tester (Zwick BT1-FK0.5N.D14 manufactured by Zwick / Roell GmbH & Co.KG). The tear strength was measured. Tear strength is defined as the force required to initiate or propagate a tear in a fabric. The average tear strength was determined as the average of 10 measurements for each sample. Tear strength is classified as "across warp" or "across weft" depending on whether the tear occurred in the warp direction (when the warp yarns break) or the weft direction (when the weft yarns break), respectively.

[0251] [Table 2] [Table 3] [Table 4]

[0252] As a result, fabric samples washed with detergent containing silk polypeptides showed a clear improvement in tear strength after washing compared to samples washed with detergent containing silk polypeptides but with the same detergent composition.

[0253] Color Test The color change was assessed instrumentally to determine the gray scale rating according to DIN EN ISO 105-A05:1997.

[0254] [Table 5] [Table 6] [Table 7]

[0255] The results showed that test fabrics washed in the presence of silk polypeptides showed a clear improvement in colorfastness after the washing process compared to fabric samples washed in the same detergent composition without silk polypeptides. The reduced abrasion of the fibers during washing reduces damage to the fibers, resulting in less fibrillation and less light scattering on the surface, which helps colors remain more vibrant.

[0256] flexibility A panel test was conducted on 10 general consumers (those without any special expertise regarding laundry detergents). The question to be answered was "Do you perceive a difference in softness between the two samples?" Consumers held an untreated control sample in one hand and a test sample, identified by a number, in the other. The test was blinded; consumers did not know which was the control sample and which was the sample being evaluated. Consumers were asked to rate "softness" on a scale from 0 = not soft to 5 = very soft. Results are the average of the 10 consumer ratings for each material.

[0257] [Table 8] [Table 9] [Table 10]

[0258] As a result, it was clearly recognized that fabric samples washed under conditions containing silk polypeptides showed a clear improvement in softness after washing compared to samples washed under conditions containing no silk polypeptides, even when using the same detergent composition.

[0259] Microfiber Loss Test The tests were conducted in a 1000 mL beaker, with 3.5 mL of detergent composition typically used in the main wash of a 10 L washing machine. Five fabric samples (6 g each) were used in each experiment to increase friction and release as many microfibers as possible, allowing for quantitative recording and statistical evaluation. The total weight of the fibers used in the experiments was 5 x 6 g = 30 g of PES textile fibers. In the comparative experiments, the detergent did not contain silk polypeptides, while the experiments based on the present invention did. Additionally, experiments were conducted using regular tap water (without washing) instead of the detergent composition to confirm the amount of microfibers lost from the textile itself. The tests were conducted on PES, the most common synthetic fiber used in consumer clothing. The temperature was set to 40°C and held for 1 hour, and the fabric samples were continuously agitated at medium agitation (30 rpm, stop-and-go cycles every 2 minutes). After treatment, the fabric samples were removed from the liquid. The liquid was filtered under slight vacuum using filter paper (Ahlstrom Filter Paper Grade 5, 2.5 cm). The filter was dried overnight at 80°C under slight vacuum. The weight difference of the filter paper before and after filtration of the washing liquid was recorded. The experiment was repeated three times for each of the comparative example and the inventive example.

[0260] [Table 11]

[0261] The results show that the presence of silk polypeptides significantly inhibits the release of microfibers from the tested polyester textile materials, compared to the same detergent composition without silk polypeptides and to the untreated original material. This effect can be explained by the protective effect of the silk polypeptide coating on the fibers.

[0262] conclusion Modern liquid laundry detergent compositions (including unit dose forms such as sachets, capsules, and pods) containing silk polypeptides at ppm-level concentrations have been shown to not only improve mechanical tear strength, color, and softness, but also reduce microfiber release due to mechanical abrasion.

[0263] Example 2 The test procedure is based on the Standard Operational Procedure for Quality Management (SOP-QM) for Comparative Testing of Detergents and Detergent Additives. 11 203 050 A :2023-05, Hohenstein Research Institute GmbH & Co. KG).

