Immunoassay for detecting truncated high molecular weight kininogen.

Abstract

To provide a reliable, high-sensitivity assay capable of detecting a level of cleaved high molecular weight kininogen (HMWK) in a biological sample.SOLUTION: The present invention relates to an immunoassay that detects cleaved HMWK with high sensitivity and specificity. Such an immunoassay may include a sandwich ELISA method in which an agent that specifically binds cleaved HMWK is immobilized on a support element, which may be a 96-well plate. The immunoassay described herein allows selective detection of both intact and cleaved HMWK, as well as cleaved HMWK in a biological sample that may contain LMWK, such as a serum sample or plasma sample. Provided is an isolated antibody that specifically binds to cleaved HMWK.SELECTED DRAWING: Figure 9

Description

[Technical field]

[0001] (CROSS REFERENCE TO RELATED APPLICATIONS) This application claims the benefit under 35 U.S.C. §119 of U.S. Provisional Patent Application No. 62 / 243,505, filed October 19, 2015, and U.S. Provisional Patent Application No. 62 / 335,311, filed May 12, 2016, each of which is incorporated herein by reference in its entirety. [Background technology]

[0002] Kininogens are precursors of kinins such as bradykinin and kallidin. There are two human kininogens, splice variants high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK acts primarily as a cofactor in coagulation and inflammation and is the preferred substrate for plasma kallikrein (pKal)-mediated bradykinin production.

[0003] Plasma kallikrein (pKal) is the major bradykinin-generating enzyme in the circulating blood. Activation of pKal occurs via the contact pathway, which has been implicated in the disease pathology of hereditary angioedema (HAE). pKal cleaves HMWK (a single-chain polypeptide) to produce bradykinin and a truncated form of HMWK that contains two polypeptide chains linked by disulfide bonds. Cugno et al., Blood (1997) 89:3213-3218.

[0004] During hereditary angioedema (HAE) attacks, cleaved HMWK is increased to approximately 47% of total kininogen (Cugno et al., Blood (1997) 89:3213-3218), making it a biomarker for monitoring HAE attacks. Therefore, there is interest in developing a sensitive and reliable assay to detect the levels of cleaved HMWK in biological samples. Summary of the Invention

[0005] Some embodiments of the present disclosure provide an immunoassay for detecting cleaved high molecular weight kininogen (HMWK) with high sensitivity and specificity. The method includes: (i) preparing a support element to which a first agent (e.g., an antibody such as 559B-M004-B04) that specifically binds to cleaved HMWK is bound; (ii) contacting the support element of (i) with a biological sample suspected of containing cleaved HMWK; (iii) contacting the support element obtained in (ii) with a second agent that is conjugated with a label and binds to HMWK; and (iv) detecting the signal emitted from the label of the second agent that is directly or indirectly bound to the support element to determine the level of cleaved HMWK in the biological sample. In some cases, step (ii) can be performed in the presence of ZnCl2.

[0006] In some embodiments, the support element of (i) is incubated with a blocking buffer prior to step (ii).

[0007] In some embodiments, the second agent is a polyclonal antibody, a monoclonal antibody, or a mixture of two or more monoclonal antibodies that bind to HMWK. The two or more monoclonal antibodies in the mixture may bind to different epitopes of HMWK. In some embodiments, the label is a signal-emitting substance. In some embodiments, the label is a member of a receptor-ligand pair. In that case, the immunoassay further comprises contacting the second agent of (iii) immobilized on a support element with the other member of the receptor-ligand pair before step (iv), where the other member is conjugated with a signal-emitting substance. In one example, the receptor-ligand pair is biotin and streptavidin.

[0008] Another aspect of the present disclosure provides a method for detecting cleaved high molecular weight kininogen (HMWK) in a sample, the method comprising: (i) contacting a sample suspected of containing cleaved HMWK with any of the antibodies described herein (e.g., 559B-M004-B04); (ii) measuring the cleaved HMWK-antibody complex formed in step (i); and (iii) determining the level of cleaved HMWK in the sample based on the results of step (ii). In some embodiments, step (i) is performed in the presence of ZnCl2. In some embodiments, step (i) is performed using enzyme-linked immunosorbent assay (ELISA) or immunoblotting.

[0009] In any of the methods described herein, the sample may be a biological sample taken from a subject (e.g., a human patient), such as a serum sample of a plasma sample, etc. In some embodiments, the method may further include collecting the sample in an evacuated blood collection tube containing one or more protease inhibitors.

[0010] Any of the assay methods (eg, immunoassays) described herein can be an ELISA assay, a Western blot assay, or a lateral flow assay.

[0011] In some embodiments, a biological sample is taken from a subject (e.g., a human patient) with a disease. The assay method can further comprise determining whether the disease is mediated by plasma kallikrein based on the level of cleaved HMWK, and if the level of cleaved HMWK in the sample deviates from that of the control sample, it indicates that the disease is mediated by plasma kallikrein.

[0012] Any of the assay methods described herein may further comprise identifying a patient with a plasma kallikrein-mediated disease or disorder or assessing the effectiveness of a treatment for a disease or disorder based on the level of cleaved HMWK. In some embodiments, the method may further comprise administering to the subject an effective amount of a therapeutic agent, such as a plasma kallikrein (pKal) inhibitor, a bradykinin 2 receptor (B2R) inhibitor and / or a C1 esterase inhibitor, to treat the disorder if the subject is identified as having the disorder. In some embodiments, the pKal inhibitor is an anti-pKal antibody. In some embodiments, the therapeutic agent is lanadelumab, ecallantide, icatibant or a human plasma-derived C1 esterase inhibitor.

[0013] In some embodiments, the subject is a human patient undergoing treatment for a disorder, and the method further comprises evaluating the efficacy of the treatment based on the level of cleaved HMWK in step (iii), where a deviation in the level of cleaved HMWK in the sample from the subject from the level of the control sample indicates that the treatment is effective. In some embodiments, the method further comprises identifying an appropriate treatment for the subject based on the level of cleaved HMWK. In some embodiments, the method may further comprise identifying the subject as a candidate for treatment of the disease based on the level of cleaved HMWK.

[0014] In some embodiments, the human patient has a history of disease (e.g., HAE).In some embodiments, the method further comprises evaluating the risk of disease attack of the subject based on the level of cleaved HMWK, and if the level of cleaved HMWK in the sample from the subject deviates from the level of the control sample, it indicates that there is a risk of disease attack.In some embodiments, the method further comprises administering a therapeutic agent to the subject if the subject is at risk of disease attack.

[0015] In another aspect, a kit for detecting cleaved high molecular weight kininogen (HMWK) is provided, the kit comprising a first agent (e.g., an antibody described herein) that specifically binds to cleaved HMWK. In some embodiments, the kit further comprises a second agent that binds to HMWK, a support element, or both, and, optionally, instructions for detecting cleaved HMWK. In some examples, the support element is a 96-well plate.

[0016] In another aspect of the present disclosure, an isolated antibody is provided that specifically binds to cleaved high molecular weight kininogen (HMWK). In some embodiments, the antibody binds to the same epitope as 559B-M004-B04 or competes with 559B-M004-B04 for binding to cleaved HMWK. In some embodiments, the antibody comprises the same heavy chain complementarity determining region and light chain complementarity determining region as 559B-M004-B04, e.g., the same heavy chain variable region and light chain variable region as 559B-M004-B04. In one example, the antibody is 559B-M004-B04.

[0017] Any antibody specific to cleaved HMWK described herein can be used in a method for detecting cleaved high molecular weight kininogen (HMWK) in a sample. Such a method can include (i) contacting a sample suspected of containing cleaved HMWK with an antibody; (ii) measuring the complex of cleaved HMWK and antibody formed in step (i); and determining the level of cleaved HMWK in the sample based on the result of step (ii). In some embodiments, the sample is a biological sample, such as a serum sample or a plasma sample, taken from a human subject. The results obtained from this method can be used to determine the risk of developing a plasma kallikrein-mediated disorder, such as HAE, in the subject from whom the sample is obtained. In some cases, step (i) can be performed in the presence of ZnCl2.

[0018] Any of the immunoassay methods described herein can be performed in a Western blot or ELISA format.

[0019] In yet another embodiment, an isolated antibody that binds to both intact high molecular weight kininogen (HMWK) and cleaved HMWK is provided.

[0020] In some embodiments, antibodies that bind to both intact and cleaved HMWK do not bind to low molecular weight kininogen (LMWK). In some embodiments the antibody binds to the same epitope as 559B-M0067-E02, 559B-M0039-G07, 559B-M0044-E09, 559B-M0003-C08, 559B-M0039-H06, 559B-M0039-D08, 559B-M0068-C07, 559B-M0021-G11, 559B-M0061-G06, 559B-M0036-G12, 559B-M0042-E06, 559B-M0070-H10, 559B-M0068-D01, or 559B-M0004-E08. In some embodiments, the antibody competes with 559B-M0067-E02, 559B-M0039-G07, 559B-M0044-E09, 559B-M0003-C08, 559B-M0039-H06, 559B-M0039-D08, 559B-M0068-C07, 559B-M0021-G11, 559B-M0061-G06, 559B-M0036-G12, 559B-M0042-E06, 559B-M0070-H10, 559B-M0068-D01, or 559B-M0004-E08 for binding to intact HMWK and / or cleaved HMWK.

[0021] In some embodiments, the antibody comprises the same heavy and light chain CDRs as 559B-M0067-E02, 559B-M0039-G07, 559B-M0044-E09, 559B-M0003-C08, 559B-M0039-H06, 559B-M0039-D08, 559B-M0068-C07, 559B-M0021-G11, 559B-M0061-G06, 559B-M0036-G12, 559B-M0042-E06, 559B-M0070-H10, 559B-M0068-D01, or 559B-M0004-E08. In some examples, the antibody is selected from the group consisting of 559B-M0067-E02, 559B-M0039-G07, 559B-M0044-E09, 559B-M0003-C08, 559B-M0039-H06, 559B-M0039-D08, 559B-M0068-C07, 559B-M0021-G11, 559B-M0061-G06, 559B-M0036-G12, 559B-M0042-E06, 559B-M0070-H10, 559B-M0068-D01, and 559B-M0004-E08.

[0022] In other embodiments, the antibody that binds to both intact and cleaved HMWK also binds to LMWK. In some embodiments, the antibody is selected from the group consisting of 559B-M0069-C09, 559B-M0038-F04, 559B-M0044-C05, 559B-M0047-H01, 559B-M0019-E12, 559B-X0004-B05, 559B-M0048-D12, 559B-M0053-G01, 559B-M0038-H03 , 559B-M0017-H08, 559B-M0035-F05, 559B-M0035-H09, 559B-M0043-C06, 559B-M0003-A08, 559B-M0054-B11, 559B-M0067-G11, 559B-M0064-H02 or 559B-M0065-B10. In some embodiments, the antibody is selected from the group consisting of 559B-M0069-C09, 559B-M0038-F04, 559B-M0044-C05, 559B-M0047-H01, 559B-M0019-E12, 559B-X0004-B05, 559B-M0048-D12, 559B-M00 Conflicts with 053-G01, 559B-M0038-H03, 559B-M0017-H08, 559B-M0035-F05, 559B-M0035-H09, 559B-M0043-C06, 559B-M0003-A08, 559B-M0054-B11, 559B-M0067-G11, 559B-M0064-H02 or 559B-M0065-B10.

[0023] In some embodiments, the antibody is selected from the group consisting of 559B-M0069-C09, 559B-M0038-F04, 559B-M0044-C05, 559B-M0047-H01, 559B-M0019-E12, 559B-X0004-B05, 559B-M0048-D12, 559B-M0053-G01, 559B-M0038-H03, 55 9B-M0017-H08, 559B-M0035-F05, 559B-M0035-H09, 559B-M0043-C06, 559B-M0003-A08, 559B-M0054-B11, 559B-M0067-G11, 559B-M0064-H02 or 559B-M0065-B10. In some examples, the antibody is selected from the group consisting of 559B-M0069-C09, 559B-M0038-F04, 559B-M0044-C05, 559B-M0047-H01, 559B-M0019-E12, 559B-X0004-B05, 559B-M0048-D12, 559B-M0053-G01, 559B-M0038-H03, Selected from the group consisting of 559B-M0017-H08, 559B-M0035-F05, 559B-M0035-H09, 559B-M0043-C06, 559B-M0003-A08, 559B-M0054-B11, 559B-M0067-G11, 559B-M0064-H02 and 559B-M0065-B10.

[0024] The following description sets forth the details of one or more embodiments of the present disclosure. Other features or advantages of the present disclosure will become apparent from the following drawings and detailed description of certain embodiments, as well as from the appended claims.

[0025] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure, which can be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments described herein. [Brief description of the drawings]

