NEUREGULIN FOR THE TREATMENT OF HEART DEFECTS

DE602012081705T2Active Publication Date: 2025-09-03ZENSUN (SHANGHAI) SCIENCE & TECHNOLOGY CO LTD
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
DE602012081705
Authority / Receiving Office
DE · DE
Patent Type
Patents
Current Assignee / Owner
Priority Date
2011-11-02
Filing Date
2012-10-08
Publication Date
2025-09-03
Estimated Expiration
2032-10-08

AI Technical Summary

Technical Problem

Current therapies for heart failure, such as ACE inhibitors and heart transplantation, have limited efficacy and are invasive or expensive, and there is a need for more effective treatments, particularly for chronic heart failure patients.

Method used

Administration of neuregulin (NRG) to enhance cardiac muscle cell differentiation, organization, and adhesion, with treatment regimens tailored to specific patient populations identified by NYHA classification and NT-proBNP plasma levels, including introduction and maintenance phases.

Benefits of technology

Significant reduction in mortality and rehospitalization rates, along with improved myocardial performance and biomarker indicators, are achieved through targeted neuregulin treatment.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader
Need to check novelty before this filing date? Find Prior Art

Description

1. FIELD OF THE INVENTION

[0001] The present invention relates to neuregulin protein for use in a method of preventing, treating or delaying heart failure in humans Particularly, the present invention provides neuregulin for use in preventing, treating or delaying heart failure in specific populations of chronic heart failure patients.2. BACKGROUND OF THE INVENTION

[0002] Heart failure affects approximately five million Americans, and more than 550,000 new patients are diagnosed with the condition each year. Current drug therapy for heart failure is primarily directed to angiotensin-converting enzyme (ACE) inhibitors, which are vasodilators that cause blood vessels to expand, lowering blood pressure and reducing the heart's workload. While the percent reduction in mortality has been significant, the actual reduction in mortality with ACE inhibitors has averaged only 3%-4%, and there are several potential side effects. Additional limitations are associated with other options for preventing or treating heart failure. For example, heart transplantation is clearly more expensive and invasive than drug treatment, and it is further limited by the availability of donor hearts. Uses of mechanical devices, such as biventricular pacemakers, are similarly invasive and expensive. Thus, there has been a need for new therapies given the deficiencies in current therapies.

[0003] One promising new therapy involves administration of neuregulin (hereinafter referred to as "NRG") to a patient suffering from or at risk of developing heart failure. NRGs, a family of EGF-like growth factors, comprises a family of structurally related growth and differentiation factors that include NRG1, NRG2, NRG3 and NRG4 and isoforms thereof, are involved in an array of biological responses: stimulation of breast cancer cell differentiation and secretion of milk proteins; induction of neural crest cell differentiation to Schwann cells; stimulation of skeletal muscle cell synthesis of acetylcholine receptors; and, promotion of myocardial cell survival and DNA synthesis. In vivo studies of neuregulin gene-targeted homozygous mouse embryos with severe defects in ventricular trabecular formation and dorsal root ganglia development indicate that neuregulin is essential for heart and neural development.

[0004] NRGs bind to the EGF receptor family, which comprises EGFR, ErbB2, ErbB3 and ErbB4, each of which plays an important role in multiple cellular functions, including cell growth, differentiation and survival. They are protein tyrosine kinase receptors, consisting of an extracellular ligand-binding domain, transmembrane kinase domain and cytoplasmic tyrosine kinase domain. After NRG bind to the extracellular domain of ErbB3 or ErbB4, it induces a conformational change that leads to heterodimer formation between ErbB3, ErbB4 and ErbB2 or homodimer formation between ErbB4 itself, which results in phosphorylation of the receptor's C-terminal domain inside the cell membrane. The phosphorylated intracellular domain then binds additional signal proteins inside the cell, activating the corresponding downstream AKT or ERK signaling pathway, and inducing a series of cell reactions, such as stimulation or depression of cell proliferation, cell differentiation, cell apoptosis, cell migration or cell adhesion. Among these receptors, mainly ErbB2 and ErbB4 are expressed in the heart.

[0005] It has been shown that the EGF-like domains of NRG-1, ranging in size from 50 to 64-amino acids, are sufficient to bind to and activate these receptors. Previous studies have shown that neuregulin-1β (NRG-1β) can bind directly to ErbB3 and ErbB4 with high affinity. The orphan receptor, ErbB2, can form heterdimer with ErbB3 and ErbB4 with higher affinity than ErbB3 or ErbB4 homodimers. Research in neural development has indicated that the formation of the sympathetic nervous system requires an intact NRG-1β, ErbB2 and ErbB3 signaling system. Targeted disruption of the NRG-1β or ErbB2 or ErbB4 led to embryonic lethality due to cardiac development defects. Recent studies also highlighted the roles of NRG-1β, ErbB2 and ErbB4 in the cardiovascular development as well as in the maintenance of adult normal heart function. NRG-1β has been shown to enhance sarcomere organization in adult cardiomyocytes. The administration of a recombinant NRG-1β EGF-like domain significantly improves or protects against deterioration in myocardial performance in distinct animal models of heart failure as well as in clinical trials. These results make NRG-1 promising as a lead compound for the treatment of heart failure. However, there is still a need for more evidences of whether NRG-1 treatment can provide long-term benefits to the heart failure patients and whether the benefits can be provided to all chronic heart failure patients or some subpopulations.3. SUMMARY OF THE INVENTION

[0006] In human clinical trials of neuregulin for treating heart failure, applicant discovered that evaluating New York Heart Association (NYHA) heart function classification or measuring plasma level of NT-proBNP or BNP in patients allows the selection of heart failure patients who will receive significant treatment benefits from neuregulin. Such benefits include significant reduction in mortality rate.

[0007] It has been discovered by applicant that NRG enhances cardiac muscle cell differentiation and organization of sarcomeric and cytoskeleton structure, as well as cell adhesion. It has been also discovered by applicant that that NRG significantly improves or protects against deterioration in myocardial performance in distinct animal models of heart failure and in clinical trials. Neuregulin, neuregulin polypeptide, or neuregulin derivatives, fall within the scope of the present invention.

[0008] Thus, in a first aspect a pharmaceutical composition comprising an effective amount of neuregulin is provided for treating chronic heart failure patients, and the patients received significant benefits from the pharmaceutical composition. The benefit may be significant reduction of mortality rate. The benefit may be significant reduction of rehospitalization. The benefit may be the improvement of the biomarkers levels which indicate the improvement of chronic heart failure. The pharmaceutical composition may be administered to the patients for an induction regimen, hereinafter referred to in the application as introduction regimen. In some optimized examples, the introduction regimen includes an administration of the pharmaceutical composition for at least consecutive 3, 5, 7 or 10 days. In some optimized examples, the pharmaceutical composition is administered to the patients for a maintenance regimen for at least 3, 6 or 12 months after the introduction regimen. In some optimized examples the maintenance regimen includes administration of the pharmaceutical composition every 3, 5, 7 or 10 days.