[0264] Materials and Methods Test fabrics: New and pilled colored fabrics Washing machine: Miele Softtronic W 1935 WPS WTL Washing course: Cotton, short cycle Washing temperature: 40℃ Laundry load (weight): 3kg Water hardness: (14±1.5)°dH((2.5±0.3)mmol / l) Drying method: Use a dryer and / or air dry

[0265] result 1) Color retention: Measurements of color retention were performed using a color measuring device. Color difference was calculated based on the DIN 6174:2007-10 standard, measuring lightness, hue, and saturation. The test was performed using new, untreated fabric. Three test samples (sample numbers 1 to 3) taken from the same untreated fabric were used for the test. A lower measurement value indicates a smaller color difference.

[0266] The color difference measurements for color retention are shown in the table below. [Table 12]

[0267] The test fabrics were washed and treated with the following detergents: A: Silk-free laundry detergent composition (-Silk) B: Silk-containing laundry detergent composition (+silk)

[0268] Silk-free laundry detergent composition (-Silk): 35.8g of Eco-label certified liquid detergent (LLD) Silk-containing laundry detergent composition (+Silk): Spider silk hydrogel (18.5g) dissolved in 100g of water was added to 35.8g of eco-labeled liquid detergent (LLD).

[0269] The experimental results show that the test fabrics treated or washed with the silk-containing composition (+silk) have better color retention.

[0270] 2) Surface maintenance: The surface texture changes of new, untreated fabrics were visually evaluated by a panel and ranked on a 5-point scale (1 = very good, 5 = very poor). The best product was ranked 1st. Two samples (sample numbers 1 to 3) of new, untreated fabrics were used. The fabrics were washed 20 times.

[0271] The results of the surface texture tests are shown in the table below. [Table 13]

[0272] The test fabrics were washed and treated with the following detergents: A: Silk-free laundry detergent composition (-Silk) B: Silk-containing laundry detergent composition (+silk)

[0273] Silk-free laundry detergent composition (-Silk): 35.8g of Eco-label certified liquid detergent (LLD) Silk-containing laundry detergent composition (+Silk): Spider silk hydrogel (18.5g) dissolved in 100g of water was added to 35.8g of eco-labeled liquid detergent (LLD).

[0274] The experimental results show that the test fabrics treated or washed with the silk-containing composition (+silk) have a better surface texture.

[0275] The surface texture changes of the pilled fabrics were visually evaluated by a panel and ranked on a 5-point scale (1 = very good, 5 = very poor). The best product was ranked 1st. Two samples (sample numbers 1 to 3) of pilled fabrics were used. In one case, the fabrics were washed 10 times and in the other case, 20 times.

[0276] The results of the surface texture tests are shown in the table below. [Table 14]

[0277] The test fabrics were washed and treated with the following detergents: A: Silk-free laundry detergent composition (-Silk) B: Silk-containing laundry detergent composition (+silk)

[0278] Silk-free laundry detergent composition (-Silk): 35.8g of Eco-label certified liquid detergent (LLD) Silk-containing laundry detergent composition (+Silk): Spider silk hydrogel (18.5g) dissolved in 100g of water was added to 35.8g of eco-labeled liquid detergent (LLD).

[0279] The experimental results show that the balled fabrics treated or washed with the silk-containing composition (+silk) have a better surface texture.

[0280] 3) Softness / Hand Feel: Softness / handle was evaluated by five experts with extensive experience in sensory evaluation of washing tests (SOP-QM 11 2 02 020:2023-02; Hohenstein Institute GmbH & Co. KG). The change in softness after 10 and 20 washes and rinses of the terry cloth fabric was evaluated on a 5-point scale (1 = very soft, 5 = very hard).

[0281] The results of the softness test are shown in the table below. [Table 15]

[0282] The test fabrics were washed and treated with the following detergents: A: Silk-free laundry detergent composition (-Silk) B: Silk-containing laundry detergent composition (+silk)

[0283] Silk-free laundry detergent composition (-Silk): 35.8g of Eco-label certified liquid detergent (LLD) Silk-containing laundry detergent composition (+Silk): Spider silk hydrogel (18.5g) dissolved in 100g of water was added to 35.8g of eco-labeled liquid detergent (LLD).

[0284] The experimental results show that terry cloth fabric washed and treated with a solution containing silk (+silk) feels softer to the touch than terry cloth fabric washed and treated with a solution not containing silk (-silk).

[0285] 4) Scanning electron microscope (SEM) analysis: The experiment was performed using a JEOL JSM-IT500LA scanning electron microscope (SEM) with a secondary electron detector. The JSM-IT500LA is a high-resolution scanning electron microscope capable of observation in low vacuum mode and equipped with a tungsten hairpin electrode. Gold was evaporated onto the sample surface to make it uniformly conductive. The accelerating voltage was set in the range of 3.0 to 8.0 kV.