[0026] [Figure 1]FIG. 1 is a graph showing binding of 559B-M0004-B04 to intact HMWK (dark grey bars) or truncated HMWK (light grey bars) under the ELISA conditions indicated. [Diagram 2] Figure 2 is a graph showing the binding of various Fab clones to single-stranded intact HMWK, double-stranded (truncated) HMWK or LMWK. A: Fab clones identified using the phage display screening method described herein. Intact HWMK is shown in dark grey bars, truncated HMWK in light grey bars, and LMWK in medium grey bars. B: Binding of some example Fab clones. LWMK is shown in dark grey bars, intact HMWK in light grey bars, and truncated HWMK in medium grey bars. [Diagram 3] Figure 3 is a graph showing the specificity of 559B-M0004-B04 for intact HMWK, truncated HMWK or LMWK. Purified truncated HMWK was added to SBT assay buffer (circles) or HMWK-deficient plasma (squares). Purified intact HMWK was added to SBT assay buffer (triangles). Purified LMWK was added to SBT assay buffer (diamonds). The y-axis represents the ELISA signal in absorbance units and the x-axis represents the concentration of kininogen in μg / mL. [Figure 4] Figure 4 is a graph showing detection of double-chain HMWK (truncated HMWK) in plasma or assay buffer. Purified truncated HMWK was added to SBT assay buffer (open circles) and analyzed in the presence of 10% plasma (squares) or HMWK-deficient plasma, and analyzed in the presence of 10% plasma (triangles). Purified truncated HMWK was similarly added to assay buffer and analyzed in the presence of 2.5% plasma (diamonds) or HMWK-deficient plasma, and analyzed in the presence of 2.5% plasma (filled circles). The y-axis represents the ELISA signal in absorbance units, and the x-axis represents the concentration of kininogen in μg / mL. [Diagram 5]Figure 5 is a graph showing the levels of cleaved HMWK in the indicated human plasma samples before and after contact system activation. A: before and after contact system activation with FXIIa or ellagic acid. B: before and after contact system activation with FXIIa, pKal or ellagic acid. [Figure 6] FIG. 6 is a graph showing levels of cleaved HMWK in plasma samples from 12 healthy human donors before and after contact system activation with ellagic acid. [Figure 7] Figure 7 is a graph showing levels of cleaved HMWK after inhibition with pKal inhibitors. A: Inhibition with lanadelumab / DX-2930 or C1-INH prior to contact system activation with ellagic acid. B: Inhibition of pooled sodium citrate plasma samples with lanadelumab / DX-2930 prior to contact system activation with 10 nM FXIIa. [Figure 8] FIG. 8 is a graph showing cleaved HMWK production at the indicated times following contact system activation with FXIIa or ellagic acid. [Figure 9] FIG. 9 is a graph showing levels of double-chain HMWK in plasma samples from normal subjects and subjects with HAE. [Figure 10] Figure 10 is a photograph showing the results obtained from the Western blot analysis of HMWK, which are consistent with the results obtained from the ELISA assay of two-chain HMWK described herein. Human citrated plasma samples (normal plasma, FXII-deficient plasma and prekallikrein-deficient plasma) were probed with a mouse monoclonal anti-HMWK light chain antibody followed by a goat anti-mouse detection antibody. The plasma samples analyzed were either untreated or activated with 100 nM pKal, 10 nM FXIIa or 10% ellagic acid. [Figure 11] 11 is a graph showing that the addition of ZnCl2 to either citrated or EDTA plasma samples increased the double-chain HMWK signal in an ELISA assay. The x-axis shows the concentration of ZnCl2 in the assay wells after a 40-fold dilution. [Figure 12]Figure 12 is a schematic of the discovery and development of assays using the antibodies described herein. A: Schematic of the phage display method used to discover double-chain HMWK binding antibodies. B: An example of a sandwich ELISA assay in which double-chain HMWK specific antibodies / Fabs (e.g., 559B-M0004-B04) are immobilized on 96-well plates to capture double-chain HMWK in citrated plasma, followed by washing and detection with a label-conjugated anti-HMWK antibody (anti-HMWK-HRP). [Figure 13] FIG. 13 is a graph showing the results obtained from a standard curve of a double-chain HMWK sandwich ELISA in which double-chain HMWK was added to citrated plasma samples (final dilution 10%). [Figure 14] Figure 14 shows the identification of double-chain HMWK-specific antibodies by phage display selection and screening. A: Plot comparing the ratio of the double-chain HMWK binding assay results to the LMWK binding assay results on the y-axis and the ratio of the double-chain HMWK binding assay results to the single-chain HMWK binding assay results on the x-axis for each antibody (Fab) tested. Recombinant Fab fragments were passively immobilized on a 384-well plate, followed by the addition of biotinylated double-chain HMWK, single-chain HMWK or LMWK, followed by streptavidin-HRP. B: Binding of the indicated isolated Fab fragments to single-chain HMWK, double-chain HMWK or LMWK is shown. [Figure 15] FIG. 15 is a graph showing competition of two-chain HMWK and kininogen peptides (HKH20 and GCP28) for binding to 559B-M0004-B04. [Figure 16] FIG. 16 is a graph showing the standard curve of an optimized sandwich ELISA for the detection of double-chain HMWK in human plasma samples. [Figure 17]Figure 17 is a graph of a Western blot analysis comparing the levels of double-chain HMWK in citrated plasma samples from healthy subjects and samples from HAE patients. A: Scatter plot comparing the percentage of double-chain HMWK in samples from healthy subjects ("HV") and HAE patients between HAE attacks ("Basal") and during HAE attacks ("Attack"). B: ROC (Receiver Operating Characteristic) analysis comparing the sensitivity and specificity of detection between HAE basal samples and healthy subjects (AUC=0.977). C: ROC analysis comparing the sensitivity and specificity of detection between HAE attack samples and healthy subjects (AUC=1). D: ROC analysis comparing the sensitivity and specificity of detection between HAE attack samples and HAE basal samples (AUC=0.625). [Figure 18] Figure 18 is a graph of a Western blot analysis comparing the levels of double-stranded HMWK in SCAT169 plasma samples from healthy subjects and HAE patients. A: Scatter plot comparing the percentage of double-stranded HMWK in samples from healthy subjects ("HV") and HAE patients between HAE attacks ("Basal") and during HAE attacks ("Attack"). B: ROC analysis comparing the sensitivity and specificity of detection between HAE basal and healthy samples (AUC=0.915). C: ROC analysis comparing the sensitivity and specificity of detection between HAE attack and healthy samples (AUC=0.967). D: ROC analysis comparing the sensitivity and specificity of detection between HAE attack and HAE basal samples (AUC=0.597). [Figure 19]Figure 19 is a graph of an ELISA analysis comparing the levels of double-chain HMWK in citrated plasma samples from healthy subjects and HAE patients. A: Scatter plot comparing the percentage of double-chain HMWK in samples from healthy subjects ("HV") and HAE patients between HAE attacks ("Basal") and during HAE attacks ("Attack"). B: ROC analysis comparing the sensitivity and specificity of detection between HAE basal samples and healthy subjects (AUC=0.795). C: ROC analysis comparing the sensitivity and specificity of detection between HAE attack samples and healthy subjects (AUC=0.866). D: ROC analysis comparing the sensitivity and specificity of detection between HAE attack samples and HAE basal samples (AUC=0.709). [Figure 20] Figure 20 is a graph of an ELISA analysis comparing the levels of double-chain HMWK in SCAT169 samples from healthy subjects and HAE patients. A: Scatter plot comparing the percentage of double-chain HMWK in samples from healthy subjects ("HV") and HAE patients between HAE attacks ("Basal") and during HAE attacks ("Attack"). B: ROC analysis comparing the sensitivity and specificity of detection between basal and healthy subjects (AUC=0.999). C: ROC analysis comparing the sensitivity and specificity of detection between HAE attacks and healthy subjects (AUC=1). D: ROC analysis comparing the sensitivity and specificity of detection between HAE attacks and HAE basal samples (AUC=0.8176). DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0027] Detailed Description of the Disclosure Plasma kallikrein (PKal) is a serine protease component of the contact system and the major bradykinin-generating enzyme in the circulating blood. The contact system is activated by factor XIIa (activated factor XII or factor FXII) upon contact with foreign or negatively charged surfaces or on the endothelial cell surface by prolylcarboxypeptidase (Sainz IM et al., Thromb Haemost 98, 77-83, 2007). Plasma kallikrein activation amplifies intrinsic coagulation through feedback activation of factor XII and proteolytically cleaves the kininogen precursor high molecular weight kininogen (HMWK), releasing the proinflammatory nonapeptide bradykinin and the cleaved HMWK (also known as two-chain HMWK), which contains two polypeptide chains linked by disulfide bonds.

[0028] Plasma kallikrein, the major kininogenase in the circulation, is primarily responsible for bradykinin production in the vasculature. A genetic defect in the C1 inhibitor protein (C1-INH) leads to hereditary angioedema (HAE). HAE patients often suffer from acute painful attacks precipitated by unknown triggers (Zuraw BL et al., N Engl J Med 359, 1027-1036, 2008). The plasma kallikrein-kinin system (plasma KKS) has been implicated in a variety of diseases through the use of pharmacological agents or genetic studies in animal models.

[0029] It has been found that the level of truncated HMWK is increased in HAE attacks and other pKal-related disorders.Therefore, truncated HMWK can serve as a biomarker for monitoring the development of disease and / or the effectiveness of treatment.However, the art lacks suitable agents and / or suitable assays that can effectively distinguish between intact HMWK and truncated HMWK.

[0030] The present disclosure is based, at least in part, on the development of a specific immunoassay capable of detecting cleaved HMWK with high specificity and sensitivity. It has been observed that a sandwich ELISA method in which an agent that specifically binds to cleaved HMWK is immobilized on a support element (e.g., a multi-well plate) unexpectedly increases the detection efficiency compared to the situation in an ELISA in which an antigen (in this case, cleaved HMWK) is immobilized on a support element. Furthermore, it has been unexpectedly observed that the use of a LowCross blocking buffer (containing casein) rather than a blocking buffer containing bovine serum albumin (BSA) increases the detection specificity and detection sensitivity during the initial screening to find an antibody specific to cleaved HMWK. Furthermore, the use of a 96-well plate further increases the detection specificity and detection sensitivity compared to a 384-well plate. The present disclosure is also based, at least in part, on the isolation of an antibody that specifically binds to cleaved HMWK.

[0031] Thus, herein is provided an immunoassay that uses an agent (e.g., an antibody) that specifically binds to cleaved HMWK (e.g., cleaved HMWK with a molecular weight of 46 kDa) to detect the presence or measure the level of cleaved HMWK in a biological sample suspected of containing HMWK species. Given that there is a correlation between the level of cleaved HMWK and pKal-related or pKal-mediated disorders (e.g., HAE), the immunoassay described herein can be applied to identify patients at risk of such diseases, monitor disease progression, and / or monitor the effectiveness of treatments for such disorders.

[0032] I. Immunoassay for specifically detecting cleaved HMWK One aspect of the present disclosure relates to an immunoassay that detects cleaved HMWK with high sensitivity and specificity.Such immunoassay can include a sandwich ELISA method, in which the agent that specifically binds to cleaved HMWK is immobilized on a support element that can be a 96-well plate.The immunoassay described herein can selectively detect both intact HMWK and cleaved HMWK, as well as cleaved HMWK in biological samples that can contain LMWK, such as serum samples or plasma samples.

[0033] (i) High molecular weight kininogen High molecular weight kininogen (HMWK) exists in plasma as a single polypeptide (single chain), multi-domain (domains 1-6) protein with a molecular weight of approximately 110 kDa, and is referred to herein as intact HWMK. The human gene encoding HMWK is kininogen 1 (KNG1). KNG1 is transcribed and alternatively spliced ​​to form mRNAs that encode either HMWK or low molecular weight kininogen (LMWK). Exemplary protein sequences for HMWK are set forth below: >gi|156231037|ref|NP_001095886.1|Kininogen-1 isoform 1 precursor [Human (Homo sapiens)] MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQY DCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEE TLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS (SEQ ID NO: 1)

[0034] Intact HMWK, also referred to herein as "intact kininogen", can be assayed, for example, using clotting or immunological methods, such as radioimmunoassays (see, e.g., Kerbiriou-Nabias, DM, Br J Haematol, 1984, 56(2):2734-86). Monoclonal antibodies against the light chain of human HMWK are known. See, e.g., Reddigari, SR and Kaplan, AP, Blood, 1999, 74:695-702. Assays for HMWK that rely on chromogenic substrates can be used as well. See, e.g., Scott, CF et al., Thromb Res, 1987, 48(6):685-700; Gallimore, MJ et al., Thromb Res, 2004, 114(2):91-96.

[0035] HMWK is cleaved by pKal within domain 4 to release the nine amino acid proinflammatory peptide bradykinin and a two-chain form of HMWK, referred to herein as cleaved HMWK. The two chains of HMWK are the heavy chain, which contains domains 1-3, and the light chain, which contains domains 5 and 6, and are linked by disulfide bonds. When intact HMWK is first cleaved, the heavy and light chains have molecular weights of approximately 65 kDa and 56 kDa, respectively. Further proteolytic processing produces a light chain of 46 kDa.

[0036] Exemplary sequences for the heavy and light chains of truncated kininogen are set forth below.

[0037] > Truncated kininogen-1 heavy chain QESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTA QYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQ PPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISL MK (SEQ ID NO:2) > Truncated kininogen-1 light chain SSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNK GKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTT QMKESYYFDLTDGLS (SEQ ID NO: 3)

[0038] (ii) Antibody specific for cleaved HMWK The immunoassays described herein may use any agent capable of specifically binding to truncated HMWK, for example, an agent that recognizes a neo-epitope on truncated HMWK that is not present on intact HMWK. In some embodiments, the truncated HMWK binding agent is an antibody.

[0039] Antibodies (used interchangeably in the plural) are immunoglobulin molecules capable of specifically binding to targets such as carbohydrates, polynucleotides, lipids, polypeptides, etc., through at least one antigen recognition site present in the variable region of the immunoglobulin. As used herein, the term "antibody" encompasses intact (i.e., full-length) polyclonal or monoclonal antibodies, as well as antigen-binding fragments thereof (Fab, Fab', F(ab')2, Fv), single chains (scFv), variants thereof, fusion proteins containing antibody portions, humanized antibodies, chimeric antibodies, diabodies, linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies), and any other immunoglobulin molecule that contains an antigen recognition site with the required specificity and has a modified conformation, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies. Antibodies include antibodies of any class, such as IgD, IgE, IgG, IgA, or IgM (or subclasses thereof), and an antibody need not be an antibody of any particular class. Immunoglobulins can be divided into different classes depending on the antibody amino acid sequence of the constant domain of their heavy chains. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, some of which can be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2. The heavy chain constant domains corresponding to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three-dimensional configurations of the different classes of immunoglobulins are well known.

[0040] Any antibody described herein can be either monoclonal or polyclonal. A "monoclonal antibody" refers to a homogeneous population of antibodies, whereas a "polyclonal antibody" refers to a heterogeneous population of antibodies. The two terms do not limit the source of the antibody or the method by which the antibody is made.

[0041] An antibody that "specifically binds" to cleaved HMWK or an epitope thereof is a term well understood in the art, and methods for determining such specific binding are also well known in the art. A molecule is said to exhibit "specific binding" if it reacts or associates with a particular target antigen (here, cleaved HMWK) more frequently, more rapidly, for longer duration, and / or with higher affinity than it binds alternative targets (e.g., intact HMWK and / or LMWK). An antibody "specifically binds" to a target antigen if it binds to the target antigen with higher affinity, higher avidity, more rapidly, and / or for longer duration than it binds to other substances. For example, an antibody that specifically (or preferentially) binds to cleaved HMWK or an epitope thereof is an antibody that binds to this target antigen with higher affinity, higher avidity, more readily, and / or for longer duration than it binds to other antigens (e.g., intact HMWK or LMWK) or other epitopes of the same antigen. By reading this definition, it is also understood that, for example, an antibody that specifically binds to a first target antigen may or may not specifically or preferentially bind to a second target antigen. Thus, "specific binding" or "preferential binding" does not necessarily require (but may include) exclusive binding. Generally, when referring to binding, it means preferential binding, but does not necessarily mean so.

[0042] In some embodiments, antibodies that specifically bind to truncated HMWK as described herein (as well as other antibodies that bind to both truncated and intact HMWK, and optionally LMWK) have a suitable binding affinity for truncated HMWK (or another target antigen as described herein). As used herein, "binding affinity" refers to the apparent binding constant or K A Refers to. A is the dissociation constant (K D The antibodies described herein have a reciprocal of at least 10 -5 M, 10 -6 M, 10 -7 M, 10 -8 M, 10 -9 M, 10-10 Binding affinity (K D The increase in binding affinity can be expressed as K D The fact that an antibody binds to a first target with higher affinity than to a second target corresponds to a decrease in the K A is the K for binding to the second target. A (or K D (or K D In such cases, the antibody has specificity for a first target (e.g., a protein or mimetic thereof in a first conformation) compared to a second target (e.g., the same protein or mimetic thereof in a second conformation; or a second protein). The difference in binding affinity (e.g., when comparing specificity or otherwise) may be at least 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 15-fold, 20-fold, 37.5-fold, 50-fold, 70-fold, 80-fold, 91-fold, 100-fold, 500-fold, 1000-fold, 10,000-fold, or 10 5 For example, the binding affinity of an antibody that specifically binds to truncated HMWK described herein can be 10 times, 100 times, 10,000 times, or 10 times greater than the binding affinity of the antibody to intact HMWK and / or LMWK. 5 It could be double.

[0043] Binding affinity can be determined by a variety of methods, including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance, or spectrometry (e.g., using a fluorescence assay). Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES (pH 7.4), 150 mM NaCl, 0.005% (v / v) surfactant P20). Using these techniques, the concentration of bound binding protein can be measured as a function of target protein concentration. The concentration of bound binding protein ([bound]) is calculated according to the following equation: [Bound]=[N][Free] / (Kd+[Free]) It relates the free target protein concentration ([Free]) and the concentration of binding sites for the binding protein on the target by, where (N) is the number of binding sites per target molecule.

[0044] Not necessarily K A It is not necessary to precisely determine the K A This is because it is sufficient to obtain a quantitative measure of affinity that is proportional to and can therefore be used for comparison, e.g. to determine whether a higher affinity is, for example, a two-fold higher affinity, to obtain a qualitative measure of affinity, or to obtain an inference of affinity, for example by activity in a functional assay, e.g. an in vitro assay or an in vivo assay.

[0045] In some embodiments, an antibody that specifically binds to cleaved HMWK (also called an anti-cleaved HMWK antibody) binds to the same epitope as 559B-M004-B04 of cleaved HMWK. "Epitope" refers to a site on a target antigen to which a binding protein (e.g., an antibody such as a Fab or full-length antibody) binds. The site may consist exclusively of amino acid elements, exclusively of chemical modifications of amino acids of the protein (e.g., glycosyl moieties), or a combination thereof. Overlapping epitopes include at least one common amino acid residue, glycosyl group, phosphate group, sulfate group, or other molecular structure. Epitopes may be linear, or in other examples, epitopes are conformational epitopes.

[0046] A first antibody "binds to the same epitope" as a second antibody if it binds to the same site on a target antigen as the second antibody or if it binds to a site that overlaps (e.g., 50%, 60%, 70%, 80%, 90% or 100%) in amino acid sequence or other molecular structure (e.g., glycosyl groups, phosphate groups or sulfate groups) with the site bound by the second antigen.