[0009] In a second aspect, disclosed herein is a method to improve survival or reduce mortality of chronic heart failure patients, comprising administering a pharmaceutical composition comprising an effective amount of neuregulin to the chronic heart failure patients. In some examples, the pharmaceutical composition is administered to the patients for an introduction regimen. In some optimized examples, the introduction regimen includes administration of the pharmaceutical composition for at least consecutive 3, 5, 7 or 10 days. In some optimized examples, the pharmaceutical composition is administered to the patients for a maintenance regimen for at least 3, 6 or 12 months after the introduction regimen. In some optimized examples , the maintenance regimen includes an administration of the pharmaceutical composition every 3, 5, 7 or 10 days.

[0010] In a third aspect according to the invention, a pharmaceutically effective amount of neuregulin is used for treating chronic heart failure patients whose plasma level of NT-proBNP is within a favorite treatment zone prior to neuregulin treatment.

[0011] Specifically the present invention provides neuregulin for use in a method of treating chronic heart failure in a patient, wherein the patient has a plasma level of NT-proBNP of between 1600 fmol / ml and 4000 fmol / ml, and wherein the patient has a class II or class III heart function as classified by New York Heart Association (NYHA) heart function classification.

[0012] The present invention further provides a method of selecting a heart failure patient for treatment by neuregulin, wherein the method comprises: (i) performing an in vitro test of plasma level of NT-proBNP of the patient before treatment; (ii) evaluating heart function class by New York Heart Association (NYHA) heart function classification; and (iii) selecting the patient for treatment by neuregulin when the patient has a plasma level of NT-proBNP of between 1600 fmol / ml and 4000 fmol / ml, and a class II or class III heart function as classified by NYHA heart function classification. The favorite treatment zone is between 1600 fmol / ml and 4000 fmol / ml. In a preferred embodiment, the plasma level is measured by immunoassay.

[0013] According to the invention, a pharmaceutically effective amount of neuregulin is used for treating chronic heart failure patients who has a specific class of heart function classified by NYHA heart function classification. The specific class of heart function is NYHA class II. or NYHA class III.

[0014] In a fourth aspect, the invention features a method of selecting a heart failure patient for treatment by neuregulin. This method comprises an in vitro test measuring the plasma level of NT-proBNP in the patient. A level of between 1600 fmol / ml and 4000 fmol / ml is indicative of the patient being suitable for heart failure treatment by neuregulin. This method further comprises evaluating heart function class by NYHA heart function classification. NYHA class II or NYHA class III is indicative of the patient being suitable for heart failure treatment by neuregulin.

[0015] In a fifth aspect, the description features a diagnostic kits for selecting a heart failure patient for treatment by neuregulin. The diagnostic kits may comprise immunoassay reagents to measure plasma level of NT-proBNP in a heart failure patient wherein a level of no more than 4000 fmol / ml is indicative of the patient being suitable for heart failure treatment by neuregulin. A level of between 1600 fmol / ml and 4000 fmol / ml may be indicative of the patient being suitable for heart failure treatment by neuregulin. A level of no more than 1600 fmol / ml may be indicative of the patient being suitable for heart failure treatment by neuregulin.

[0016] In a sixth aspect the use of neuregulin protein for preparation of a medication was provided. The medication can be provided to chronic heart failure patients for long-term benefits. In one embodiment, the long-term benefit is the improvement of survival. In one embodiment, the long-term benefit is the reduction of re-hospitalization. In another embodiment, the long-term benefit is the improvement of biomarkers which indicate the long-term prognosis of chronic heart failure. In some embodiments, the medication is administered to the patients for an introduction regimen. In some optimized embodiments, the introduction regimen includes administration of medication for at least consecutive 3, 5, 7 or 10 days. In some optimized embodiments, the medication is administered to the patients for a maintenance regimen for at least 3, 6 or 12 months after the introduction regimen. In some optimized embodiments, the maintenance regimen includes an administration of the medication every 3, 5, 7 or 10 days.

[0017] In a seventh aspect according to the invention, a companion diagnostic test was provided for the treatment of chronic heart failure by neuregulin protein. N-terminal pro-brain natriuretic peptide (NT-proBNP) is used as a biomarker for the companion diagnostic test. A level of between 1600 fmol / ml and 4000 fmol / ml is indicative of the patient being suitable for heart failure treatment by neuregulin. The evaluation procedure further include NYHA heart function classification of a chronic heart failure patient. In another embodiment, the evaluation procedure includes test of plasma NT-proBNP or BNP for each chronic heart failure patient.

[0018] In an eighth aspect, a companion diagnostic kit for deciding whether a chronic heart failure patient is suitable for receiving neuregulin protein treatment is provided. The companion diagnostic kit comprises a test kit for plasma NT-proBNP or BNP and an instruction of how to use the kit and how to judge whether the subject is suitable for neuregulin protein treatment according to the test result.4. DETAILED DESCRIPTION OF THE INVENTION

[0019] The present invention provides neuregulin for use in a method of treating chronic heart failure in a patient, wherein the patient has a plasma level of NT-proBNP of between 1600 fmol / ml and 4000 fmol / ml, and wherein the patient has a class II or class III heart function as classified by New York Heart Association (NYHA) heart function classification.

[0020] According to some embodiments, the neuregulin is neuregulin-1; or wherein the neuregulin comprises the EGF-like domain of neuregulin-1; or wherein the neuregulin comprises the amino acid sequence of SEQ ID NO: 1.

[0021] According to some embodiments, the chronic heart failure is caused by ischemic, congenital, rheumatic, idiopathic, viral or toxic factors.

[0022] According to some embodiments, the method further comprises administering at least one anti-heart failure drug, optionally wherein the at least one anti-heart failure drug is selected from a group consisting of: ACE inhibitors, β-blockers, ARBs, diuretics, and digitalis.

[0023] According to some embodiments, the long-term benefit of the method is indicated by the expression level of a biomarker for diagnosis or prognosis of heart failure.

[0024] According to some embodiments, the long-term benefit of the method is indicated by the expression level of a biomarker for diagnosis or prognosis of heart failure.

[0025] According to some embodiments, the biomarker is NT-proBNP.

[0026] According to some embodiments, the biomarker is BNP.

[0027] According to some embodiments, the neuregulin is administered to the patients for an introduction regimen.

[0028] According to some embodiments, the introduction regimen includes an administration of neuregulin for at least consecutive 3, 5, 7 or 10 days.