[0286] The results are shown in Figures 1–3. Figure 1 shows scanning electron microscopy (SEM) images of the surface structure of a new, untreated textile sample (65% polyester (PES) / 35% cotton (CO)) (A: 200x, B: 500x, C: 1000x). Abbreviations are based on DIN EN ISO 2076:2014-03 (chemical fibers) and DIN 60001-1:2001-05 (natural fibers). Figure 2 shows SEM images of the surface structure of a textile sample (65% PES / 35% CO) treated with Ecolabel LLD detergent (A: 200x, B: 500x, C: 1000x). Treatment with detergent alone (Figure 2) shows significant damage to the textile sample compared to the untreated textile sample (see Figure 1). Figure 3 shows SEM images of the surface structure of a textile sample (65% PES / 35% CO) treated with EcoLabel LLD detergent and silk gel (A: 200x, B: 500x, C: 1000x). Significant damage to the textile sample is evident when treated with detergent alone (Figure 2) compared to an untreated textile sample (see Figure 1). When treated with detergent alone (Figure 2), the combined use of detergent and silk gel (Figure 3) caused significantly less damage to the textile sample, demonstrating significantly better fiber protection.

[0287] In the above experiments, spider silk polypeptide C 16 It is preferable to use [Sequence List Free Text]

[0288] AA sequence for sequence listing C X Module SEQ ID NO: 1 (Module C): GSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGP SEQ ID NO: 2 (Module C Cys ): GSSAAAAAAAASGPGGYGPENQGPCGPGGYGPGGP SEQ ID NO: 3 (moduleC Lys ): GSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGP TAG and linker SEQ ID NO: 4 (T7-TAG) MASMTGGQQMG SEQ ID NO: 5 (リンカー) RGSM C x 16-Protein SEQ ID NO: 6 (C 16 ): MASMTGGQQMGRGSMGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGGSSAAAAAAAASGPGGYGPENQGP SGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPG GYGPGGPGSSAAAAAAAASGPGGYGPPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGGPGPGGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGPGPGGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGPGPGGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGPGPGGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGPGPGGSSAAAAAAAASGPGGYGPPENGQGPSGPGGYGPGPGPGGSSAAAAAAAASGPGGYGPPENG SEQ ID NO: 7 (C Lys 16 ): MASMTGGQQMGRGSMGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPKNQGPSGPGGYGPGGPG SEQ ID NO: 8 ((C) 16 C Cys ): MASMTGGQQMGRGSMGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPCGPGGYGPGGP A larger protein based on module C SEQ ID NO: 9 (C32): MASMTGGQQMGRGSMGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPG GYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPGSSAAAAAAAASGPGGYGPENQGPSGPGGYGPGGPG SEQ ID NO: 10 (C48):

Claims

1. a) a structural polypeptide, and b) at least one surfactant 1. A laundry detergent composition comprising:

2. 2. The laundry detergent composition according to claim 1, wherein the structural polypeptide a) is a silk polypeptide, preferably a recombinant or synthetic silk polypeptide, in particular a spider silk polypeptide.

3. The silk polypeptide - comprising or consisting of a protein chain having at least two units with the same sequence motif (single unit of amino acid), or - comprising or consisting of at least two identical repeating units, The laundry detergent composition of claim 2.

4. 4. The laundry detergent composition of claim 2 or claim 3, wherein the silk polypeptide does not contain any non-repeating units.

5. 5. The laundry detergent composition of claim 3 or claim 4, wherein the single or repeating units are independently selected from the group consisting of: - a module C having the amino acid sequence of SEQ ID NO: 1 or a variant thereof, - Module C having the amino acid sequence of SEQ ID NO: 2 or a variant thereof Cys , - module C having the amino acid sequence of SEQ ID NO: 3 or a variant thereof Lys

6. The silk polypeptide is (C)m, (C)mC Cys , (C) mC Lys , C Cys (C) m, C Lys (C)m, (C Cys ) m and (C Lys 6. The laundry detergent composition of claim 2, wherein m is selected from the group consisting of: ) m, wherein m is an integer from 1 to 96.