[0047] In some embodiments, an antibody that specifically binds to cleaved HMWK competes with 559B-M004-B04 for binding to HMWK. A first antibody "competes for binding" with a second antibody if binding of the first antibody to its epitope reduces (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% or more) the amount of the second antibody that binds to its epitope. Competition can be direct (e.g., the first antibody binds to an epitope that is the same as or overlaps with the epitope bound by the second antibody) or indirect (e.g., binding of the first antibody to its epitope causes a conformational change in the target antigen that reduces the ability of the second antibody to bind to its epitope).

[0048] In some instances, an antibody that specifically binds to cleaved HMWK is H V that is at least 75% (e.g., 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to the CDR H CDR1, V H CDR2 and / or V H Including CDR3, V H Alternatively or additionally, an antibody that specifically binds to truncated HMWK comprises the corresponding V chain of 559B-M004-B04. L V that is at least 75% (e.g., 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to the CDR L CDR1, V L CDR2 and / or V L In some embodiments, an antibody that specifically binds to truncated HMWK has the same heavy and / or light chain complementarity determining regions (CDRs) as 559B-M004-B04.

[0049] "Complementarity determining regions" or "CDRs" are known in the art as non-contiguous amino acid sequences within an antibody variable region that confer antigen specificity and binding affinity. Generally, there are three CDRs in each heavy chain variable region and three CDRs in each light chain variable region. The exact amino acid sequence boundaries of a given CDR can be readily determined using any of a number of well-known schemes, including those described by Kabat et al. (1991) (Public Health Service, 5th ed., National Institutes of Health, Bethesda, MD) (Kabat numbering scheme), Al-Lazikani et al. (1997) (JMB 273,927-948) (Chothia numbering scheme), MacCallum et al. (J. Mol. Biol. 262:732-745 (1996)) (Contact numbering scheme), Lefranc MP et al. (Dev Comp Immunol, 2003 January;27(1):55-77) (IMGT numbering scheme), and Honegger A and Pluckthun A (J Mol Biol, 2001 Jun. 8;309(3):657-70) (AHo numbering scheme).

[0050] The boundaries of a given CDR may vary depending on the scheme used for identification. For example, the Kabat scheme is based on structural alignment, while the Chothia scheme is based on structural information. The Contact scheme is based on the analysis of complex crystal structures and is similar in many ways to the Chothia numbering scheme. Thus, unless otherwise specified, the term "complementarity determining region" or "CDR" of a given antibody should be understood to include the complementarity determining region determined by any of the above known schemes.

[0051] An antibody may have the same V number as 559B-M004-B04 (as well as other exemplary antibodies disclosed herein) as determined by the same numbering scheme. HCDR and / or V L If the antibody has the same CDRs as 559B-M004-B04 (or other exemplary antibodies disclosed herein), then such an antibody is considered to have the same CDRs as 559B-M004-B04 (or other exemplary antibodies disclosed herein) and is within the scope of the present disclosure. For example, such an antibody may have the same V and VD as clone 559B-M004-B04 as determined by the Chothia numbering scheme. H CDR and / or V L In another example, an anti-cleaved HMWK antibody within the scope of the present disclosure may have the same V CDRs as clone 559B-M004-B04 as determined by the Kabat numbering scheme. H CDR and / or V L It may have CDRs.

[0052] Alternatively or additionally, the anti-cleaved HMWK antibody is H V that is at least 75% (e.g., 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to H Chain and / or V of 559B-M004-B04 L V that is at least 75% (e.g., 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to L In some embodiments, the antibody is 559B-M004-B04.

[0053] The "percent identity" of two amino acid sequences is determined using the algorithm of Karlin and Altschul (Proc. Natl. Acad. Sci. USA 87:2264-68, 1990) modified as in Karlin and Altschul, Proc. Natl. Acad. Sci. USA 90:5873-77, 1993. Such an algorithm is incorporated into the NBLAST program of Altschul et al. (J. Mol. Biol. 215:403-10, 1990) and the XBLAST program (version 2.0). The XBLAST program allows for BLAST protein searches with score=50 and wordlength=3 to be performed to obtain amino acid sequences homologous to a protein molecule of interest. When gaps exist between the two sequences, Gapped BLAST can be used as described in Altschul et al., Nucleic Acids Res. 25(17):3389-3402, 1997. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (eg, XBLAST and NBLAST) can be used.

[0054] The sequences of the heavy and light chain variable regions of 559B-M004-B04 are shown below, with the sequences of CDR1, CDR2 and CDR3 of the heavy chain and CDR1, CDR2 and CDR3 of the light chain underlined and in bold (identified by one scheme as an example).

[0055] [ka]

[0056] In some cases, the antibody that specifically binds to truncated HMWK may include one or more (e.g., up to 5, up to 3, or up to 1) conservative mutations in one or more heavy chain CDRs or one or more light chain CDRs in 559B-M0004-B04, for example, at positions where the residue is not likely to be involved in interaction with truncated HMWK. As used herein, "conservative amino acid substitution" refers to an amino acid substitution that does not change the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequences known to those skilled in the art, such as those described in references that summarize such methods, such as Molecular Cloning: A Laboratory Manual, edited by J. Sambrook et al., 2nd Edition (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989) or Current Protocols in Molecular Biology, edited by FMAusubel et al. (John Wiley & Sons, Inc., New York). Conservative substitutions of amino acids include those made between amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.

[0057] Antibodies capable of binding to the cleaved HMWK described herein (as well as antibodies capable of binding to intact HMWK and / or LMWK) can be produced by any method known in the art. See, for example, Harlow and Lane (1988) Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory, New York).

[0058] In some embodiments, antibodies specific to the target antigen (truncated HMWK, intact HMWK and / or LMWK) can be produced by conventional hybridoma technology. A host animal can be immunized with a full-length target antigen or a fragment thereof, optionally conjugated to a carrier protein such as KLH, to produce antibodies that bind to the antigen. The route and schedule for immunizing the host animal generally conforms to established conventional techniques for stimulating and producing antibodies, as further described herein. General techniques for producing mouse, humanized and human antibodies are known in the art and are described herein. It is contemplated that any mammalian subject, including humans, or antibody-producing cells derived therefrom can be engineered to serve as a basis for producing mammalian, including human, hybridoma cell lines. Typically, an amount of an immunogen, including those described herein, is inoculated intraperitoneally, intramuscularly, bucally, subcutaneously, intraplantarly and / or intradermally into the host animal.

[0059] Hybridomas can be prepared from lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C. (1975) (Nature 256:495-497) or a modification of it by Buck, DW et al. (In Vitro, 18:377-381 (1982)). Available myeloma cell lines, including but not limited to X63-Ag8.653 and those from the Cell Distribution Center at the Salk Institute (San Diego, CA, USA), can be used for hybridization. This technique generally involves fusing myeloma cells with lymphoid cells using a fusing agent such as polyethylene glycol or by electrical means well known to those skilled in the art. After fusion, the cells are separated from the fusion medium and grown in a selective growth medium such as hypoxanthine-aminopterin-thymidine (HAT) medium to remove unhybridized parent cells. Hybridomas secreting monoclonal antibodies can be cultured in any medium described herein, with or without the addition of serum. As an alternative to cell fusion techniques, EBV-immortalized B cells can be used to produce anti-PKal monoclonal antibodies described herein. Hybridomas are expanded and subcloned as necessary, and supernatants are assayed for anti-immunogen activity by conventional immunoassay methods (e.g., radioimmunoassay, enzyme immunoassay, or fluorescent immunoassay).

[0060] Hybridomas that can be used as a source of antibodies include any derivative or progeny of the parent hybridoma that produces a monoclonal antibody capable of blocking PKal activity. Hybridomas producing such antibodies can be grown in vitro or in vivo using known methods. If necessary, the monoclonal antibodies can be isolated from culture media or body fluids by conventional immunoglobulin purification methods such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography and ultrafiltration. If undesirable activity is present, it can be removed by, for example, passing the preparation over an adsorbent made of immunogen bound to a solid phase, thereby eluting or dissociating the desired antibody from the immunogen. A population of antibodies (e.g., monoclonal antibodies) can be obtained by immunizing a host animal with a target antigen or with a fragment containing the target amino acid sequence conjugated to a protein that is immunogenic in the species to be immunized, such as keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor, using a bifunctional agent or derivatizing agent, such as maleimidobenzoyl sulfosuccinimide ester (conjugation via cysteine ​​residues), N-hydroxysuccinimide (conjugation via lysine residues), glutaraldehyde, succinic anhydride, SOCl, or R1N=C=NR, where R and R1 are different alkyl groups.

[0061] If necessary, the antibody of interest (monoclonal or polyclonal) (e.g., produced by a hybridoma) can be sequenced and the polynucleotide sequence can then be cloned in a vector for expression or propagation. The sequence encoding the antibody of interest can be maintained in a vector in a host cell, which can then be expanded and frozen for later use. Alternatively, the polynucleotide sequence can be used in genetic engineering to improve the affinity (affinity maturation) or other properties of the antibody. It may be desirable to genetically engineer the antibody sequence to obtain greater affinity and / or specificity for the target antigen. It will be apparent to one of skill in the art that an antibody can be altered with one or more polynucleotide changes and still maintain its binding specificity for its target antigen.

[0062] In other embodiments, fully human antibodies can be obtained by using commercially available mice that have been engineered to express certain human immunoglobulin proteins. Similarly, transgenic animals designed to generate a more desirable immune response (e.g., fully human antibodies) or a more robust immune response can also be used to generate humanized or human antibodies. Examples of such technology are Xenomouse® from Amgen, Inc. (Fremont, CA), and HuMAb-Mouse® and TC Mouse™ from Medarex, Inc. (Princeton, NJ). In another alternative, antibodies can be recombinantly generated by phage display or yeast technology. See, e.g., U.S. Patent Nos. 5,565,332; 5,580,717; 5,733,743; and 6,265,150; and Winter et al. (1994) Annu. Rev. Immunol. 12:433-455. Alternatively, phage display technology (McCafferty et al., (1990) Nature 348:552-553) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.

[0063] Antigen-binding fragments of intact antibodies (full-length antibodies) can be prepared by routine methods, for example, F(ab')2 fragments can be produced by pepsin digestion of the antibody molecule and Fab fragments can be produced by reduction of the disulfide bridges of the F(ab')2 fragment.

[0064] Single chain antibodies can be prepared by recombinantly linking a nucleotide sequence encoding a heavy chain variable region with a nucleotide sequence encoding a light chain variable region. It is preferable to incorporate a flexible linker between the two variable regions. Alternatively, techniques described for the production of single chain antibodies (U.S. Pat. Nos. 4,946,778 and 4,704,692) can be applied to generate phage or yeast scFv libraries, and PKal-specific scFv clones can be identified from the libraries according to routine methods. Positive clones can be further screened to identify clones that specifically bind to target antigens, such as truncated HMWK.

[0065] In some embodiments, the antibody specific to cleaved HMWK (or intact HMWK or LMWK) may be isolated from an antibody library, which may be a synthetic or natural library. A natural antibody library refers to a library obtained from a natural source (e.g., a human donor) according to routine procedures. A synthetic antibody library refers to a library designed according to predetermined rules (e.g., having a completely randomized CDR region such as CDR or a quasi-randomized CDR region such as CDR1 or CDR2 of the heavy chain, light chain, or both).

[0066] In some cases, the antibody library is a display library (e.g., a phage display library or a yeast display library). A display library is a collection of entities, each of which includes an available polypeptide element and a recoverable element that encodes or identifies the polypeptide element. The polypeptide elements are diverse and therefore represented by a variety of amino acid sequences. The polypeptide elements can be of any length, for example, from 3 amino acids to more than 300 amino acids. A display library entity can include more than one polypeptide element, for example, two polypeptide chains of an sFab. In an exemplary embodiment, a display library can be used to identify proteins that bind to truncated HMWK (and other target antigens described herein). For selection, the polypeptide element of each member of the library is probed with truncated HMWK (or a fragment thereof), and if the polypeptide element binds to truncated HMWK, the display library member is typically identified by being retained on a support. An example of using a phage display antibody library to identify an antibody specific for truncated HMWK is shown in FIG. 12.

[0067] The retained display library members are recovered from the support and analyzed. Analysis may include amplification followed by selection under the same or different conditions. For example, alternating positive and negative selections may be performed. Analysis may also include determining the amino acid sequence of the polypeptide elements and purifying the polypeptide elements for detailed characterization.

[0068] The antibodies obtained by the methods known in the art and described herein can be characterized using methods known in the art. For example, one method is to identify the epitope to which an antigen binds, i.e., "epitope mapping". There are many methods known in the art for mapping and characterizing the location of an epitope on a protein, including, for example, analysis of the crystal structure of an antibody-antigen complex, as described in Chapter 11 of Harlow and Lane, Using Antibodies, a Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1999), competitive assays, gene fragment expression assays, and synthetic peptide-based assays. In another example, epitope mapping can be used to determine the sequence to which an antibody binds. The epitope can be a linear epitope, i.e., an epitope that is contained in the form of a single stretch of amino acids, or a conformational epitope that is formed by three-dimensional interactions of amino acids that are not necessarily contained in the form of a single stretch of amino acids (linear sequence of primary structure). Peptides of various lengths (e.g., at least 4-6 amino acids in length) can be isolated or synthesized (e.g., recombinantly) and used in antibody binding assays. In another example, the epitope to which an antibody binds can be determined by determining antibody binding using overlapping peptides derived from the target antigen sequence in a systematic screen. In a gene fragment expression assay, the open reading frame encoding the target antigen is fragmented either randomly or by specific gene constructs, and the reactivity of the expressed antigen fragments with the test antibody is determined. Gene fragments may be generated, for example, by PCR, and then transcribed and translated into protein in vitro in the presence of radioactive amino acids. Binding of the antibody to the radiolabeled antigen fragment is then determined by immunoprecipitation and gel electrophoresis.

[0069] Specific epitopes can also be identified by using large libraries of random peptide sequences (phage libraries) displayed on the surface of phage particles. Alternatively, libraries of defined overlapping peptide fragments can be tested for binding to the test antibody in a simple binding assay. In another example, mutagenesis of the antigen-binding domain, domain swapping experiments and alanine scanning mutagenesis can be performed to identify residues necessary, sufficient and / or essential for epitope binding. For example, domain swapping experiments can be performed with mutants of labeled antigen in which various fragments of the HMWK polypeptide are replaced (swapped) with sequences from closely related but antigenically distinct proteins. The importance of specific antigen fragments to antibody binding can be evaluated by assessing the binding of the antibody to the mutant HMWK.

[0070] Alternatively, competition assays can be performed with other antibodies known to bind to the same antigen to determine whether one antibody binds to the same epitope as another antibody. Competition assays are well known to those of skill in the art.

[0071] Any anti-cleaved HMWK antibody is within the scope of this disclosure.

[0072] (iii) Immunoassay Provided herein is an immunoassay for detecting cleaved HMWK. The term "immunoassay" as used herein may be interchangeably referred to as immune-based assay or immuno-based assay. Immunoassays generally use agents such as antibodies that bind to a molecule (e.g., HMWK) to detect the presence and / or concentration (level) of the molecule in a sample. Examples of immunoassays include Western blots, enzyme-linked immunosorbent assays (ELISAs), lateral flow assays, radioimmunoassays, electrochemiluminescence-based detection assays, magnetic immunoassays, and related techniques. In some embodiments, the immunoassay is an ELISA assay. In some embodiments, the immunoassay is a sandwich ELISA assay. In some embodiments, the immunoassay is a lateral flow assay.

[0073] ELISAs are known in the art (see, e.g., Crowther, John R (2009). "The ELISA Guidebook". 2nd ed.. Humana Press and Lequin R (2005). "Enzyme immunoassay (EIA) / enzyme-linked immunosorbent assay (ELISA)". Clin. Chem. 51(12):2415-8), and exemplary ELISAs are described herein. Kits for performing ELISAs are also known in the art and commercially available (see, e.g., ELISA kits from Life Technologies and BD Biosciences).