[0029] According to some embodiments, the neuregulin is administered to the patients for a maintenance regimen after the introduction regimen.

[0030] According to some embodiments, the maintenance regimen includes an administration of neuregulin every 3, 5, 7 or 10 days.

[0031] The present invention further provides a method of selecting a heart failure patient for treatment by neuregulin, wherein the method comprises: (i) performing an in vitro test of plasma level of NT-proBNP of the patient before treatment; (ii) evaluating heart function class by New York Heart Association (NYHA) heart function classification; and (iii) selecting the patient for treatment by neuregulin when the patient has a plasma level of NT-proBNP of between 1600 fmol / ml and 4000 fmol / ml, and a class II or class III heart function as classified by NYHA heart function classification.

[0032] According to some embodiments, the neuregulin is neuregulin-1; or wherein the neuregulin comprises the EGF-like domain of neuregulin-1; or wherein the neuregulin comprises the amino acid sequence of SEQ ID NO: 1.

[0033] For clarity of disclosure, and not by way of limitation, the detailed description of the invention hereinafter is divided into the subsections that follow.A. DEFINITIONS

[0034] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of ordinary skill in the art to which this invention belongs. If a definition set forth in this section is contrary to or otherwise inconsistent with a definition set forth in the patents, applications, published applications and other publications that are herein cited by reference, the definition set forth in this section prevails over the definition that is cited herein by reference.

[0035] As used herein, the singular forms "a", "an", and "the" mean "at least one" or "one or more" unless the context clearly dictates otherwise.

[0036] As used herein, "neuregulin" or "NRG" used in the present invention refers to proteins or peptides that can bind and activate ErbB2, ErbB3, ErbB4 or combinations thereof, including but not limited to all neuregulin isoforms, neuregulin EGF-like domain alone, polypeptides comprising neuregulin EGF-like domain, neuregulin mutants or derivatives, and any kind of neuregulin-like gene products that also activate the above receptors as described in detail below. Neuregulin also includes NRG-1, NRG-2, NRG-3 and NRG-4 proteins, peptides, and fragments. Neuregulin used in the present invention can activate the above ErbB receptors and modulate their biological reactions, e.g., stimulate acetylcholine receptor synthesis in skeletal muscle cell; and / or improve cardiocyte differentiation, survival and DNA synthesis. Neuregulin also includes those variants with conservative amino acid substitutions that do not substantially alter their biological activity. Suitable conservative substitutions of amino acids are known to those of skill in this art and may be made generally without altering the biological activity of the resulting molecule. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al., Molecular Biology of the Gene, 4th Edition, 1987, The Bejacmin / Cummings Pub.co.,p.224). In preferred embodiments, neuregulin used in the present invention binds to and activates ErbB2 / ErbB4 or ErbB2 / ErbB3 heterodimers, for example, but not for the purpose of restriction, peptides including the 177-237 residues of NRG-1 β2 isoform containing the amino acid sequence: SHLVKCAEKEKTFCVNGGECF MVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ (SEQ ID NO:1). The peptides including the 177-237 residues of NRG-1 β2 isoform comprises the EGF-like domain, which has been proved to be sufficient to bind to and activate the receptors.

[0037] As used herein, "epidermal growth factor-like domain" or "EGF-like domain" refers to a polypeptide motif encoded by the neuregulin gene that binds to and activates ErbB2, ErbB3, ErbB4, or combinations thereof, and bears a structural similarity to the EGF receptor-binding domain as disclosed in WO 00 / 64400, Holmes et al., Science, 256:1205-1210 (1992); US Patent Nos.5,530,109 and 5,716,930; Hijazi et al., Int. J. Oncol., 13:1061-1067 (1998); Chang et al., Nature, 387:509-512 (1997); Carraway et al., Nature, 387:512-516 (1997); Higashiyama et al., J. Biochem., 122:675-680 (1997); and WO 97 / 09425. In certain embodiments, EGF-like domain binds to and activates ErbB2 / ErbB4 or ErbB2 / ErbB3 heterodimers. In certain embodiments, EGF-like domain comprises the amino acid sequence of the receptor binding domain of NRG-1. In some embodiments, EGF-like domain comprises the amino acid sequence corresponding to amino acid residues 177-226, 177-237, or 177-240 of NRG-1. In certain embodiments, EGF-like domain comprises the amino acid sequence of the receptor binding domain of NRG-2. In certain embodiments, EGF-like domain comprises the amino acid sequence of the receptor binding domain of NRG-3. In certain embodiments, EGF-like domain comprises the amino acid sequence of the receptor binding domain of NRG-4. In certain embodiments, EGF-like domain comprises the amino acid sequence of Ala Glu Lys Glu Lys Thr Phe Cys Val Asn Gly Gly Glu Cys Phe Met Val Lys Asp Leu Ser Asn Pro, as described in US Patent No.5,834,229.

[0038] The formulation, dosage and route of administration of a neuregulin protein, preferably in the form of pharmaceutical compositions, can be determined according to the methods known in the art (see e.g., Remington: The Science and Practice of Pharmacy, Alfonso R. Gennaro (Editor) Mack Publishing Company, April 1997; Therapeutic Peptides and Proteins: Formulation, Processing, and Delivery Systems, Banga, 1999; and Pharmaceutical Formulation Development of Peptides and Proteins, Hovgaard and Frkjr (Ed.), Taylor & Francis, Inc., 2000; Medical Applications of Liposomes, Lasic and Papahadjopoulos (Ed.), Elsevier Science, 1998; Textbook of Gene Therapy, Jain, Hogrefe & Huber Publishers, 1998; Adenoviruses: Basic Biology to Gene Therapy, Vol. 15, Seth, Landes Bioscience, 1999; Biopharmaceutical Drug Design and Development, Wu-Pong and Rojanasakul (Ed.), Humana Press, 1999; Therapeutic Angiogenesis: From Basic Science to the Clinic, Vol. 28, Dole et al. (Ed.), Springer-Verlag New York, 1999).

[0039] The neuregulin protein, can be formulated for oral, rectal, topical, inhalational, buccal (e.g., sublingual), parenteral (e.g., subcutaneous, intramuscular, intradermal, or intravenous), transdermal administration or any other suitable route of administration. The most suitable route in any given case will depend on the nature and severity of the condition being treated and on the nature of the particular neuregulin protein, which is being used. The neuregulin protein can be administered alone. Alternatively and preferably, the neuregulin protein is co-administered with a pharmaceutically acceptable carrier or excipient. Any suitable pharmaceutically acceptable carrier or excipient can be used in the present method (See e.g., Remington: The Science and Practice of Pharmacy, Alfonso R. Gennaro (Editor) Mack Publishing Company, April 1997).