7. The silk polypeptide is C 1 、C 2 、C 3 、C 4 、C 5 、C 6 、C 7 、C 8 、C 16 、C 32 、C 48 、(C) 1 C Cys 、(C) 2 C Cys 、(C) 3 C Cys 、(C) 4 C Cys 、(C) 5 C Cys 、(C) 6 C Cys 、(C) 7 C Cys 、(C) 8 C Cys 、(C) 16 C Cys 、(C) 32 C Cys 、(C) 48 C Cys 、(C) 1 C Lys 、(C) 2 C Lys 、(C) 3 C Lys 、(C) 4 C Lys 、(C) 5 C Lys 、(C) 6 C Lys 、(C) 7 C Lys 、(C) 8 C Lys 、(C) 16 C Lys 、(C) 32 C Lys 、(C) 48 C Lys 、C Cys (C) 1 、C Cys (C) 2 、C Cys (C) 3 、C Cys (C) 4 、C Cys (C) 5 、C Cys (C) 6 、C Cys (C) 7 、C Cys (C) 8 、C Cys (C) 16 、C Cys (C) 32 、C Cys (C) 48 、C Lys (C) 1 、C Lys (C) 2 、C Lys (C) 3 、C Lys (C) 4 、C Lys (C) 5 、C Lys (C) 6 、C Lys (C) 7 、C Lys (C) 8 、C Lys (C) 16 、C Lys (C) 32 、C Lys (C) 48 、C Cys 1 、C Cys 2 、C Cys 3 、C Cys 4 、C Cys 5 、C Cys 6 、C Cys 7 、C Cys 8 、C Cys 16 、C Cys 32 、C Cys 48 、C Lys 1 、C Lys 2 、C Lys 3 、C Lys 4 、C Lys 5 , C Lys 6 , C Lys 7 , C Lys 8 , C Lys 16 , C Lys 32 and C Lys 48 7. The laundry detergent composition of claim 6, selected from the group consisting of:

8. 8. A laundry detergent composition according to any one of claims 1 to 7, comprising 0.0005 to 2.5%, preferably 0.001 to 2.0%, in particular 0.005 to 1.5%, by weight of at least one structural polypeptide (component a)), based on the total weight of the composition.

9. b1) at least one anionic surfactant, and b2) optionally at least one nonionic surfactant The laundry detergent composition according to any one of claims 1 to 8, comprising:

10. Based on the total weight of the composition, - 3 to 60% by weight, preferably 5 to 50% by weight, in particular 7 to 45% by weight, of at least one anionic surfactant b1), and - 0 to 40% by weight, preferably 1 to 30% by weight, in particular 2.5 to 25% by weight, of at least one nonionic surfactant b2), The laundry detergent composition according to any one of claims 1 to 9.

11. The laundry detergent composition according to any one of claims 1 to 10, comprising the following components: a) at least one structural polypeptide; b) at least one anionic surfactant b1), and optionally at least one nonionic surfactant b2); c) optionally at least one builder; d) optionally at least one enzyme; e) optionally at least one polymeric anti-redeposition agent; f) optionally at least one bleaching agent; g) optionally at least one further additive different from components a) to f), preferably selected from surfactants different from anionic surfactants and nonionic surfactants, rheology modifiers, pH adjusters, anticorrosive agents, antifoaming agents, dyes, fragrances, fillers, tableting aids, disintegrants, solubilizers, electrolytes, optical brighteners, hydrotropes, antimicrobial components, antioxidants and mixtures thereof, h) optionally at least one organic solvent; i) optionally water

12. A laundry detergent composition according to any one of claims 1 to 11, which is in the form of a liquid or gel, or a unit dose formulation having a water-soluble packaging or coating.

13. A method of washing laundry in a washing machine, comprising contacting the laundry to be washed with a laundry detergent composition according to any one of claims 1 to 12.

14. Use of a structural polypeptide, preferably a structural polypeptide according to any one of claims 2 to 8, in particular a silk polypeptide, in a laundry detergent composition.

15. Use of the laundry detergent composition according to any one of claims 1 to 12 in treating laundry in a washing machine, comprising: - improving or maintaining the properties of the textile, in particular improving or maintaining at least one property selected from the following: i) the mechanical and / or use properties of the fabric; ii) the optical properties of the fabric; iii) the feel of the textile; and / or iv) Odor characteristics of textiles - extending the life of the fabric; - reducing the amount of microfibers released during washing; - Eliminating the need for additional laundry care products; Use characterized by.