[0074] In carrying out the immunoassays described herein, a sample may be obtained from a subject. As used herein, a "sample" refers to a composition comprising tissue, such as blood, plasma, or proteins, from a subject. Samples include both the original unprocessed sample taken from a subject as well as later processed forms, such as partially purified or preserved forms. Exemplary samples include blood, plasma, tears, or mucus. In some embodiments, the sample is a bodily fluid sample, such as a serum sample or a plasma sample. The sample analyzed by the immunoassays described herein may be the original unprocessed sample taken from a subject or later processed forms, such as partially purified or preserved forms. In some embodiments, multiple samples (e.g., at least two, three, four, five, or more) may be taken from a subject over time or at specific time intervals, for example, to assess the progression of a disease or disorder or to assess the effectiveness of a treatment. Multiple samples may be taken before and after a treatment, or during the course of a treatment.

[0075] The sample can be collected from the subject by any means known in the art. In some embodiments, the sample is obtained from the subject by collecting the sample (e.g., a blood sample) in an evacuated collection tube (e.g., a vacuum blood collection tube). In some embodiments, the evacuated collection tube contains one or more protease inhibitors, for example to reduce or prevent ex vivo activation of the contact system during sample collection. Such protease inhibitors may be included in the form of a liquid formulation. In some embodiments, the protease inhibitors include at least one serine protease inhibitor and at least one cysteine ​​protease inhibitor. Such collection tubes are known in the art. See, for example, International Application PCT / US2016 / 046681. Optionally, the evacuated collection tube may further contain one or more anticoagulants.

[0076] A "patient," "subject," or "host" (these terms are used interchangeably) treated by the methods of the invention can mean either a human or a non-human animal. In some embodiments, the subject is a patient suffering from a kallikrein-mediated disorder, such as a bradykinin-mediated disorder, such as hereditary angioedema (HAE), non-histamine-dependent idiopathic angioedema, rheumatoid arthritis, Crohn's disease, lupus, Alzheimer's disease, septic shock, burns, cerebral ischemia / reperfusion injury, cerebral edema, diabetic retinopathy, diabetic nephropathy, macular edema, vasculitis, arterial or venous thrombosis, thrombosis associated with ventricular assist devices or stents, heparin-induced thrombocytopenia with thrombosis, thromboembolic disease, and coronary heart disease with unstable angina, edema, eye disease, gout, intestinal disease, oral mucositis, neuropathic pain, inflammatory pain, spinal stenosis-degenerative spine disease, postoperative ileus, aortic aneurysm. , osteoarthritis, hereditary angioedema, pulmonary embolism, stroke, head trauma or peritumoral cerebral edema, sepsis, acute middle cerebral artery (MCA) ischemic event (stroke), restenosis (e.g., after angioplasty), systemic lupus erythematosus nephritis, autoimmune diseases, inflammatory diseases, cardiovascular diseases, neurological diseases, diseases associated with protein misfolding, diseases associated with angiogenesis, hypertensive and diabetic nephropathy, allergic and respiratory diseases (e.g., anaphylaxis, asthma, chronic obstructive pulmonary disease, acute respiratory distress syndrome, cystic fibrosis, persistent rhinitis), and tissue injury (e.g., burn or chemical injury).

[0077] Alternatively or additionally, the subject that needs the analysis described herein can be a patient with a disease or disorder.Such a subject can be a subject that is currently experiencing an attack of disease (e.g., HAE) or a subject that has previously suffered from disease (e.g., currently in the dormant phase of disease).In some examples, the subject is a human patient that can be undergoing treatment for disease, for example, treatment with C1 esterase inhibitor (C1-INH), plasma kallikrein inhibitor, or bradykinin inhibitor.In other cases, such a human patient can be a patient that has not undergone such treatment.

[0078] The sample described herein can be subjected to analysis using an agent that specifically binds to cleaved HMWK to determine the level of cleaved HMWK in the sample. In some embodiments, the immunoassay described herein can be in the form of a sandwich ELISA, in which a first agent that specifically binds to cleaved HMWK (e.g., an antibody described herein) is immobilized on a support element. The support element can then be incubated with the sample described herein for an appropriate time under conditions that allow the formation of a complex of cleaved HMWK / first agent (e.g., an antibody). Such a complex can then be detected using a second agent that binds to HMWK. The second agent can be conjugated with a label that can directly or indirectly emit a signal. The intensity of the signal represents the level of cleaved HMWK in the sample.

[0079] This method can use any support element known in the art, including but not limited to membranes, beads, slides, or multi-well plates. The selection of an appropriate support element for an immunoassay depends on various factors, such as the number of samples and the method of detection of the signal emitted from the label conjugated to the second agent.

[0080] In some embodiments, the support element is a membrane, such as a nitrocellulose membrane, a polyvinylidene fluoride (PVDF) membrane, or a cellulose acetate membrane. In some examples, the immunoassay can be in a Western blot assay format or a lateral flow assay format.

[0081] In some embodiments, the support element is a multi-well plate, such as an ELISA plate. In some embodiments, the immunoassays described herein can be performed on a high-throughput platform. In some embodiments, a multi-well plate, such as a plate with 24 wells, 48 ​​wells, 96 wells, 384 wells or more, can be used for high-throughput immunoassays. Individual immunoassays can be performed simultaneously in each well. For this reason, it is generally desirable to increase the throughput of the assay by using a plate reader that measures multiple wells simultaneously. In some embodiments, a plate reader capable of simultaneously imaging multiple wells (e.g., 4 wells, 16 wells, 24 wells, 48 ​​wells, 96 wells, 384 wells or more) can be used for this platform. For example, a commercially available plate reader (e.g., the plate::vision system available from Perkin Elmer, Waltham, Massachusetts) can be used. This plate reader is capable of kinetic-based fluorescence analysis. The plate::vision system has high collection efficiency optics and has specialized optics designed to analyze 96 wells simultaneously. Other suitable parallel plate readers include, but are not limited to, SAFIRE (Tecan, San Jose, Calif.), FLIPRTETRA® (Molecular Devices, Union City, Calif.), FDSS7000 (Hamamatsu, Bridgewater, NJ), and CellLux (Perkin Elmer, Waltham, Mass.).

[0082] It has been surprisingly discovered that the surface area and / or volume of the wells of a multi-well plate can affect the outcome of an immunoassay, as described in Example 1. In some embodiments, the immunoassays described are performed in 96-well plates, such as 96-well ELISA plates.

[0083] In other embodiments, the high throughput screening immunoassays of the present disclosure can be automated (eg, adapted for robotic assays).

[0084] In some embodiments, immunoassays can be performed in low-throughput platforms, including single immunoassay formats.For example, low-throughput platforms can be used to measure the presence and amount of cleaved HMWK in biological samples (e.g., biological tissues, tissue extracts) for diagnostic methods, monitoring disease and / or treatment progression, and / or predicting whether a disease or disorder can benefit from a particular treatment.

[0085] Any method known in the art can be used to immobilize an agent that specifically binds to cleaved HMWK, such as an antibody described herein, onto a support element also described herein. In some embodiments, immobilization involves binding of the agent (e.g., an antibody) to the support element. In other embodiments, immobilization involves adsorbing the antibody to the support element. Such adsorption methods can be performed, for example, by incubating the antibody in a buffer with the wells of a multi-well plate. In some embodiments, an agent, such as an antibody, is placed in a coating buffer and incubated with the wells of a multi-well plate. Coating buffers will be apparent to those skilled in the art and may be prepared or obtained from commercial sources. Non-limiting examples of coating buffers include 50 mM sodium bicarbonate, pH 9.6; 0.2 M sodium bicarbonate, pH 9.4; phosphate buffer solution (50 mM phosphate, pH 8.0, 0.15 M NaCl); carbonate-bicarbonate solution; and TBS (50 mM Tris, pH 8.0, 0.15 M NaCl).

[0086] In some embodiments, the first agent is immobilized on the support element by hydrophobic interactions between the first agent and the support element, hi some embodiments, the first agent is immobilized on the support element using electrophoretic transfer.

[0087] The support element may be incubated with a blocking buffer before or after immobilization or before or after. A blocking buffer is generally used to block any exposed surface of the support membrane (e.g., the site on the support membrane that the first agent occupies). The use of a blocking buffer can reduce the baseline signal detected (i.e., "background interference") and / or improve the sensitivity of the immunoassay and / or reduce non-specific binding of components of the sample to the support membrane. As described in Example 1, the choice of blocking buffer influenced the results of the immunoassay. In some embodiments, the blocking buffer contains serum albumin, such as bovine serum albumin or human serum albumin. In some embodiments, the blocking buffer is a BSA buffer (e.g., 2% BSA in PBS buffer). In some embodiments, the blocking buffer does not contain serum albumin, such as bovine serum albumin or human serum albumin. In some embodiments, the blocking buffer contains casein fragments, and optionally NaCl and Tween, and may have a pH of 7.0-7.4. In some embodiments, the casein fragments are highly purified casein fragments.Such blocking buffers may be prepared or obtained from commercial sources (e.g., Blocking Solution LowCross from CANDOR Bioscience).

[0088] The support element having an agent specific for cleaved HMWK bound thereto can be contacted (incubated) with a sample as described herein suspected of containing cleaved HMWK. The term "contacting" generally refers to exposing the support element to the biological sample or agent for a suitable period of time sufficient to form a complex between the agent, such as an antibody, and the cleaved HMWK in the sample (if present). The sample can then be removed from the support element, and the support element can then be washed several times to remove unbound cleaved HMWK. In some embodiments, contacting is performed by capillary action, which causes the biological sample or agent to migrate across the surface of the support membrane.

[0089] The support element can then be incubated with a second agent that binds to HMWK for a period of time suitable to allow binding of the second agent to the HMWK bound to the support element.

[0090] The second agent can be any agent capable of binding to HMWK, such as an antibody capable of binding to HMWK (specific for truncated HMWK or cross-reactive with both truncated and intact HMWK). In some embodiments, the second agent comprises one or more antibodies that bind to HWMK (truncated HMWK and / or intact HMWK). In some embodiments, the antibody is a mouse monoclonal antibody or a monoclonal sheep antibody. This is conjugated to a label, which is a compound that can directly or indirectly (e.g., through interaction with one or more additional compounds) emit a signal.

[0091] In some embodiments, the label is a signal-emitting agent that is either an agent that directly emits a signal (e.g., a dye or fluorophore) or an agent that emits a signal upon interaction with a substrate (e.g., an enzyme such as HRP or β-galactosidase that can convert a colorless substrate to a colored product). As used herein, the term "fluorophore" (also called "fluorescent label" or "fluorescent dye") refers to a moiety that absorbs light energy at a particular excitation wavelength and emits light energy at a different wavelength.

[0092] In other embodiments, the label can be a member of a receptor-ligand pair. As used herein, "ligand-receptor pair" refers to a pair of molecules (e.g., biomolecules) that have specific affinity for each other, such as biotin-streptavidin. In this case, the support element carrying the first agent-cleaved HMWK-second agent can be further incubated with the other member of the ligand-receptor pair for a suitable time period to allow the two elements of the receptor-ligand pair to interact. The other member of the receptor-ligand pair is conjugated with a signal-emitting substance as described herein. In one example, the second agent is conjugated with biotin, and HRP-conjugated streptavidin is used for detection.

[0093] After washing away any unbound conjugate, a substrate solution may be added to aid detection. For example, after a period of time, the reaction can be stopped (e.g., by addition of 1N NaOH) and the concentration of the colored product formed can be measured spectrophotometrically. The intensity of the color is proportional to the concentration of bound antigen.

[0094] The signal emitted from the label described herein can then be detected / measured by routine methodology depending on the particular immunoassay format and the signal emitting substance used therein. As used herein, the terms "measuring" or "measurement" or "detecting" or "detection" refer to assessing the presence, absence, quantity or amount (which may be an effective amount) of a substance in a sample, including inducing a qualitative or quantitative concentration level of such substance, or otherwise assessing a value or classification of interest.

[0095] The assay, e.g., Western blot assay, may further involve the use of a quantitative imaging system, e.g., commercially available LICOR imaging technology (see, e.g., LI-COR Biosciences' Odyssey® CLx Infrared Imaging System). In some embodiments, an electrochemiluminescence detection assay or an assay that relies on a combination of electrochemiluminescence and patterned array technology is used (e.g., Meso Scale Discovery's (MSD) ECL technology or MULTI-ARRAY technology).

[0096] Any immunoassay described herein, for example, one or more steps of the immunoassay, may be carried out in a suitable assay buffer that will be apparent to those skilled in the art. In some embodiments, the assay buffer contains ZnCl2 or is supplemented with ZnCl2. In some embodiments, the assay buffer contains at least about 10 μM, 20 μM, 30 μM, 40 μM, 50 μM, 60 μM, 70 μM, 80 μM, 90 μM, 100 μM, 150 μM, 200 μM, 250 μM, 300 μM, 350 μM, 400 μM, 450 μM, 500 μM or more ZnCl2. In some embodiments, such ZnCl2-containing assay buffer is used in the step where a cleaved HMWK-specific agent (e.g., an antibody specific to cleaved HMWK) binds to cleaved HMWK. ZnCl2 increases the binding activity of the agent (e.g., an antibody) to cleaved HMWK.

[0097] In some embodiments, the assay buffer contains serum albumin, such as bovine serum albumin or human serum albumin. In some embodiments, the assay buffer contains at least about 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.12%, 0.014%, 0.16%, 0.18%, 0.2%, 0.25%, 0.3%, 0.4% or more of BSA. In some embodiments, the assay buffer contains a detergent, such as Tween-20. In some embodiments, the assay buffer contains 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1% or more of a detergent. In one example, the assay buffer contains 0.1% BSA and 0.05% Tween-20 in PBS.

[0098] (iv) Diagnostic and prognostic applications Given the correlation between the level of cleaved HMWK and diseases or disorders associated with plasma kallikrein, the assays and kits described herein can be applied (e.g., as biomarkers) to evaluate such diseases or disorders, such as those described herein (e.g., HAE). Alternatively or additionally, the assays and kits described herein can be used to monitor the progression of such diseases, to evaluate the effectiveness of treatments for diseases, to identify patients suitable for particular treatments, and / or to predict the disease state (e.g., attack vs. quiescence) of a subject.

[0099] In some embodiments, the level of cleaved HMWK determined by the immunoassay described herein can be used to assess whether the subject (e.g., human patient) from whom the biological sample was obtained has or is at risk of having a disease or disorder associated with plasma kallikrein, such as HAE or an autoimmune disease (such as RA, UC, and Crohn's disease). The level of cleaved kininogen can then be compared with either the amount of intact kininogen or the total amount of kininogen in the sample to determine the cleaved kininogen level (e.g., percentage), the level of intact kininogen, or both in the sample. The level of cleaved kininogen and / or the level of intact kininogen can be compared with a reference value to determine whether the subject has or is at risk of having a PKal-mediated disorder, such as HAE or an autoimmune disease, such as RA, UC, and Crohn's disease. For example, if the percentage of cleaved kininogen is equal to or greater than the reference value, the subject can be identified as having or at risk of having a PKal-mediated disorder, such as HAE, RA, UC, and Crohn's disease. Alternatively, if the percent intact kininogen is below a reference value, the subject can be considered to have or be at risk for a pKal-mediated disorder, such as HAE, RA, UC and Crohn's disease.

[0100] In some embodiments, the samples analyzed by the methods described herein are from human subjects with or at risk of having hereditary angioedema (HAE). HAE is also known as "Quincke's edema", C1 esterase inhibitor deficiency, C1 inhibitor deficiency, and hereditary angioneurotic edema (HANE). HAE is characterized by recurrent episodes of severe swelling (angioedema), which may occur, for example, in the extremities, face, genitals, digestive tract, and airway. Symptoms of HAE include, for example, swelling of the arms, legs, lips, eyes, tongue, and / or pharynx; airway obstruction, which may be accompanied by pharyngeal swelling and sudden hoarseness; recurrent episodes of abdominal cramping with no known cause; and / or intestinal swelling, which may become severe and cause abdominal cramping, vomiting, dehydration, diarrhea, pain, and / or shock. Approximately one-third of patients with this HAE develop a non-pruritic rash during attacks, called erythema marginatum.