[0040] According to the present invention, the neuregulin protein, alone or in combination with other agents, carriers or excipients, may be formulated for any suitable administration route, such as intracavernous injection, subcutaneous injection, intravenous injection, intramuscular injection, intradermal injection, oral or topical administration. The method may employ formulations for injectable administration in unit dosage form, in ampoules or in multidose containers, with an added preservative. The formulations may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and / or dispersing agents. Alternatively, the active ingredient may be in powder form for constitution with a suitable vehicle, sterile pyrogen-free water or other solvents, before use. Topical administration in the present invention may employ the use of a foam, gel, cream, ointment, transdermal patch, or paste.

[0041] Pharmaceutically acceptable compositions and methods for their administration that may be employed for use in this invention include, but are not limited to those described in U.S. Patent Nos. 5,736,154; 6,197,801 B1; 5,741,511; 5,886,039; 5,941,868; 6,258,374 B1; and 5,686,102.

[0042] The magnitude of a therapeutic dose in the treatment or prevention will vary with the severity of the condition to be treated and the route of administration. The dose, and perhaps dose frequency, will also vary according to age, body weight, condition and response of the individual patient.

[0043] It should be noted that the attending physician would know how to and when to terminate, interrupt or adjust therapy to lower dosage due to toxicity, or adverse effects. Conversely, the physician would also know how to and when to adjust treatment to higher levels if the clinical response is not adequate (precluding toxic side effects).

[0044] Any suitable route of administration may be used. Dosage forms include tablets, troches, cachet, dispersions, suspensions, solutions, capsules, patches, and the like. See, Remington's Pharmaceutical Sciences. In practical use, the neuregulin protein, alone or in combination with other agents, may be combined as the active in intimate admixture with a pharmaceutical carrier or excipient, such as beta-cyclodextrin and 2-hydroxy-propyl-beta-cyclodextrin, according to conventional pharmaceutical compounding techniques. The carrier may take a wide form of preparation desired for administration, topical or parenteral. In preparing compositions for parenteral dosage form, such as intravenous injection or infusion, similar pharmaceutical media may be employed, water, glycols, oils, buffers, sugar, preservatives, liposomes, and the like known to those of skill in the art. Examples of such parenteral compositions include, but are not limited to dextrose 5% wlv, normal saline or other solutions. The total dose of the neuregulin protein, alone or in combination with other agents to be administered may be administered in a vial of intravenous fluid, ranging from about 1 ml to 2000 ml. The volume of dilution fluid will vary according to the total dose administered.

[0045] Kits can carry out the therapeutic regimens. Such kits comprise in one or more containers therapeutically effective amounts of the neuregulin protein, alone or in combination with other agents, in pharmaceutically acceptable form. Preferred pharmaceutical forms would be in combination with sterile saline, dextrose solution, or buffered solution, or other pharmaceutically acceptable sterile fluid. Alternatively, the composition may be lyophilized or desiccated; in this instance, the kit optionally further comprises in a container a pharmaceutically acceptable solution, preferably sterile, to reconstitute the complex to form a solution for injection purposes. Exemplary pharmaceutically acceptable solutions are saline and dextrose solution.

[0046] In another aspect, a kit further comprises a needle or syringe, preferably packaged in sterile form, for injecting the composition, and / or a packaged alcohol pad. Instructions are optionally included for administration of composition by a physician or by the patient.

[0047] As used herein, "treat", "treatment" and "treating" refer to any manner in which the symptoms of a condition, disorder or disease are ameliorated or otherwise beneficially altered. The effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and / or may be therapeutic in terms of a partial or complete cure for a disease and / or adverse effect attributable to the disease. Treatment also encompasses any pharmaceutical use of the compositions herein.

[0048] As used herein, "heart failure" means an abnormality of cardiac function where the heart does not pump blood at the rate needed for the requirements of metabolizing tissues. Heart failure includes a wide range of disease states such as congestive heart failure, myocardial infarction, tachyarrhythmia, familial hypertrophic cardiomyopathy, ischemic heart disease, idiopathic dilated cardiomyopathy, myocarditis and the like. The heart failure can be caused by any number of factors, including, without limitation, ischemic, congenital, rheumatic, viral, toxic or idiopathic forms. Chronic cardiac hypertrophy is a significantly diseased state which is a precursor to congestive heart failure and cardiac arrest.

[0049] As used herein, "protein" is synonymous with "polypeptide" or "peptide" unless the context clearly dictates otherwise.

[0050] As used herein, "plasma" is synonymous with "serum" unless the context clearly dictates otherwise.

[0051] As used herein, "long-term benefit" means benefit caused by a treatment or interference which may not be observed in a short period after the treatment or interference. For chronic heart failure patients, long-term benefit may be improvement of survival, reduction of re-hospitalization or improvement of biomarkers which indicate the long-term prognosis. In some embodiments, the time period for observation of the benefit is about 6 months. In some embodiments, the time period for observation of the benefit is about 1 year. In some embodiments, the time period for observation of the benefit is about 2 years. And in other embodiments, the time period for observation of the benefit is about 3 years, 5 years, 10 years or longer.

[0052] As used herein, "survival" means the time or probability one subject may remain alive or living. It could be expressed by survival time or survival rate. Survival time is the time period start from the diagnosis or treatment to the end of the life. Survival rate means the percentage of people who are alive for a given period of time after diagnosis or treatment. For each subject, prolonged survival time caused by a treatment or interference could be regarded as a benefit. For a group of subjects or large populations, prolonged mean survival time or increased survival rate could be regarded as a benefit.

[0053] As used herein, "re-hospitalization" means the times or frequency of the patient admitted to the hospital in a given period of time. The admission to the hospital may be caused by all conditions, or only caused by the same condition which is being treated. For each subject, a reduction of times of re-hospitalizations in a given period of time could be regarded as a benefit. And for a group of subjects or large populations, a reduction of total times or mean times of re-hospitalizations could be regarded as a benefit.

[0054] As used herein, "N-terminal brain natriuretic peptide" or "NT-proBNP" means the inactive remnant N-terminal proBNP, the latter is the pro hormone of BNP which is a hormonally active natriuretic peptide that is mainly released from the cardiomyocytes in the left ventricular wall. In reaction to stretch and tension of the myocardial wall the pro hormone proBNP splits into BNP and the hormonally inactive remnant NT-proBNP by proteolytic cleavage.

[0055] BNP and NT-proBNP plasma levels are promising tools in the daily management of suspected or established heart failure. Most studies on the use of BNP and NT-proBNP in clinical practice addressed their diagnostic properties, and an increasingly amount of evidence is available supporting the prognostic value of BNP and NT-proBNP. As NT-proBNP has about 6 times longer of half-life in the blood than BNP, it is more widely used as a diagnostic or prognostic marker for heart failure. The plasma NT-proBNP level can be analyzed by commercial kits. For the purpose of example, but not limitation, the commercial kits from Roche or Biomedica. In the examples of the present invention, the NT-proBNP level was detected by kit from Biomedica (Austria).