[0101] Airway swelling can be life-threatening and in some patients, fatal. Mortality is estimated at 15-33%. HAE results in approximately 15,000-30,000 emergency room visits each year.

[0102] Trauma or stress, such as dental procedures, illness (e.g., viral illnesses such as colds and influenza), menstruation, and surgery, can trigger attacks of angioedema. To prevent acute attacks of HAE, patients can try to avoid certain stimuli that have previously caused attacks. However, in many cases, attacks occur without a known trigger. HAE symptoms usually first appear during childhood and worsen during adolescence. Untreated patients experience attacks on average every 1-2 weeks, with most episodes lasting about 3-4 days (ghr.nlm.nih.gov / condition / hereditary-angioedema). The frequency and duration of attacks vary widely among patients with hereditary angioedema, even within the same family.

[0103] There are three types of HAE, known as types I, II, and III. It is estimated that 1 in 50,000 people suffer from HAE, with type I accounting for approximately 85 percent of cases, type II accounting for approximately 15 percent of cases, and type III being extremely rare. Type III is the most recently described type and was initially thought to occur only in women, although families with affected men have been identified.

[0104] HAE is inherited in an autosomal dominant manner, meaning that affected individuals may inherit the mutation from one affected parent. Because de novo gene mutations can occur, HAE can occur in individuals with no previous family history. It is estimated that 20-25% of cases are due to de novo spontaneous mutations.

[0105] Mutations in the SERPING1 gene cause types I and II hereditary angioedema. The SERPING1 gene directs the production of the C1 inhibitor protein, which is important in controlling inflammation. C1 inhibitor blocks the activity of certain proteins that promote inflammation. Mutations that cause type I hereditary angioedema result in low levels of C1 inhibitor in the blood. In contrast, mutations that cause type II result in the production of C1 inhibitor with abnormal functionality. Inadequate levels of functional C1 inhibitor result in the production of excess bradykinin. Bradykinin promotes inflammation by increasing leakage of fluid through blood vessel walls and tissues. Excessive accumulation of fluid in tissues leads to the swelling episodes seen in patients with types I and II hereditary angioedema.

[0106] Mutations in the F12 gene are associated with some cases of hereditary angioedema type III. The F12 gene directs the production of clotting factor XII. In addition to playing a vital role in blood clotting (clotting), factor XII is also an important stimulator of inflammation and is involved in the production of bradykinin. Any mutation in the F12 gene results in the production of highly active factor XII. This results in increased production of bradykinin and leaky blood vessel walls, which leads to swelling episodes. The cause of other cases of hereditary angioedema type III remains unknown. In these cases, mutations in one or more unidentified genes appear to be responsible for the disorder.

[0107] Although HAE may show similarities to other forms of angioedema caused by allergies or other medical conditions, the causes and treatment are very different. When HAE is misdiagnosed as an allergy, it is most commonly treated with antihistamines, steroids, and / or epinephrine, but these drugs are usually ineffective against HAE, although epinephrine can be used for life-threatening reactions. Misdiagnosis has also led to unnecessary exploratory surgery in patients with abdominal swelling, and some patients with HAE have had their abdominal pain mistakenly diagnosed as psychogenic.

[0108] Kaplan, AP, J Allergy Clin Immunol, 2010, 126(5):918-925 describes C1 inhibitor therapy as well as other treatments for HAE.

[0109] In an HAE attack, acute treatment is given to stop the progression of edema as quickly as possible. One acute treatment is intravenous injection of C1 inhibitor concentrates from donor blood, but this treatment is not available in many countries. In emergency situations where C1 inhibitor concentrates are not available, an alternative is fresh frozen plasma (FFP), which also contains C1 inhibitor.

[0110] Purified C1 inhibitor from human blood has been used in Europe since 1979. Several C1 inhibitor therapeutics are currently available in the United States, and two C1 inhibitor products are currently available in Canada. Sterile Berinert P (CSL Behring) was approved by the FDA in 2009 for acute attacks. Nanofiltered CINRYZE® was approved by the FDA in 2008 for prophylaxis. Rhucin / Ruconest (Pharming) is a recombinant C1 inhibitor in development that does not pose the risk of transmission of infections from human blood-borne pathogens.

[0111] Treatment for acute HAE attacks also includes the administration of pain relievers and / or IV fluids.

[0112] Other treatment modalities can stimulate the synthesis of C1-inhibitor or reduce its consumption. Administration of androgenic agents such as danazol can reduce the frequency and severity of attacks by stimulating the production of C1-inhibitor.

[0113] Helicobacter pylori can trigger abdominal attacks. Treating H. pylori with antibiotics reduces abdominal attacks.

[0114] Newer therapies attack the contact cascade: ecallantide (KALBITOR®) inhibits plasma kallikrein and is approved in the United States; icatibant (FIRAZYR®, Shire) inhibits the bradykinin B2 receptor and is approved in Europe and the United States.

[0115] Diagnosis of HAE can utilize, for example, family history and / or blood tests. Laboratory findings associated with types I, II, and III HAE are described, for example, in Kaplan, AP, J Allergy Clin Immunol, 2010, 126(5):918-925. In type I HAE, C1 inhibitor levels are decreased, as are C4 levels, but C1q levels are normal. In type II HAE, C1 inhibitor levels are normal or increased, but C1 inhibitor function is abnormal. C4 levels are decreased and C1q levels are normal. In type III, C1 inhibitor, C4, and C1q levels are all normal. The present disclosure is based, at least in part, on the identification of additional proteins whose levels differ in samples from HAE patients compared to those of healthy individuals (Table 1). Measurement of the level or presence of 2-HMWK can be used to reveal whether a subject has a disease such as HAE. In some embodiments, the method may be used to determine whether a patient has had or is having an HAE attack.

[0116] Symptoms of HAE can be assessed, for example, using questionnaires, for example, questionnaires that are completed by the patient, clinician, or family. Such questionnaires are known in the art, and include, for example, visual analog scales. See, for example, McMillan, CV et al., Patient. 2012;5(2):113-26.

[0117] The levels of cleaved kininogen and / or intact kininogen detected in a sample from a subject can be compared to a reference value to determine whether the subject has or is at risk for a PKal-mediated disorder (e.g., HAE). Alternatively or additionally, the levels of cleaved kininogen and / or intact kininogen detected in a sample from a subject can be compared to a reference value to assess the effectiveness of treatment of a disorder, the prognosis or severity of the disorder, and / or to identify a patient as a candidate for treatment.

[0118] The reference value can be the percentage of cleaved kininogen in the control level. In some embodiments, the control level is the percentage of cleaved kininogen in a control sample, for example, a sample (for example, blood sample or plasma sample) taken from a healthy subject or a group of healthy subjects, and the healthy subject is preferably of the same species as the candidate subject. As used herein, a healthy subject is a subject that does not have or has no history of target disease (for example, HAE or autoimmune disease, for example, PKal-mediated disorder such as RA, US and Crohn's disease) at the time when the level of cleaved kininogen and / or intact kininogen is measured.

[0119] The control level may also be a predefined level or threshold. Such a predefined level may represent the percentage of cleaved kininogen in a population of subjects that do not have or are not at risk for the target disease. The predefined level may also represent the percentage of cleaved kininogen in a population of subjects that have the target disease.

[0120] The predefined level may take a variety of forms. For example, the predefined level may be a single cut-off value, such as a median or mean value. In some embodiments, such predefined level may be established based on a comparison group, for example, one particular group known to have the target disease and another particular group known to not have the target disease. Alternatively, the predefined level may be a range, for example, a range representing the percent of cleaved kininogen in a subject population within a predefined percentile.

[0121] The control level described herein can be determined by routine techniques. In some examples, the control level can be determined by performing conventional methods (e.g., the same assay for obtaining the level of cleaved kininogen and / or intact kininogen in the test sample described herein) on the control sample also described herein. In another example, the level of cleaved kininogen and / or intact kininogen of the members of the control group is obtained, and the results are analyzed, for example, by a calculation program, to obtain a control level (a predetermined level) that represents the level of cleaved kininogen and / or intact kininogen of the control population.

[0122] By comparing the percentage of cleaved kininogen in a sample obtained from a candidate subject with the reference value described herein, it can be determined whether the candidate subject has or is at risk of having a PKal-mediated disease (e.g., HAE or an autoimmune disease such as RA, UC and Crohn's disease). For example, if the percentage of cleaved kininogen in a sample of a candidate subject deviates from the reference value (e.g., increases compared to the reference value or decreases compared to the reference value), the candidate subject can be identified as having or at risk of having a disease. If the reference value represents a range of the percentage of cleaved kininogen in a population of subjects with a target disease, the percentage of cleaved kininogen in a candidate sample falling within that range indicates that the candidate subject has or is at risk of having a target disease. In some cases, the reference value may represent a background level that indicates the absence of cleaved kininogen. The presence of cleaved kininogen would be considered to deviate from such background reference value. As used herein, "deviation from" a control sample or reference value includes the level of cleaved HMWK as well as the presence or absence of cleaved HMWK in a sample.

[0123] As used herein, "high level, or level above a reference value" means that the level / percentage of cleaved kininogen is higher than a reference value, e.g., a predefined threshold value for the level / percentage of cleaved kininogen in a control sample. Control levels are described in detail herein.

[0124] An elevated percentage of cleaved kininogen includes, for example, a percentage of cleaved kininogen that is 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, 200%, 300%, 400%, 500% or more above the reference value. An elevated percentage of cleaved kininogen also includes increasing an event from a zero state (e.g., no or undetectable cleaved and / or intact kininogen bound to the capture reagent in the sample) to a non-zero state (e.g., some presence or detectability of cleaved and / or intact kininogen).

[0125] As used herein, a "low percentage / level, or a percentage / level below a reference value" means that the percentage / level of cleaved kininogen is lower than a reference value, e.g., a predefined threshold value of cleaved kininogen in a control sample, the control level being described in detail herein.

[0126] Low levels of cleaved kininogen include, for example, 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, 200%, 300%, 400%, 500% or more lower cleaved kininogen than the reference level. Low levels of cleaved kininogen bound to the capture reagent also include reducing an event from a non-zero state (e.g., some cleaved kininogen is present or detectable in the sample) to a zero state (e.g., no cleaved kininogen is present or detectable in the sample).

[0127] In some embodiments, the candidate subject is a human patient with symptoms of pKal-mediated disorder, such as HAE or autoimmune diseases such as RA, UC and Crohn's disease.For example, the subject has edema, swelling that is entirely or mostly peripheral; hives; redness, pain and swelling without evidence of infection; non-histamine-mediated edema, recurrent attacks of swelling or combinations thereof.In other embodiments, the subject does not have symptoms of pKal-mediated disorder at the time of sample collection, or has no history of symptoms of pKal-mediated disorder or has no history of pKal-mediated disorder such as HAE.In yet another embodiment, the subject is resistant to antihistamine therapy, corticosteroid therapy or both.

[0128] Appropriate treatments may be administered to subjects identified by the methods described herein.

[0129] Given that there is a correlation between the level of cleaved HMWK and diseases related to plasma kallikrein, such as those described herein, the assay method and kit described herein can be applied to evaluate the effectiveness of the treatment of such diseases.For example, a subject undergoing treatment can take multiple biological samples (e.g., blood samples or plasma samples) before and after or during the course of treatment.The level of cleaved kininogen and / or intact kininogen can be measured by any of the assay methods described herein, and the value (e.g., percentage) of cleaved kininogen and / or intact kininogen can be determined accordingly.A decrease in the percentage of cleaved kininogen after or during the course of treatment (comparing the percentage of cleaved kininogen in the sample taken later to that in the sample taken earlier) or an increase in the percentage of intact kininogen after or during the course of treatment indicates that the treatment is effective.In some examples, the treatment involves a therapeutic agent such as a kallikrein inhibitor, a bradykinin B2 receptor antagonist, or a C1-INH supplement. Examples of therapeutic agents include, but are not limited to, lanadelumab (DX-2930), ecallantide (DX-88), icantibant, and human plasma-derived C1-INH.

[0130] If a subject is identified as not responding to treatment, the identified subject is administered high and / or frequent doses of the therapeutic agent.In some embodiments, for subjects identified as responding to treatment or not needing further treatment, the dosage or frequency of administration of the therapeutic agent is maintained, reduced, or discontinued.Alternatively, a different treatment can be applied to subjects found not responding to the first treatment.

[0131] In other embodiments, the value of cleaved kininogen can be used alone or together with the value of intact kininogen to identify disorders that may be treatable by pKal inhibitors. To carry out this method, the level of cleaved kininogen and / or the level of intact kininogen can be measured in a sample (e.g., blood sample or plasma sample) taken from a subject with a target disease by a suitable assay, such as, for example, Western blot or ELISA assay as described herein. Values ​​such as percentage of cleaved kininogen and / or intact kininogen can be determined as described herein. The value of cleaved kininogen and / or intact kininogen can be compared with a reference value as described herein. If the value of cleaved kininogen and / or intact kininogen deviates from the reference value (e.g., higher or lower), it indicates that a pKal inhibitor may be effective in treating the disease. For example, if the percentage of cleaved kininogen decreases after or during the course of treatment, the treatment can be identified as effective. Alternatively, a treatment is identified as effective if the percent of intact kininogen increases after or during the course of treatment.

[0132] If the disease is identified as being sensitive to (treatable with) a pKal inhibitor, the method may further include administering to a subject having the disease an effective amount of a pKal inhibitor, such as ecallantide (DX-88), EPIKAL-2 or lanadelumab (DX-2930).

[0133] Methods for assessing the severity or pathology of a disease or disorder associated with plasma kallikrein are also within the scope of the present disclosure. For example, as described herein, HAE may be in a dormant state (basal state) in which the subject has no symptoms of the disease. Attacks of HAE are usually recurrent episodes, and the subject may experience pain and swelling, for example in the hands, feet, face, gastrointestinal tract, genitals, and larynx (pharynx), which may last for 2-5 days. In some embodiments, the level of 2-HMWK is indicative of whether a subject has, is developing, or will soon develop an attack of HAE. In some embodiments, the method involves comparing the level of 2-HMWK in a sample obtained from a subject with HAE to the level of 2-HMWK in a sample from the same subject, for example, a sample obtained from the same subject in a basal state or during an attack of HAE.

[0134] (v) Non-clinical applications In addition, the assay for detecting the level of cleaved 2-HMWK described herein may be used for research purposes. Although many diseases and disorders have been identified that are related to or mediated by plasma kallikrein, it is possible that other diseases may be mediated by similar mechanisms or have similar components. In some embodiments, the methods described herein can be used to identify a disease as being related to plasma kallikrein, mediated by plasma kallikrein, or having a component of the contact activation system. In some embodiments, the methods described herein can be used to investigate the mechanism of disease (e.g., discover new biological pathways or biological processes related to disease development) or progression.

[0135] In some embodiments, the level of cleaved 2-HMWK measured using the assay described herein can be used to develop new therapeutic agents for diseases related to contact activation system.For example, the level of cleaved 2-HMWK can be measured in samples obtained from subjects who are administered new therapeutic agents (e.g., clinical trials).In some embodiments, the level of cleaved 2-HMWK before, during, or after new treatment can indicate the effectiveness of the new therapeutic agent or the progression of disease in subjects.

[0136] II. Treatment of diseases associated with plasma kallikrein Subjects at risk for or suffering from a plasma kallikrein-related disease identified using the methods and assays described herein may be treated with any suitable therapeutic agent. In some embodiments, the methods provided include selecting a treatment for the subject based on the results of the methods described, e.g., measuring the level of cleaved 2-HMWK.

[0137] In some embodiments, the methods include one or both of selecting or administering a therapeutic agent to the subject, e.g., a kallikrein inhibitor, a bradykinin B2 receptor inhibitor, and / or a C1 esterase inhibitor, based on the results of an assay, e.g., 2-HMWK detection.

[0138] In some embodiments, the subject is administered one or more doses of a therapeutic agent. In some embodiments, the subject is administered a plasma kallikrein inhibitor. In some embodiments, the kallikrein inhibitor is a peptide, a small molecule inhibitor, a kallikrein antibody or a fragment thereof. In some embodiments, the subject is administered an antagonist of the bradykinin B2 receptor. In some embodiments, the subject is administered C1-INH.

[0139] As part of a combination therapy for treating a disease or condition involving the contact activation system, a therapeutic agent, such as a kallikrein inhibitor, a bradykinin B2 receptor inhibitor, and / or C1-INH, can be administered with another therapy. The combination therapy, such as a combination with one or more of a kallikrein inhibitor, a bradykinin B2 receptor antagonist, or a C1-INH supplement, such as a combination with one or more of a kallikrein inhibitor, a bradykinin B2 receptor antagonist, or a C1-INH supplement, and a combination therapy with another therapy, can be provided in a number of different configurations. The first agent can be administered before or after the other therapy. In some situations, the first agent and the other therapy (e.g., administration of a therapeutic agent) are administered simultaneously or in close proximity in time (e.g., with a short time interval between injections, such as in the same treatment session). The first agent and the other therapy can also be administered with a further time interval.

[0140] Plasma kallikrein binding agents (e.g., binding proteins, e.g., polypeptides, e.g., inhibitory polypeptides, e.g., antibodies, e.g., inhibitory antibodies, or other binding agents, e.g., small molecules) are useful therapeutic agents for a variety of diseases and conditions, e.g., diseases and conditions associated with plasma kallikrein activity. For example, in some embodiments, the disease or condition associated with plasma kallikrein activity is hereditary angioedema (HAE). In some embodiments, a plasma kallikrein binding agent, such as a plasma kallikrein inhibitor, is administered to a subject at risk for or suffering from a disease associated with the contact activation system.

[0141] Many useful protein inhibitors of tissue kallikrein and / or plasma kallikrein contain a Kunitz domain. As used herein, a "Kunitz domain" refers to a polypeptide domain having at least 51 amino acids and containing at least two, preferably three disulfides. The domain is folded such that the first and sixth cysteines, the second and fourth cysteines, and the third and fifth cysteines form disulfide bonds (e.g., in a 58 amino acid Kunitz domain, cysteines are present at positions corresponding to amino acid positions 5, 14, 30, 38, 51, and 55 according to the numbering of the BPTI homologous sequence described below, and disulfides can be formed between the cysteines at positions 5 and 55, 14 and 38, and 30 and 51), or, if two disulfides are present, disulfides can be formed between a subset of the corresponding cysteines. The spacing between each cysteine ​​can be within 7, 5, 4, 3, 2, 1, or 0 amino acids of the spacing between positions corresponding to positions 5-55, 14-38, and 30-51 according to the numbering of the BPTI sequence described below. The BPTI sequence can be used as a reference to indicate the specific positions of any general Kunitz domain. A comparison of the Kunitz domain of interest to BPTI can be performed by identifying the optimal alignment that maximizes the number of aligned cysteines.

[0142] The three-dimensional structure (at high resolution) of the Kunitz domain of BPTI is known. One of the X-ray structures has been deposited in the Brookhaven Protein Data Bank as "6PTI". The three-dimensional structures of several BPTI homologues are known (Eigenbrot et al., Protein Engineering (1990) 3(7):591-598; Hynes et al., Biochemistry (1990) 29:10018-10022). At least 81 Kunitz domain sequences are known. Known human homologues include the three Kunitz domains of LACI, also known as tissue factor pathway inhibitor (TFPI) (Wun et al., J. Biol. Chem. (1988) 263(13):6001-6004; Girard et al., Nature (1989) 338:518-20; Novotny et al., J. Biol. Chem. (1989) 264(31):18832-18837), inter-alpha trypsin inhibitor, two Kunitz domains of APP-I (Kido et al., J. Biol. Chem. (1988) 263(34):18104-18107), a Kunitz domain from collagen, and three Kunitz domains of TFPI-2 (Sprecher et al., PNAS USA (1994) 91:3353-3357), the Kunitz domain of hepatocyte growth factor activator inhibitor type 1, the Kunitz domain of hepatocyte growth factor activator inhibitor type 2, and the Kunitz domain described in U.S. Patent Publication No. 2004-0152633. LACI is a human serum phosphoglycoprotein containing three Kunitz domains with a molecular weight of 39 kDa (amino acid sequence in Table 1).

[0143] [Table 1]

[0144] The Kunitz domains are called LACI-K1 (residues 50-107), LACI-K2 (residues 121-178) and LACI-K3 (residues 213-270). The cDNA sequence of LACI was reported by Wun et al. (J. Biol. Chem. (1988) 263(13):6001-6004). Girard et al. (Nature (1989) 338:518-20) reported a mutation study in which the P1 residues of each of the three Kunitz domains were changed. LACI-K1 inhibits factor VIIa (F.VIIa) when it forms a complex with tissue factor, and LACI-K2 inhibits factor Xa.

[0145] Various methods can be used to identify Kunitz domains from sequence databases. For example, the amino acid sequence, consensus sequence or motif (e.g., ProSite motif) of known Kunitz domains can be searched against the GenBank sequence database (National Center for Biotechnology Information, National Institutes of Health, Bethesda, Maryland) using, for example, BLAST; against the Pfam database of HMMs (hidden Markov models); against the SMART database; or against the ProDom database (e.g., using default parameters for Pfam search). For example, Pfam Accession No. PF00014 of Pfam Release 9 provides a number of Kunitz domains and HMMs for identifying Kunitz domains. A description of the Pfam database can be found in Sonhammer et al., Proteins (1997) 28(3):405-420, and detailed descriptions of HMM can be found, for example, in Gribskov et al., Meth. Enzymol. (1990) 183:146-159; Gribskov et al., Proc. Natl. Acad. Sci. USA (1987) 84:4355-4358; Krogh et al., J. Mol. Biol. (1994) 235:1501-1531; and Stultz et al., Protein Sci. (1993) 2:305-314. The SMART database of HMMs (Simple Modular Architecture Research Tool, EMBL, Heidelberg, Germany) is described in Schultz et al., Proc. Natl. Acad. Sci. USA (1998) 95:5857 and Schultz et al., Nucl. Acids Res (2000) 28:231. The SMART database contains domains identified by profiling with hidden Markov models in the HMMer2 search program (RR. Durbin et al. (1998) Biological sequence analysis: probabilistic models of proteins and nucleic acids. Cambridge University Press). The database is annotated and monitored.The ProDom protein domain database consists of an automated compilation of homologous domains (Corpet et al., Nucl. Acids Res. (1999) 27:263-267). The latest version of ProDom was constructed using recursive PSI-BLAST searches of the SWISS-PROT 38 protein database and the TREMBL protein database (Altschul et al., Nucleic Acids Res. (1997) 25:3389-3402; Gouzy et al., Computers and Chemistry (1999) 23:333-340). The database automatically generates a consensus sequence for each domain. Prosite lists Kunitz domains as motifs and identifies proteins that contain Kunitz domains. See, e.g., Falquet et al., Nucleic Acids Res. (2002) 30:235-238.

[0146] Kunitz domains interact with target proteases primarily using amino acids in two loop regions ("binding loops"). The first loop region is between residues corresponding approximately to amino acids 13-20 of BPTI. The second loop region is between residues corresponding approximately to amino acids 31-39 of BPTI. Exemplary libraries of Kunitz domains differ at one or more amino acid positions in the first loop region and / or the second loop region. Particularly useful positions to vary when screening for Kunitz domains that interact with kallikrein or selecting variants with improved affinity include positions 13, 15, 16, 17, 18, 19, 31, 32, 34, and 39 of the sequence of BPTI. At least some of these positions are expected to make close contact with the target protease. It is also useful to vary other positions, for example positions that are in close proximity to the above positions in the three-dimensional structure.

[0147] The "framework regions" of a Kunitz domain are defined as residues that are part of the Kunitz domain, but specifically exclude residues in the first and second binding loop regions, i.e., residues corresponding approximately to amino acids 13-20 of BPTI and amino acids 31-39 of BPTI. Conversely, residues not present within the binding loops may tolerate a broader range of amino acid substitutions (e.g., conservative and / or non-conservative substitutions).

[0148] In one embodiment, these Kunitz domains are variants of the loop structures that comprise Kunitz domain 1 of human lipoprotein-associated coagulation inhibitor (LACI) protein. LACI contains three distinct internal peptide loop structures that are paradigm Kunitz domains (Girard, T. et al., Nature (1989) 338:518-520). Variants of Kunitz domain 1 of LACI described herein have been screened and isolated, and bind kallikrein with high affinity and specificity (see, e.g., U.S. Pat. Nos. 5,795,865 and 6,057,287). These methods can also be applied to other Kunitz domain frameworks to obtain other Kunitz domains that interact with kallikrein, e.g., plasma kallikrein. Useful modulators of kallikrein function typically bind to and / or inhibit kallikrein, as determined using kallikrein binding assays and kallikrein inhibition assays.

[0149] In some aspects, the plasma kallikrein inhibitor binds to the active form of plasma kallikrein. In some embodiments, the plasma kallikrein inhibitor binds to and inhibits plasma kallikrein, for example, human plasma kallikrein and / or mouse kallikrein. Exemplary polypeptide plasma kallikrein agents are disclosed in U.S. Patent No. 5,795,865, U.S. Patent No. 5,994,125, U.S. Patent No. 6,057,287, U.S. Patent No. 6,333,402, U.S. Patent No. 7,628,983, and U.S. Patent No. 8,283,321, U.S. Patent No. 7,064,107, U.S. Patent No. 7,276,480, U.S. Patent No. 7,851,442, U.S. Patent No. 8,124,586, U.S. Patent No. 7,811,991, and U.S. Patent Publication No. 20110086801, each of which is incorporated herein by reference in its entirety. In some embodiments, the plasma kallikrein inhibitor is an inhibitory polypeptide or inhibitory peptide. In some embodiments, the inhibitory peptide is ecallantide (also known as DX-88 or KALBITOR®; SEQ ID NO:80). In some embodiments, the kallikrein inhibitor comprises or consists of a DX-88 polypeptide having a sequence of about 58 amino acids from amino acids 3 to 60 of SEQ ID NO:80, or a sequence of about 60 amino acids of SEQ ID NO:80.

[0150] Glu Ala Met His Ser Phe Cys Ala Phe Lys Ala Asp Asp Gly Pro Cys Arg Ala Ala His Pro Arg Trp Phe Phe Asn Ile Phe Thr Arg Gln Cys Glu Glu Phe Ile Tyr Gly Gly Cys Glu Gly Asn Gln Asn Arg Phe Glu Ser Leu Glu Glu Cys Lys Lys Met Cys Thr Arg Asp (SEQ ID NO: 80).

[0151] The plasma kallikrein inhibitor may be a full-length antibody (e.g., IgG (e.g., IgG1, IgG2, IgG3, IgG4), IgM, IgA (e.g., IgA1, IgA2), IgD and IgE) or may comprise only an antigen-binding fragment (e.g., a Fab fragment, a F(ab')2 fragment or a scFv fragment). The binding protein may comprise two heavy and two light chain immunoglobulins or may be a single chain antibody. The plasma kallikrein inhibitor may be a recombinant protein such as a humanized antibody, a CDR-grafted antibody, a chimeric antibody, a deimmunized antibody or an in vitro generated antibody, and may optionally comprise a constant region derived from a human germline immunoglobulin sequence. In one embodiment, the plasma kallikrein inhibitor is a monoclonal antibody.

[0152] Exemplary plasma kallikrein binding proteins are disclosed in U.S. Patent Application Publication No. 20120201756, the entire contents of which are incorporated herein by reference. In some embodiments, the kallikrein binding protein is selected from the group consisting of M162-A04, M160-G12, M142-H08, X63-G06, X101-A01 (also known as DX-2922), X81-B01, X67-D03, X67-G04, X81-B01, X67-D03, X67-G04, X115-B07, X115-D05, X115-E09, X115-E10, X115-E20, X115-E30, X115-E40, X115-E50, X115-E60, X115-E70, X115-E80, X115-E90, X115-E120, X115-E140, X115-E15, X115-E22, X115-E30, X115-E15, X115-E160, X115-E170, X115-E180, X115-E190, X115-E220, X115-E230, X115-E240, X115-E250, X115-E30 ... and an antibody (e.g., a human antibody) having a light chain and / or a heavy chain of an antibody selected from the group consisting of 115-H06, X115-A03, X115-D01, X115-F02, X124-G01 (also referred to herein as DX-2930 or lanadelumab), X115-G04, M29-D09, M145-D11, M06-D09 and M35-G04. In some embodiments, the plasma kallikrein binding protein competes with or binds to the same epitope as M162-A04, M160-G12, M142-H08, X63-G06, X101-A01 (also referred to herein as DX-2922), X81-B01, X67-D03, X67-G04, X81-B01, X67-D03, X67-G04, X115-B07, X115-D05, X115-E09, X115-H06, X115-A03, X115-D01, X115-F02, X124-G01, X115-G04, M29-D09, M145-D11, M06-D09, and M35-G04. In some embodiments, the plasma kallikrein binding protein is lanadelumab. See U.S. Patent Application Publication Nos. 20110200611 and 20120201756, which are incorporated herein by reference.

[0153] An example of a plasma kallikrein inhibitor antibody is lanadelumab. The amino acid sequences of the heavy and light chain variable regions of lanadelumab are set forth below, with the CDR regions in bold and underlined:

[0154] Lanadelumab heavy chain variable region sequence (SEQ ID NO:81) EVQLLESGGG LVQPGGSLRL SCAASGFTFS HYIMMWVRQA PGKGLEWVSG IYSSGGITVY ADSVKGRFTI SRDNSKNTLY LQMNSLRAED TAVYYCAYRR IGVPRRDEFD IWGQGTMVTV SS Lanadelumab light chain variable region sequence (SEQ ID NO:82) DIQMTQSPS TLSASVGDRV TITCRASQSI SSWLAWYQQK PGKAPKLLIY KASTLESGVP SRFSGSGSGT EFTLTISSLQ PDDFATYYCQ QYNTYWTFGQ GTKVEI

[0155] In some embodiments, a plasma kallikrein inhibitor may have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to a plasma kallikrein inhibitor described herein. In some embodiments, a plasma kallikrein inhibitor may have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity in the HC and / or LC framework regions (e.g., FR1, FR2, FR3 and / or FR4 of the HC and / or LC) to a plasma kallikrein inhibitor described herein. In some embodiments, the plasma kallikrein inhibitors may have HC and / or LC CDRs (e.g., CDR1, CDR2 and / or CDR3 of the HC and / or LC) that share about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the plasma kallikrein inhibitors described herein. In some embodiments, the plasma kallikrein inhibitors may have constant regions (e.g., CH1, CH2, CH3 and / or CL1) that share about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the plasma kallikrein inhibitors described herein.

[0156] In some embodiments, the small molecule binds to and inhibits the active form of plasma kallikrein.

[0157] Bradykinin B2 receptor inhibitors In some embodiments, the subject is administered a bradykinin B2 receptor inhibitor (e.g., antagonist). Exemplary bradykinin B2 receptor antagonists include icatibant (Firazyr®), which is a 10 amino acid peptide mimetic that blocks natural bradykinin from binding to the bradykinin B2 receptor.

[0158] C1-INH supplements In some embodiments, the subject is administered a C1 esterase inhibitor (C1-INH), such as a C1-INH supplement. Exemplary C1-INH supplements have been published, including, for example, human plasma-derived C1-INH, such as Berinert® and CINRYZE®.

[0159] III. Kits for detecting cleaved HMWK The present disclosure also provides a kit for use in evaluating cleaved HMWK in a sample suspected of containing cleaved HMWK, e.g., a biological sample from a human patient. Such a kit may include a first agent that specifically binds to cleaved HMWK compared to intact HMWK or LMWK. In some embodiments, the first agent is an antibody, e.g., any antibody described herein that specifically binds to cleaved HMWK (e.g., 559B-M004 or a functional variant thereof described herein). In some embodiments, the kit further includes a second agent (e.g., an antibody that binds to HMWK) that detects the binding of the first agent to cleaved HMWK. The second agent can be conjugated to a label. In some embodiments, the second agent is an antibody that specifically binds to cleaved HMWK. In other embodiments, the second agent is an antibody that cross-reacts with both cleaved HMWK and intact HMWK.