[0056] Both BNP and NT-proBNP levels in the blood are used for screening, diagnosis of heart failure and are useful to establish prognosis in heart failure, as both markers are typically higher in patients with worse outcome. And, it is discovered in the present invention that plasma level of BNP or NT-proBNP is indicative of the patient being suitable for heart failure treatment by neuregulin. In fact, any diagnostic or prognostic markers for heart failure can be used to determine whether a patient is suitable for heart failure treatment by neuregulin. The plasma level of NT-proBNP identified in this invention shall be used as guidance rather than a limitation for selection of heart failure patients who will receive significant treatment benefits from neuregulin. For example, using a plasma level of 5000 fmol / ml is still able to select heart failure patients who will receive treatment benefits from neuregulin, but some of these patients will receive treatment benefits in a lesser degree.

[0057] As used herein, "New York Heart Association" or "NYHA" heart function classification is a simple way of classifying the extent of heart failure. It places patients in one of four categories based on how much they are limited during physical activity; the limitations / symptoms are in regards to normal breathing and varying degrees in shortness of breath and / or angina pain: I, no symptoms and no limitation in ordinary physical activity, e.g. shortness of breath when walking, climbing stairs etc.; II, mild symptoms (mild shortness of breath and / or angina) and slight limitation during ordinary activity; III, marked limitation in activity due to symptoms, even during less-than-ordinary activity, e.g. walking short distances (20-100 m), comfortable only at rest; and IV, severe limitations, experiences symptoms even while at rest, mostly bedbound patients.

[0058] As used herein, "activity unit" or "EU" or "U" means the quantity of standard product that can induce 50% maximal reaction. In other words, to determine the activity unit for a given active agent, the EC50 must be measured. For example, if the EC50 for a batch of product was 0.1 µg, which would be one unit. Further, if 1 µg of that product is being used, then 10 EU (1 / 0.1) is being used. The EC50 can be determined by any method known in the art, including the method employed by the inventors. This determination of the activity unit is important for quality control of genetically engineered products and clinically used drugs, permits product from different pharmaceuticals and / or different batch numbers to be quantified with uniform criteria.

[0059] The following is an exemplary, rapid, sensitive, high flux and quantitative method for determination of biological activity of NRG-1 through combining NRG with cell surface ErbB3 / ErbB4 molecule and indirect mediation of ErbB2 phosphorylation (See e.g., Michael D. Sadick et al., 1996, Analytical Biochemistry, 235:207-214 and WO03 / 099300).

[0060] Briefly, the assay, termed a kinase receptor activation enzyme-linked immunosorbant assay (KIRA-ELISA), consists of two separate microtiter plates, one for cell culture, ligand stimulation, and cell lysis / receptor solubilization and the other plate for receptor capture and phosphotyrosine ELISA. The assay was developed for analysis of NRG-induced ErbB2 activation and utilizes the stimulation of intact receptor on the adherent breast carcinoma cell line, MCF-7. Membrane proteins are solubilized via Triton X-100 lysis and the receptor is captured in ELISA wells coated with ErbB2-specific antibodies with no cross-reaction to ErbB3 or ErbB4. The degree of receptor phosphorylation is then quantified by antiphosphotyrosine ELISA. A reproducible standard curve is generated with a EC50 of approximately 360pM for heregulin beta 1 (177-244). When identical samples of HRG beta 1 (177-244) are analyzed by both the KIRA-ELISA and quantitative antiphosphotyrosine Western Blot analysis, the results correlate very closely with one another. The assay described in this report is able to specifically quantify tyrosine phosphorylation of ErbB2 that results from the interaction of HRG with ErbB3 and / or ErbB4.

[0061] Since most of the genetically engineered medicines are proteins and polypeptides, their activity can be determined by their amino acid sequences or the activity center formed by their spatial structure. Activity titer of protein and polypeptide is not consistent with their absolute quality, therefore cannot be determined with weight unit as that of chemical drugs. However, biological activity of genetically engineered medicines is generally consistent with their pharmacodynamics and titer determination system established through given biological activity can determine its titer unit. Therefore, biological activity determination can be part of a titration process of the substance with biological activity and is an important component of quality control of genetically engineered product. It is important to determine biological activity criteria for quality control of genetically engineered product and clinically used drugs.

[0062] Quantity of standard product that can induce 50% maximal reaction is defined as an activity unit (1 EU). Accordingly, product from different pharmaceuticals and of different batch numbers can be quantitated with uniform criteria.B. EXAMPLES Example 1: The effect of Neucardin ™< administration by different routes on the survival rate of rats with CHF. Introduction:

[0063] In this study, we used a coronary artery ligation (CAL) induced CHF model to investigate whether administration of Neucardin ™< by IV drip using a micro-injection pump or by subcutaneous (SC) bolus had any effects on survival rate and cardiac hemodynamics, 120 days after the initiation of administration of Neucardin ™< 4 weeks after CAL. Echocardiography and cardiac remodeling were also used to determine cardiac function and recovery from CAL.2. Methods: 2.1. Test animals:

[0064] Strain, Origin: Wistar rats, Shanghai SLAC Laboratory Animal CO. LTD; Weight, 200 ± 10g, male;2.2 Test article: 2.2.1 Neucardin ™<

[0065] Identification: Recombinant human neuregulin-1 for injection (rhNRG-1, Neucardin ™< ) Lot Number: 200607009 Manufacturer: Zensun (Shanghai) Sci & Tech Co., Ltd Dose form: Lyophilized powder Appearance: White or off-white cake Labeled Content of rhNRG-1: 250µg / vial Specific activity: 4897 U / vial Storage conditions: 2~8°C 2.2.2 Vehicle:

[0066] Identification: Placebo for recombinant human neuregulin-1 Dose form: Lyophilized powder Appearance: White or off-white cake Composition: Human serum albumin, mannitol, phosphate, NaCl Storage conditions: 2~8°C 2.3 Procedure: 2.3.1 To establish the rat CHF model:

[0067] The LAD of the rats was ligated. Briefly, the rats were anesthetized with ketamine hydrochloride (100 mg / kg, IP) and their chest was shaved and sterilized. The rats were endotracheally intubated and mechanically ventilated with room air (respiratory rate 60 breaths / min, tidal volume 20 ml). A left thoracotomy was then performed at the 4th and 5th intercostal space and then the skin was incised along the left sternal border. The fourth rib was then cut proximal to the sternum. The pericardial sac was perforated and the heart was exposed. The LAD was ligated approximately 2 mm from its origin using a 6-0 silk suture. Subsequently, the air within the thorax was removed and the chest was closed in three layers (ribs, muscles and then skin). The rats were then allowed to resume spontaneous respiration, recover from the anesthesia and were then returned to their cages. Rats were maintained during a period of 4 weeks, then echocardiography evaluated, included in the formal study if they were shown an EF% value of 30-45%. Animals from all Groups were housed 5 per cage, fed ad libitum with standard diet and had free access to pure water. Room temperature was maintained at 21 ± 1°C and in a12 h light / dark cycle.2.3.2 IV drip via microinjection pump:

[0068] The method of IV drip of vehicle or Neucardin ™< was through the tail vein. For this procedure, an appropriate rat restrainer was used according to the weight of the animal. The rat was placed near the restrainer and was gently placed into the apparatus. Normally the rats entered the restrainer without aid. Subsequently the tail of the rat was swabbed with a gauze dampened with alcohol to increase blood flow to the tail vein and to the intenerate skin corneum. The two lateral (on the side) tail veins were located and with the bevel of the needle facing upward with the needle almost parallel to the vein, the needle was inserted 2 mm into the tail vein 2-3cm from the end of the tail. To confirm that the needle was successfully inserted into the tail vein, blood was extracted into the hub of the needle. The needle was fixed into the tail using medical tape. The infusion of drug or vehicle at the appropriate rate (0.2-0.4ml / h) by microinjection pump or bolus injection was initiated.2.3.3 SC bolus

[0069] The SC bolus of vehicle or Neucardin ™< was from the back of the rat. For this procedure, an appropriate rat restrainer was used according to the weight of the animal. The back of the rat was swabbed with gauze dampened with alcohol to sterilize the skin. With the bevel of the needle facing upward with the needle almost parallel to the skin, the needle was subcutaneously inserted 3-4 cm into the back of the rat. The needle was fixed onto the back using medical tape and connected to the perfusion tube. Then, the rat was placed near the restrainer and was gently placed into the apparatus. Normally the rats entered the restrainer with no aid. After fasten the restrainer, the bolus injection was initiated.2.3.4 Experiment Groups and drug infusion:

[0070] MI rats were randomized by EF% value into four Groups as follows: Group A (Negative control) for both IV and SC bolus. n=58 rats: IV drip of vehicle for 10-days by micro-injection pump at a speed of 0.2ml / h for 8h each day for the first 10 days, SC bolus of vehicle (same volume as Neucardin ™< ), every 5days until Day 120; Group B (SC bolus Neucardin ™< ), n=58: IV drip of vehicle by micro-injection pump at a speed of 0.2ml / h for 8h each day in the first 10 days, SC bolus Neucardin ™< (10µg / day), every 5 days until Day 120; Group C (IV drip Neucardin ™< ), n=57: IV drip of Neucardin ™< (0.625µg / kg / h) by micro-injection pump at a speed of 0.2ml / h for 8h each day for the first 10 days, SC bolus of vehicle (same volume as Neucardin ™< ), every 5days until Day 120. Group D (IV drip and SC bolus Neucardin ™< ), n=57: IV drip of Neucardin ™< (0.625µg / kg / h) by micro-injection pump at a rate of 0.2 ml / h for 8h per day for the first 10 days, SC bolus of vehicle (same volume as Neucardin ™< ) at 1st, 6th, 11th day, and then SC bolus Neucardin ™< (10µg / kg), every 5days from 16th day to the end. 2.3.5 Data acquisition

[0071] Survival rate; Echocardiography parameters; Hemodynamics parameters;3. Results 3.1 Survival rate:

[0072] Table 1 illustrates the survival rates between each Group. The survival rates were 48.3%, 62.1%, 64.9% and 82.5% in the IV drip & SC bolus of vehicle Group A, SC bolus of Neucardin ™< Group B, IV drip of Neucardin ™< Group C and IV drip & SC bolus of Neucardin ™< Group D, respectively. All the survival rate or mean survival time of mortalities in Group B, C and D were improved or prolonged compared to Group A with Group D had best efficacy. Table 1: Mortality, Survival rate and Mean survival time in the four Groups Group Treatment Start rat number Deaths Survival rat number Survival rate (%) Mean survival tim mortalities in day S.E. A Vehicle 58302848.3%83.8 ± 5.9B SC bolus Neucardin ™< 58223662.1%91.4±5.5C IV drip Neucardin ™< 57203764.9%97.5±5.1D SC bolus & IV drip Neucardin ™< 57104782.5%107.5±4.1 3.2 Echocardiography parameters:

[0073] Echocardiography parameters were shown in Table 2. Four-weeks after coronary artery ligation and before administration of the test article, the CHF rats were randomized into four Groups according to their EF% values. As shown in Table 2, there were no significant differences between the four Groups before treatment (BT). 120 days after the start of administration, the EF% values were 30.7 ± 3.1, 32.9 ± 4.1, 33.5 ± 3.4, 36.2 ± 4.8% in the vehicle, Neucardin ™< via SC bolus, Neucardin ™< via IV drip and Neucardin ™< via IV drip plus SC bolus Groups, respectively. After treatment, EF% and FS% of Group B, C and D were all higher than that of Group A. Table 2: Echocardiography parameters in the four Groups Group BT N LVEDd LVEDs EF% FS% AT (cm) (cm) (%) (%) A. Negative control BT 580.987±0.0830.829±0.08838.0±5.516.2±AT 251.100 ± 0.0890.961 ±0.09030.7±3.112.7±B. SC bolus Neucardin ™< BT 580.992 ± 0.0660.831 ± 0.06638.2±4.016.3±AT 331.104 ± 0.0630.952 ± 0.07033.1±4.113.9±C. IV drip Neucardin ™< BT 570.985 ± 0.0610.824 ± 0.06838.5±4.416.3±AT 361.080 ± 0.0720.929 ± 0.07333.4±3.414.0±D. SC bolus & IV drip Neucardin ™< BT 570.979 ± 0.0650.818 ± 0.06638.7±4.316.5±AT 441.052 ± 0.0870.893 ± 0.09236.2±4.815.3±BT: Before treatment; AT: After treatment; 3.3 Hemodynamic parameters:

[0074] Table 3 shows the MAP, HR, ± dp / dt, LVEDP and LVSP values as measured in the four Groups of anesthetized animals on day 121. When Neucardin ™< was administered by SC bolus or by IV drip alone (Group B and C), Neucardin ™< significantly increased dp / dt and -dp / dt by 19.6% and 27.1%, 22.5% and 29.8% compared to Group A. When Neucardin ™< was administered by both IV drip and SC bolus routes (Group D), significant increases in mean arterial pressure (MAP, 112.3 ± 5.5mmHg), left ventricular systolic pressure (LVSP, 139.4 ± 9.8mmHg), +dp / dt (7012.1 ± 903.0 mmHg / s), -dp / dt (-4353.2 ± 847.6 mmHg / s) compared to vehicle were obtained. Interestingly, these values of MAP, LVSP, +dp / dt and -dp / dt were 10.6%, 9.2%, 38.5% and 37.8% higher than vehicle treated rats, respectively. The results showed that Group B, C and D were all better than Group A in hemodynamic parameters with Group D had best efficacy. Table 3: Hemodynamics parameters in the four Groups Group Treatment N SBP (mmHg)DBP (mmHg)MAP (mmHg)LVSP (mmHg)A Vehicle 14118.7±11.594.1±12.3102.3 ± 11.7128.5 ± 14.7B SC bolus Neucardin ™< 27123.8±11.595.3±8.9104.9±9.5129.5 ± 13.6C IV drip Neucardin ™< 25122.5 ± 10.595.0±7.5104.4±8.2131.7 ± 10.0D SC bolus & IV drip Neucardin ™< 35132.6±7.1102.1±5.3112.3±5.5139.4 ± 9.8Group Treatment N LVEDP (mmHg)dp / dt (mmHg / s)(-dp / dt) (mmHg / s)Heart rate (Beat / min)A Vehicle 145.8±3.54995.6 ± 532.23087.5 ±715.7297.2 ±16.0B SC bolus Neucardin ™< 274.5±2.86050.9± 1231.34013.8±838.3292.6±23.0C IV drip Neucardin ™< 254.0±3.26199.9 ±709.54098.9±823.5296.3 ± 13.5D SC bolus & IV drip Neucardin ™< 353.9±2.57012.1 ±903.04353.2±847.6292.5± 19.1 4. Conclusion

[0075] A combined administration of Neucardin ™< by IV drip & SC bolus or administration of the peptide given by each route alone all increased the survival rate of rats with CHF induced by CAL and improved cardiac functional parameters compared to rats treated with vehicle.Example 2: A randomized, double-blinded, multi-center, placebo controlled study to evaluate the efficacy and safety of recombinant human neuregulin 1 in patients with chronic heart failure based on standard treatment

[0076] To evaluate the efficacy of recombinant human neuregulin-1 for injection on chronic heart failure, a phase II, double-blinded, multi-center, placebo controlled, standard treatment based study was carried out in multiple clinical centers in China. A total of 195 patients with NYHA Class II or III stable chronic heart failure were enrolled and randomized into three groups: placebo, or 0.6µg / kg and 1.2µg / kg of rhNRG-1. There were no significant variations in demographics or background therapies among groups. According to the schedule, patients were administered the drug for 10 consecutive days in the hospital first, after finishing the day 11 follow up, they were discharged from the hospital. Another two on site follow up were at day 30 and day 90. A telephone interview was conducted one year after the last patient enrolled.Investigational product:

[0077] Specification: Neucardin ™< , 61 amino acid polypeptide comprises the EGF-like domain of Neuregulin-1 β2 isoform, with the molecular weight of 7054 Dal (1µg=0.14nmol). 250µg (5000 EU) / vial (1 µg=20 EU). Preparation: For injection. Mode of administration: Intravenously drip. Storage: in safe place, with limited access and protected from light, at 3-8 °C. Placebo:

[0078] Specification: Excipient for Neucardin ™< (250µg / vial without active recombinant human neuregulin-1 protein).Dosage groups:

[0079] Dosage0µg / kg / day0.6µg / kg / day1.2µg / kg / dayAdministrationIntravenous infusionVolume50mlCourse10 hours per day, for consecutive 10 days Study procedure

[0080] Criteria for participation in the trial included patients with CHF (NYHA class II or III) between the ages of 18 and 65 years old, LVEF ≤40%, in relatively stable clinical condition (including clinical signs, symptoms and accepted standard treatment for CHF at the target dose or maximum tolerance dose for over 1 month). Major exclusion criteria included acute myocardial infarction, hypertrophic cardiomyopathy, constrictive pericarditis, significant valve disease or congenital heart disease, severe pulmonary hypertension, systolic blood pressure <90mmHg or > 160mmHg, severe ventricular arrhythmia, cardiac surgery or a cerebrovascular event within the previous six months, claustrophobia or pregnant female subjects. All patients provided witnessed written consent.

[0081] Patients were randomly assigned to three groups, treated with placebo or rhNRG-1 (0.6 or 1.2 µg / kg / day) for 10 consecutive days, after finishing the day 11 follow up, they were discharged from the hospital. Another two on site follow up were at day 30 and day 90. Blood samples of each patient were collected before treatment and at day 11, 30 and 90. Plasma NT-proBNP was tested in the core lab with NT-proBNP assays (kit from Biomedica). One year after the last patient enrolled, the telephone interview was made for collecting the information of re-hospitalizations, all telephone interviews were recorded in a special form with investigators signature.

[0082] Of the 48 patients with available re-hospitalization information in the placebo group, 12 (25.0%) were rehospitalized for worsening heart failure at least once. For the 0.6 µg / kg group, only 4 (8.7%) of the 46 patients readmitted to the hospital ( P=0.05 compared to placebo) ; Rehopitalization rate of the 1.2 µg / kg group was 22.0% (11 / 50). The average times of re-hospitalizations was 0.458 (22 / 48) per patient in the placebo group, while they were reduced by 57.4% and 17.0% respectively in the 0.6 (8 / 41) and 1.2 µg / kg group (19 / 50).

[0083] In the placebo group, the NT-proBNP were almost the same during the study while compare to the baseline. At day 11, the NT-proBNP was significantly increased in rhNRG-1 treated groups (from 1853±1512 to 2399±1841 fmol / ml in 0.6µg / kg group, P<0.01; from 1562±1275 to 2774±1926 fmol / ml in 1.2µg / kg group, P<0.01). But his increase was transient and was not caused by a worsening heart function as the cardiac function shown to be increased, the NT-proBNP decreased to the baseline level at Day 30 and Day 90 in the 1.2µg / kg group. Moreover, in the 0.6µg / kg group, the NT-proBNP was significantly reduced at day 30 (1323±1124 fmol / ml, P=0.01) and day 90 (1518±1403fmol / ml, P=0.01) while compare to the baseline.