[0160] The kit may further comprise a support element for carrying out immunoassay and immobilizing the first agent.In some embodiments, the support element is a 96-well plate, such as a 96-well ELISA plate.The kit may also comprise one or more of the buffers described herein, including but not limited to coating buffer; assay buffer, such as ZnCl2-containing assay buffer; blocking buffer; washing buffer; and / or stop buffer.

[0161] In some embodiments, the kit can include instructions for use according to any of the methods described herein.The included instructions can include instructions on how to use the components included in the kit to measure the level of cleaved HMWK and / or intact HMWK in a sample, and the sample can be a biological sample taken from a human patient.Alternatively, or in addition, the kit can include instructions on how to use the components included in the kit to measure the level of LMWK.

[0162] The instructions for using the kit generally include information on the amount of each component and the appropriate conditions for carrying out the assay method described herein. The components of the kit may be present in unit dose, bulk packaging (e.g., multi-dose packaging) or sub-unit dose. The instructions provided in the kit of the present disclosure are usually written instructions on a label or package insert (e.g., paper included in the kit), but machine-readable instructions (e.g., instructions written on a magnetic or optical storage disk) are also acceptable.

[0163] The label or insert indicates that the kit is for use in assessing levels of cleaved HMWK and / or intact HMWK. In some embodiments, the kit is for use in assessing levels of LWMK. Instructions can be provided for carrying out any of the methods described herein.

[0164] The kit of the present disclosure is in a suitable packaging container. Suitable packaging containers include, but are not limited to, vials, bottles, jars, flexible packaging containers (e.g., sealed Mylar bags or plastic bags), and the like. Packaging for use in combination with a particular device, such as an inhaler, a nasal spray device (e.g., a sprayer), or an injection device such as a minipump, is also contemplated. The kit may have a sterile connection port (e.g., the container may be an intravenous fluid bag or vial with a stopper that can be pierced by a hypodermic needle). The container may also have a sterile connection port (e.g., the container may be an intravenous fluid bag or vial with a stopper that can be pierced by a hypodermic needle).

[0165] The kit may optionally provide additional components, such as information for interpretation, such as a control sample and / or a standard or reference sample. The kit typically includes a container and a label or package insert(s) on or attached to the container. In some embodiments, the disclosure provides an article of manufacture that includes the contents of the kit described above.

[0166] IV. Other Antibodies that Bind to Cleaved HMWK Provided herein is an isolated antibody that binds to both cleaved and intact HMWK. In some embodiments, such an antibody does not bind to LMWK or binds to LMWK with low affinity. In other embodiments, such an antibody also binds to LMWK.

[0167] In some embodiments, the antibodies that specifically bind to cleaved and intact HMWK (or even LMWK) described herein have suitable binding affinity for one or more target antigens. The antibodies described herein have a binding affinity of at least 10 -5 M, 10 -6 M, 10 -7 M, 10 -8 M, 10 -9 M, 10 -10 Binding affinity (K D ).

[0168] Examples of the above antibodies and their binding specificities are provided in Table 2 of Example 2 below. The amino acid sequences of the heavy and light chain variable regions are set forth below, with the CDR regions in bold and underlined (determined by one scheme as one example): [ka] TIFF0007640599000004.tif223162TIFF0007640599000005.tif228162TIFF0007640599000006.tif22716 2TIFF0007640599000007.tif221162TIFF0007640599000008.tif230162TIFF0007640599000009.tif23162

[0169] Functional equivalents of any of the above-listed exemplary antibodies are also included within the scope of this disclosure. Such functional equivalents may bind to the same epitope of cleaved HMWK and / or intact HMWK or sample epitope of LMWK as one of the above-listed exemplary antibodies. In some embodiments, functional equivalents compete with one of the above-listed exemplary antibodies for binding to target antigen.

[0170] In some embodiments, the functional equivalent is a corresponding V of one of the exemplary antibodies above. H V that is at least 75% (e.g., 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to the CDR H CDR1, V H CDR2 and / or V H V containing CDR3 H Alternatively or in addition, functional equivalents include V chains that are at least 75% (e.g., 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to the exemplary antibodies set forth above. L CDR1, V L CDR2 and / or V LIn some embodiments, the functional equivalent comprises the same heavy chain complementarity determining regions (CDRs) and / or light chain CDRs as one of the exemplary antibodies above.

[0171] Alternatively or additionally, the functional equivalent may be the V of an exemplary antibody. H V that is at least 75% (e.g., 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to H Chains and / or V of Exemplary Antibodies L V that is at least 75% (e.g., 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%) identical to L Includes chains.

[0172] In some cases, a functional equivalent may include one or more (e.g., up to five, up to three, or up to one) conservative mutations in one or more heavy chain CDRs or one or more light chain CDRs of an exemplary antibody, for example, at positions where the residues are unlikely to be involved in interactions with the target antigen.

[0173] Without further elaboration, it is believed that those skilled in the art can utilize the present disclosure to the fullest extent in light of the above description.The following specific embodiments should therefore be construed as merely illustrative, and in no way limiting to the remainder of the present disclosure.Any publications cited herein are incorporated by reference for the purposes or subject matter mentioned herein.

[0174] (Example) Example 1 Development of an immunoassay for the specific detection of cleaved HMWK First, an ELISA-based immunoassay screen was developed to identify Fab fragments that bind to truncated or intact HMWK in a phage display library. The assay conditions generally involved immobilizing biotinylated intact or truncated HMWK on streptavidin-coated 384-well assay plates, blocking with bovine serum albumin (BSA) blocking buffer, and contacting the immobilized HMWK with Fab displayed on phages from overnight cultures of Escherichia coli (E. coli) (detected with anti-M13-HRP antibody).

[0175] As shown in panel A of FIG. 12, first, approximately 1×10 6 mAb was added to biotinylated single-stranded HMWK immobilized on streptavidin-coated magnetic beads (Dynabeads M280, Thermo Fisher Scientific). 12Selection aimed at obtaining double-chain HMWK-specific antibodies was performed by performing negative selection of the library with input phages. The depleted library was then contacted with biotinylated double-chain HMWK immobilized on streptavidin-coated magnetic beads. The beads were washed extensively with PBS buffer and used to infect Escherichia coli (E. coli) to amplify the phage output and complete the selection round. After three rounds of selection, individual phage colonies were screened by ELISA using biotinylated single-chain HMWK and double-chain HMWK immobilized on streptavidin-coated plates, detection with horseradish peroxidase (HRP) conjugated to anti-M13 antibody, and detection of absorbance by substrate hydrolysis of 3,3',5,5'-tetramethylbenzidine (TMB). Recombinant Fab fragments were expressed in E. coli and purified by protein A sepharose chromatography (Wassaf et al., Anal. Biochem. (2006) 351:241-253). The specificity of each purified Fab was determined by measuring binding to biotinylated single-chain HMWK, biotinylated double-chain HMWK, or biotinylated LMWK by detection with streptavidin conjugated to HRP and detection with TMB on coated 384-well plates. These assay conditions identified the 559B-M004-B04 isolate, which specifically binds cleaved HMWK over intact HMWK (Figure 1).

[0176] Immobilized HMWK was also contacted with a crude (unpurified) 559B-M004-B04 Fab preparation obtained from an overnight culture of E. coli. Fab bound to HMWK was detected using an anti-human Fab-HRP antibody, but no specific binding to cleaved HMWK occurred (Figure 1).

[0177] The immunoassay setup was reversed by passively immobilizing purified Fab fragments of 559B-M004-B04 on polystyrene 384-well assay plates, contacting the Fab with biotinylated HMWK, and detecting bound HMWK with streptavidin-HRP (Figure 1).

[0178] Substituting the BSA blocking buffer with a commercially available blocking buffer, Candor Biosciences' LowCross Blocking Solution, during the initial screening assay unexpectedly increased the specificity of 559B-M004-B04 Fab for cleaved HMWK (Figure 1). Furthermore, performing the immunoassay in 96-well assay plates rather than 384-well plates further increased the observed specificity of 559B-M004-B04 for cleaved HMWK (Figure 1).

[0179] Due to the results obtained with the 559B-M004-B04 isolate, an immunoassay (ELISA) was developed to detect 2-HMWK in samples (Figure 12, panel B). This assay can also be used to further evaluate the binding properties of other Fab fragments and antibodies. Briefly, Fab is coated overnight onto a multiwell plate. The next day, the plate is washed and then blocked with BSA buffer. After washing, samples, standards and QCs diluted in LowCross buffer are added to the plate, followed by incubation, washing and detection of bound double-chain HMWK by addition of an HRP-labeled sheep anti-HMWK polyclonal detection antibody. After incubation with the detection antibody, the plate is washed and TMB substrate is added to the plate. After a short incubation, the reaction is stopped with phosphoric acid. The absorbance at 450 nm to 630 nm is then measured.

[0180] Example 2 : Evaluation of the binding specificity of Fab clones using the immunoassay described herein The immunoassay described in Example 1 was used to assess the binding of 36 purified Fab clones (Table 2 below) to cleaved HWMK, intact HMWK, and LWMK. Specifically, each purified Fab clone was immobilized in 96-well assay plates at a concentration of 1 μg / L in a total volume of 100 μL in PBS and incubated overnight at 2-8°C. The assay plates were blocked with LowCross blocking buffer. Biotinylated intact HMWK, biotinylated cleaved HMWK, or biotinylated LMWK (each at 1 μg / L) was added to each well in a total volume of 100 μL, incubated for 2 hours, and then washed with wash buffer. HRP-labeled streptavidin was added to each well at a concentration of 100 ng / mL, and signal was generated using Ultra TMB Substrate. Signal to noise ratios were calculated using the signal observed when biotinylated protein was added to uncoated wells (Figure 2, panels A and B). Based on the ELISA results, the antibodies can be classified into five types (Table 2).

[0181] [Table 2]

[0182] Several antibodies were obtained that bind to both single-chain HMWK, double-chain HMWK, and LMWK, such as 559B-M0064-H02. These antibodies likely bind to epitopes in domains 1-4 common to HMWK and LMWK. M070-H10 is an example of an antibody that is predicted to bind to an epitope common to single-chain HMWK and double-chain HMWK, but not to LMWK. LMWK is a splice variant of kininogen that produces a truncated protein consisting of domains 1-4 and part of domain 5 (Colman et al., Blood (1997) 90:3819-3843). Thus, antibodies such as M070-H10 likely bind to domains 5 or 6.

[0183] As shown in Figure 14, panel A, 559B-M0004-B04 showed selectivity for double-chain HMWK over both single-chain HMWK and LMWK and was selected for further assay optimization. To detect cleaved HMWK in human plasma samples, a sandwich ELISA method was developed in which 559B-M0004-B04 (100 μL of 2 μg / mL) was passively immobilized on a 96-well plate (Nunc Maxisorp plate) (Figure 12, panel B). The next day, the plate was washed and then blocked with 2% BSA (protease / IgG free) in PBS buffer. After washing, samples containing cleaved HMWK in 0.1% BSA buffer in PBS with 0.05% Tween-20 (double-chain HMWK assay buffer). HNKW HMWK-deficient plasma was spiked with purified protein standards (e.g., double-chain HMWK, intact HMWK or LMWK) and diluted 1:320 in double-chain HMWK assay buffer. After washing the plate with PBST, a mixture of two mouse monoclonal antibodies (11H05 and 13B12) at 1 μg / mL in double-chain HMWK assay buffer was added for 1 h at room temperature. Unbound detection antibody was washed away and a 1:2000 dilution of goat anti-mouse secondary antibody conjugated with horseradish peroxidase (HRP) was added. The assay containing the secondary antibody was incubated for 1 h at room temperature and unbound secondary antibody was removed by washing with double-chain HMWK assay buffer. Signal was detected by addition of the HRP substrate, 3,3',5,5'-tetramethylbenzidine (TMB). The reaction was stopped with phosphoric acid. Hydrolysis of the TMB substrate was detected at 450 nm–630 nm using a microplate reader (Figure 3). Additionally, ELISA assays were performed with samples containing truncated HMWK in two-chain HMWK assay buffer or HMWK-deficient plasma, and comparable binding was obtained when analyzed in the presence of either 2.5% or 10% plasma (Figure 4). These immunoassay conditions were used to detect specific binding to truncated HMWK. The assay performed comparable whether HMWK was provided in two-chain HMWK assay buffer or in HMWK-deficient plasma (Figures 3 and 4). Additionally, no binding of 559B-M0004-B04 to LMWK was observed.

[0184] An ELISA assay was evaluated for the detection of truncated HMWK generated by contact activation in human plasma (Fig. 5A and 5B). The amount of truncated HMWK in normal human plasma was measured in the absence or presence of catalytic amounts of FXIIa, pKal, or ellagic acid, which trigger the autoactivation of FXII to FXIIa and thus truncated HMWK (Fig. 5, panels A and B). Consistent with the role of plasma kallikrein as the major plasma enzyme required for the generation of two-chain HMWK, no truncated HMWK was generated in prekallikrein-deficient plasma by addition of ellagic acid or FXIIa. The contact system in FXI-deficient plasma was activated to the same extent by FXIIa, pKal, or ellagic acid, a result consistent with the notion that FXIa is generated by FXIIa and does not generate two-chain HMWK.

[0185] The results obtained with the two-chain HMWK ELISA were confirmed by Western blot analysis using the mouse monoclonal antibody 11H05 to detect truncated HMWK generated by contact activation in human plasma (Figure 10). The 11H05 antibody specifically binds to the light chain of HMWK and reveals both the 56 kDa light chain and the further proteolytically cleaved 46 kDa light chain generated by the proteolytic activity of plasma kallikrein at a site close to the N-terminus of the HMWK light chain (Colman et al., Blood (1997) 90:3819-3843).

[0186] We also evaluated whether the ELISA assay could detect cleaved HMWK produced in the plasma of 12 healthy donors (Figure 6). In each of the 12 samples, cleaved HMWK was detected after ellagic acid activation of the contact activation system. Similarly, we measured the amount of cleaved HMWK after inhibition of the contact activation system in normal plasma with various concentrations of lanadelumab (DX-2930; a specific inhibitor of plasma kallikrein) or an inhibitor of serpin C1-INH, followed by activation with ellagic acid (Figure 7, panels A and B). Lanadelumab (DX-2930) potently inhibited plasma kallikrein (K iLanadelumab is a fully human antibody that specifically inhibits FXIIa (IC = 0.12 nM), was discovered using phage and is in clinical development for the prophylactic treatment of HAE-C1INH attacks (Chyung et al., Ann. Allergy Asthma Immunol. (2014) 113:460-466; Kenniston et al., J. Biol. Chem. (1994) 289:23596-23608). Lanadelumab was added to citrated plasma at various concentrations and effectively inhibited FXIIa-induced double-chain HMWK synthesis as shown by Western blot and sandwich ELISA (Figure 7B). The IC of lanadelumab inhibition of double-chain HMWK synthesis was 0.018 μg / mL. 50 The activation potential of M004-B04 was 212±28 nM, which is consistent with the expected activation potential of all prekallikrein in undiluted plasma (approximately 500 nM). The signal was completely inhibited by lanadelumab in plasma treated with a contact activator, confirming that M004-B04 is specific for two-chain HMWK generated by plasma kallikrein.

[0187] In this preliminary assay, using M004-B04 as the capture antibody and HRP-conjugated sheep polyclonal anti-kininogen as the detection antibody, activation of the contact system with kininogen-deficient plasma did not result in an increase in the ELISA signal (data not shown).

[0188] Similarly, plasma from healthy subjects using EDTA as an anticoagulant was activated to the same extent as citrated plasma, as shown in Figure 10, supporting the finding that metal ions are not required for contact system activation (Colman et al., Blood (1997) 90:3819-3843). However, double-chain HMWK was not detected by ELISA in EDTA plasma (Figure 5B), suggesting that the binding of the M004-B04 antibody to double-chain HMWK is metal ion dependent. A zinc-binding site of HMWK (amino acids 479-498) located in domain 5 of the light chain has been previously identified and shown to mediate the interaction of kininogen with the endothelial cell surface receptor gC1qR, cytokeratin 1 and urokinase plasminogen activator receptor, thereby increasing contact system activation (Kaplan et al., Adv. Immunol. (2014) 121:41-89; Bjorkqvist et al., Biol. Chem. (2013) 394:1195-1204). Addition of ZnCl2 to the assay buffer was tested at various concentrations and was found to increase the binding of the antibody to cleaved HMWK (Figure 11). Increasing concentrations of ZnCl2 were examined on the ELISA signal observed in ellagic acid-activated citrated plasma and EDTA-added plasma. The ELISA signal for EDTA-added plasma increased to an apparent maximum at ZnCl2 concentrations above 400 μM (concentration in well).

[0189] Electron microscopy has previously demonstrated that zinc binding to single-chain HMWK promotes a more compact, globular quaternary structure (Herwald et al., Eur J. Biochem. (2001) 268:396-404). Similarly, electron microscopy has demonstrated that double-chain HMWK adopts an elongated, less globular quaternary structure than single-chain HMWK in EDTA-containing buffers (Herwald et al., Eur J. Biochem. (2001) 268:396-404). Although the effect of zinc on the structure of double-chain HMWK has not yet been reported, the apparent zinc-dependent binding of M004-B04 described herein suggests that double-chain HMWK exists in a unique conformation in the presence of zinc.

[0190] The EDTA concentration in plasma collected in commercial spray-coated K2EDTA tubes was approximately 4 mM, which was diluted 1:20 to a well concentration of approximately 200 μM, consistent with zinc-dependent binding being restored by the addition of sufficient ZnCl2 to overwhelm the chelating ability of EDTA. In contrast, the ELISA signal of citrated plasma activated with ellagic acid did not increase in the presence of 25 μM or 50 μM (well concentration) of ZnCl2, but at ZnCl2 concentrations above 100 μM, the ELISA signal increased to a maximum value above approximately 200 μM ZnCl2 (Figure 11). Normal zinc concentrations in plasma from healthy subjects are 10-17 μM (Wessells et al., J. Nutr. (2014) 144:1204-1210). Since an increase in the ELISA signal was observed only in activated citrated plasma when the ZnCl2 concentration in the wells was above 50 μM, which corresponds to a plasma concentration of >1 mM, the ELISA appears not to be affected by physiological variations in the zinc concentration in plasma, and therefore ZnCl2 was not added to the assay buffer in subsequent experiments.

[0191] As described above, the binding of 559B-M004-B04 to double-chain HMWK was increased by supraphysiological concentrations of ZnCl2 and was inhibited by metal chelation with high concentrations of EDTA. The zinc-binding site in the double-chain HMWK domain has been described, and a synthetic peptide encompassing this site (HKH20, HKHGHGHGKHKNKGKKNGKH (SEQ ID NO: 83)) has been shown to inhibit contact system activation by weakening cell surface binding (Nakazawa et al., Int. Immunopharmacol. (2002) 2:1875-1885). Thus, it was suggested that the HKH20 peptide, as well as the GCP28 peptide corresponding to a sequence within domain 3, inhibited the binding of double-chain HMWK to 559B-M004-B04. We tested by ELISA whether the HKH20 peptide could inhibit the binding of double-chain HMWK to M004-B04. As shown in Figure 15, the HKH20 peptide inhibited the binding of double-chain HMWK to M004-B04, but the GCP28 peptide did not, suggesting that the M004-B04 epitope may be located near the zinc-binding site within domain 5. To perform the assay, the kininogen peptide was diluted to 250 μg / mL and pre-incubated in the assay plate. Purified double-chain HMWK in deficient human plasma was then diluted to 160 and added to the plate.

[0192] The time-dependence of the generation of cleaved HMWK in normal citrated human plasma was evaluated at various time points after activation of the contact activation system by ellagic acid or FXIIa (Figure 8). Finally, an ELISA assay was used to evaluate the presence and amount of cleaved HMWK in plasma samples from hereditary angioedema (HAE) patients compared to citrated plasma samples from normal patients (not affected by HAE). Samples from HAE patients were found to contain higher levels (1423±603ng / mL) of double-chain HMWK than samples from normal donors (432.4±186ng / mL) (Figure 9), which was statistically different by one-way ANOVA analysis (P=0.017).

[0193] Since M004-B04 specifically bound to a neoepitope on two-chain HMWK that was not present on single-chain HMWK or LMWK, and antibody binding was found to be dependent on plasma kallikrein activity, we also tested an assay using a pair of mouse monoclonal antibodies (11H05 and 13B12) for detection (Figure 16). Since antibody 13B12 appears to bind to the heavy chain of HMWK and 11H05 to the light chain of HMWK, combining both antibodies for detection provided an enhanced signal, likely due to the lack of overlap in the binding epitopes of the antigens between them.

[0194] It has been previously described that plasma collection is important in assessing the contact system (Suffritti et al., Clin. Exp. Allergy (2014) 44:1503-1514). It is well known that contact of plasma with glass or other polar surfaces can result in extensive ex vivo contact system activation, which can prevent accurate measurement of endogenous contact system activation (Colman et al., Blood (1997) 90:3819-3843). The ability of the optimized sandwich ELISA to detect double-chain HMWK was compared in various types of plasma, including customized plasma containing a mixture of protease inhibitors in acidic citrate dextrose, using plastic vacuum collection tubes called SCAT169 (HTI, Essex, VT). As shown in Figure 6, the standard curve generated with SCAT169 plasma was less sensitive than that generated with citrated plasma, likely due to the inclusion of 2 mM EDTA in the collected plasma. At the plasma dilution used in this assay (1:320), this concentration of EDTA (3.1 μM) does not significantly interfere with two-chain HMWK and may help stabilize plasma from proteolysis by metalloproteases.

[0195] Citrated plasma and SCAT169 plasma from healthy subjects were compared with samples from HAE patients by Western blot and sandwich ELISA assays. In Figure 17, panels A-C, Western blot detection of double-chain HMWK (i.e., cleaved kininogen) in citrated plasma was able to distinguish HAE patient samples from healthy subjects (HV) samples as shown by receiver operating characteristic (ROC) analysis with area under the curve (AUC) values ​​of 0.977 for comparison of basal state to HV or 1.0 for comparison of seizure state to HV. Citrated plasma samples from HAE patients in quiescent (basal) state were distinguished from seizure state samples with an AUC of 0.625 (Figure 17, panel D).

[0196] As shown in Figure 18, panels A-C, the Western blot assay detecting double-chain HMWK in SCAT169 plasma was able to discriminate between HAE patient samples and healthy subject (HV) samples as shown by ROC analysis with AUC values ​​of 0.915 for basal vs. HV or 0.967 for seizure vs. HV. SCAT169 samples from HAE patients in quiescent (basal) state were discriminated from seizure state samples with an AUC of 0.597 (Figure 18, panel D).

[0197] In Figure 19, panels A-C, the double-stranded ELISA assay detecting double-stranded HMWK in citrated plasma was able to discriminate between samples from HAE patients and healthy subjects as shown by ROC analysis with AUC values ​​of 0.915 for basal vs. HV or 0.866 for seizure vs. HV. Citrated plasma samples from HAE patients in the quiescent (basal) state were discriminated from seizure samples with an AUC of 0.709 (Figure 19, panel D).

[0198] As shown in Figure 20, panels A-C, the double-stranded ELISA assay detecting double-stranded HMWK in SCAT169 samples was able to discriminate between samples from HAE patients and healthy subjects as shown by ROC analysis with AUC values ​​of 0.999 for basal vs. HV or 1.0 for seizure vs. HV. Citrated plasma samples from HAE patients in quiescent (basal) state were discriminated from seizure state samples with an AUC of 0.8176 (Figure 20, panel D).

[0199] In the ROC analysis above, both the double-stranded HMWK Western blot and the double-stranded HMWK ELISA demonstrated herein may be useful in identifying patients with or at risk of having HAE based on the levels of cleaved kininogen in plasma compared to healthy subjects. The presence of protease inhibitors in SCAT169 plasma reduced ex vivo plasma activation at the time of blood collection.

[0200] Other embodiments All features disclosed herein may be combined in any combination. Each feature disclosed herein may be replaced by an alternative feature serving the same, equivalent or similar purpose. Thus, unless otherwise specified, each feature disclosed is only one example of a generic series of equivalent or similar features.

[0201] Those skilled in the art can easily ascertain the essential characteristics of the present disclosure from the above description, and can make various modifications and alterations to the present disclosure to suit various applications and conditions without departing from the spirit and scope of the present disclosure. Accordingly, other embodiments are also within the scope of the claims.

[0202] Equivalents and Scope Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the disclosure described herein. The scope of the disclosure is not intended to be limited to the above description, but is as set forth in the appended claims.

[0203] In the claims, articles such as "a," "an," and "the" may mean one or more than one, unless indicated to the contrary or otherwise clear from the context. A claim or description including "or" between one or more elements of a group is considered to be satisfied if one, more than one, or all of the elements of the group are present in, employed in, or otherwise relevant to a given product or process, unless indicated to the contrary or otherwise clear from the context. The present disclosure includes embodiments in which exactly one element of a group is present in, employed in, or otherwise relevant to a given product or process. The present disclosure includes embodiments in which more than one or all elements of a group are present in, employed in, or otherwise relevant to a given product or process.

[0204] Furthermore, the disclosure encompasses all variations, combinations, and modifications in which one or more limitations, elements, clauses, and descriptive terms from one or more recited claims are introduced into another claim. For example, any claim that is dependent on another claim can be amended to include one or more limitations set forth in any other claim that is dependent on the same base claim. When elements are listed, for example, as a Markush group format list, each subgroup of the elements is also disclosed, and any (one or more) can be deleted from the group. In general, when the disclosure or aspects of the disclosure are referred to as comprising certain elements and / or features, it should be understood that certain embodiments of the disclosure or aspects of the disclosure consist of or consist essentially of such elements and / or features. For purposes of brevity, the above embodiments have not been specifically described in these terms herein. Similarly, it should be noted that the terms "comprising" and "containing" are intended to be open-ended and allow for the inclusion of other elements or steps. When ranges are listed, they include endpoints. Additionally, unless otherwise expressly stated or apparent from the context and the understanding of one of ordinary skill in the art, values ​​expressed as ranges can be considered to be any particular value or subrange, down to one-tenth of the unit of the lower limit of that range, that is included within the ranges set forth in various embodiments of this disclosure, unless the context clearly dictates otherwise.

[0205] This application refers to various issued patents, published patent applications, academic papers, and other publications, all of which are incorporated herein by reference. In the event of any discrepancy between any incorporated reference and this specification, this specification shall control. Furthermore, any particular embodiment of the present disclosure that falls within the scope of the prior art may be expressly excluded from any one or more claims. Such embodiments may be excluded even if the exclusion is not expressly stated herein, since they are considered to be known to those skilled in the art. Any particular embodiment of the present disclosure may be excluded from any claim for any reason, whether or not related to the existence of prior art.

[0206] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific embodiments described herein. The scope of the embodiments of the invention described herein is not intended to be limited to the above description, but is as set forth in the appended claims. Those skilled in the art will appreciate that various modifications and variations can be made to this description without departing from the spirit or scope of the present disclosure, as defined in the following claims.

Claims

1. 1. An immunoassay method for detecting cleaved high molecular weight kininogen (HMWK), comprising: (i) providing a support element having immobilized thereon a first agent that specifically binds to cleaved HMWK; (ii) contacting the support element of (i) with a biological sample suspected of containing truncated HMWK; (iii) contacting the support element obtained in (ii) with a second agent that binds HMWK, the second agent being conjugated to a label; and (iv) detecting a signal emitted from the label of the second agent bound directly or indirectly to the support element to determine the level of cleaved HMWK in the biological sample; Including, Step (ii) is ２ is carried out in the presence of the first agent is an antibody comprising a heavy chain complementarity determining region (CDR) 1 sequence FSFYVMV, a heavy chain CDR2 sequence GISPSGNTAYADSVK, and a heavy chain CDR3 sequence KLFYYDDTKGYFDF, and a light chain CDR1 sequence SGSSSNIGSNYVY, a light chain CDR2 sequence RNNQRPS, and a light chain CDR3 sequence AWDDSLNGRV; Immunoassay methods.

2. The ZnCl ２ The immunoassay method of claim 1, wherein the antibody is at a concentration of at least 100 μM.

3. The antibody comprises a heavy chain variable region comprising: EVQLLESGGGLVQPGGSLRLSCAASGFTFSFYVMVWVRQAPGKGLEWVSGISPSGNTAYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARKLFYYDDTKGYFDFWGQGTLVTVSS (SEQ ID NO: 4); and a light chain variable region comprising: YELTQPPSASGTPGQRVTLSCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISG LQSEDEADYYCAAWDDSLNGRVFGGGTKLTVL (SEQ ID NO:5).

4. (a) the support element is a 96-well plate; (b) prior to step (ii), the support element of step (i) is incubated with a blocking buffer; (c) the second agent is a polyclonal antibody, a monoclonal antibody or a mixture of two or more monoclonal antibodies that bind to HMWK; and / or (d) an enzyme-linked immunosorbent assay (ELISA) assay or a lateral flow assay; The immunoassay method according to any one of claims 1 to 3.

5. the label is a signal-emitting substance; and / or the label is a member of a receptor-ligand pair, and the immunoassay method further comprises, prior to step (iv), contacting the second agent of (iii) bound to the support member with the other member of the receptor-ligand pair, the other member being conjugated to a signal-emitting substance; The immunoassay method according to any one of claims 1 to 4.

6. The immunoassay method of claim 5, wherein the receptor-ligand pair is biotin and streptavidin.

7. The immunoassay method according to any one of claims 1 to 6, wherein the biological sample is a biological sample taken from a human subject.

8. The immunoassay method described in claim 7, wherein the biological sample is a serum sample or a plasma sample.

9. 9. The immunoassay method of claim 7 or 8, wherein the serum or plasma sample is processed from a blood sample collected in an evacuated blood collection tube containing one or more protease inhibitors.

10. the human subject has a disease, A deviation of the level of cleaved HMWK in the biological sample from that in a control sample indicates that the disease is mediated by plasma kallikrein (pKal). The immunoassay method according to any one of claims 7 to 9.

11. 10. An immunoassay method according to any one of claims 7 to 9 for determining whether a human subject has a disease mediated by plasma kallikrein (pKal) or whether the human subject is at risk for a disease mediated by plasma kallikrein (pKal), comprising: a deviation in the level of cleaved HMWK in the biological sample from the level of cleaved HMWK in a control sample indicates that the human subject has the disease or is at risk for the disease. The immunoassay method according to any one of claims 7 to 9.

12. a deviation of the level of cleaved HMWK in the biological sample from the level of cleaved HMWK in a control sample indicates that the human subject is a candidate for administration of an effective amount of a therapeutic agent for the treatment of a disease; the therapeutic agent is a plasma kallikrein (pKal) inhibitor, a bradykinin 2 receptor (B2R) inhibitor, and / or a C1 esterase inhibitor (C1-INH); The pKal inhibitor may be an anti-pKal antibody or an inhibitory peptide or human plasma-derived C1-INH; The immunoassay method according to any one of claims 7 to 9.

13. The immunoassay method of claim 12, wherein the pKal inhibitor is lanadelumab, ecallantide, or icatibant.

14. the human subject is undergoing treatment for a disease; A deviation of the level of cleaved HMWK in the biological sample from that of a control sample indicates efficacy of the treatment. The immunoassay method according to any one of claims 7 to 9.

15. The immunoassay method of any one of claims 7 to 9, wherein deviation of the level of cleaved HMWK in the biological sample from the level of cleaved HMWK in a control sample indicates that the human subject is a candidate for the treatment of a disease.

16. the human subject has a history of hereditary angioedema (HAE); A deviation in the level of cleaved HMWK in the biological sample from that in a control sample indicates that the subject is at risk for developing a disease. The immunoassay method according to any one of claims 7 to 9.

17. The immunoassay method according to any one of claims 10 to 16, wherein the disease is hereditary angioedema (HAE).

Images