[0084] These results showed that rhNRG-1 treatment can reduce the re-hospitalizations and the plasma level of NT-proBNP, which may indicate rhNRG-1 can provide long-term benefits to chronic heart failure patients.Example 3: A randomized, double-blinded, multi-center, placebo controlled survival study of recombinant human neuregulin 1 in patients with chronic heart failure based on standard treatment

[0085] To evaluate the efficacy of recombinant human neuregulin-1 for injection on chronic heart failure, a phase II, double-blinded, multi-center, placebo controlled, standard treatment based study was carried out in multiple clinical centers in China. A total of 351 patients with NYHA Class III or IV stable chronic heart failure were enrolled and randomized into placebo group or rhNRG-1 group (0.6µg / kg). There were no significant variations in demographics or background therapies among groups. According to the schedule, patients were administered with the drug for 10 consecutive days in the hospital, after finishing the day 11 follow up, they were discharged from the hospital, and were administered with the drug once weekly from the 3 rd< week till the 25 th< week as out-patient. Blood samples of each patient were collected before treatment (baseline) and at each follow up. Plasma NT-proBNP level was tested in the core lab with NT-proBNP assays (kit from Biomedica). The survival information was collected at 52th week of the study.Investigational product:

[0086] Specification: Neucardin ™< , 61 amino acid polypeptide comprises the EGF-like domain of Neuregulin-1 β2 isoform, with the molecular weight of 7054 Dal (1µg=0.14nmol). 250µg (5000 EU) / vial (1 µg=20 EU). Preparation: For injection. Mode of administration: Intravenously drip or infusion. Storage: in safe place, with limited access and protected from light, at 3-8 °C. Placebo:

[0087] Specification: Excipient for Neucardin ™< . 250µg / vial and without active recombinant human neuregulin-1 protein.Dosage and regimens:

[0088] Day1-10Week 3-25Dose0.6µg / kg / day rhNRG-1 or placebo0.8µg / kg / day rhNRG-1 or placeboRouteIntravenous dripIntravenous infusionregimen10 hours per day for 10 days10 minutes infusion weekly

[0089] Criteria for participation in the trial included patients with CHF (NYHA class III or IV) between the ages of 18 and 80 years old, LVEF ≤40%, in relatively stable clinical condition (including clinical signs, symptoms and accepted standard treatment for CHF at the target dose or maximum tolerance dose for over 1 month). Major exclusion criteria included acute myocardial infarction, hypertrophic cardiomyopathy, constrictive pericarditis, significant valve disease or congenital heart disease, severe pulmonary hypertension, systolic blood pressure <90mmHg or >160mmHg, severe ventricular arrhythmia, cardiac surgery or a cerebrovascular event within the previous six months, claustrophobia or pregnant female subjects. All patients provided witnessed written consent.

[0090] The all-cause mortality of the placebo group at 52 week is 15.91%, with 28 death in 176 patients, while the number is 9.71% in rhNRG-1 group, with 16 death in 175 patients completed the trial (Hazard ratio=0.425, 95%CI 0.222-0.813, p=0.0097). Considering the mortality caused by cardiovascular events, the number of the placebo group at 52 week is 14.77%, with 26 death in 176 patients, and 9.71% in the rhNRG-1 group. So from the results we can find around 40% decrease of the mortality of rhNRG-1 administration compared with placebo group, even the placebo group were still maintain their previous standard treatment for chronic heart failure.

[0091] We also analyzed the all-cause mortality based on the stratification of baseline NT-proBNP. When the NT-proBNP level is stratified into 3 stratums as ≤1600fmol / ml, >1600fmol / ml and ≤4000fmol / ml, or >4000fmol / ml, the mortality of rhNRG-1 group vs placebo group are 1.49% vs 8.49%, 8.96% vs 23.33%, and 26.67% vs 28.00%, respectively. And if the NT-proBNP level is stratified as ≤4000fmol / ml or >4000fmol / ml, the mortality of rhNRG-1 group vs placebo group are 5.22% vs 14.89% (p=0.0092), and 26.67% vs 28.00%, respectively. These results show statistical significance that rhNRG-1 can effectively improve the survival of chronic heart failure patients.

[0092] Further, the patients were stratified with their baseline NYHA heart function class, to be class III or class IV. The all-cause mortality of class III patients in rhNRG-1 group or placebo group is 6.06% (8 death in 132 patients) and 15.49% (22 death in 142 patients), respectively, p=0.0189. While the all-cause mortality of class IV patients in rhNRG-1 group or placebo group is 20.93% (9 death in 43 patients) and 17.65% (6 death in 34 patients), respectively, p=0.7789.

Claims

1. Neuregulin for use in a method of treating chronic heart failure in a patient, wherein the patient has a plasma level of NT-proBNP of between 1600 fmol / ml and 4000 fmol / ml, and wherein the patient has a class II or class III heart function as classified by New York Heart Association (NYHA) heart function classification.

2. The neuregulin for use of claim 1, wherein the neuregulin is neuregulin-1; or wherein the neuregulin comprises the EGF-like domain of neuregulin-1; or wherein the neuregulin comprises the amino acid sequence of SEQ ID NO: 1.

3. The neuregulin for use of claim 1 or 2, wherein the chronic heart failure is caused by ischemic, congenital, rheumatic, idiopathic, viral or toxic factors.

4. The neuregulin for use of any one of claims 1 to 3, wherein the method further comprises administering at least one anti-heart failure drug, optionally wherein the at least one anti-heart failure drug is selected from a group consisting of: ACE inhibitors, β-blockers, ARBs, diuretics, and digitalis.

5. The neuregulin for use of any of claims 1 to 4, wherein the long-term benefit of the method is indicated by the expression level of a biomarker for diagnosis or prognosis of heart failure.

6. The neuregulin for use of claim 5, wherein the biomarker is NT-proBNP.

7. The neuregulin for use of claim 5, wherein the biomarker is BNP.

8. The neuregulin for use of any of claims 1 to 7, wherein the neuregulin is administered to the patients for an introduction regimen.

9. The neuregulin for use of claim 8, wherein the introduction regimen includes an administration of neuregulin for at least consecutive 3, 5, 7 or 10 days.

10. The neuregulin for use of claim 8 or 9, wherein the neuregulin is administered to the patients for a maintenance regimen after the introduction regimen.

11. The neuregulin for use of claim 10, wherein the maintenance regimen includes an administration of neuregulin every 3, 5, 7 or 10 days.

12. A method of selecting a heart failure patient for treatment by neuregulin, wherein the method comprises: (i) performing an in vitro test of plasma level of NT-proBNP of the patient before treatment; (ii) evaluating heart function class by New York Heart Association (NYHA) heart function classification; and (iii) selecting the patient for treatment by neuregulin when the patient has a plasma level of NT-proBNP of between 1600 fmol / ml and 4000 fmol / ml, and a class II or class III heart function as classified by NYHA heart function classification.

13. The method of claim 12, wherein the neuregulin is neuregulin-1; or wherein the neuregulin comprises the EGF-like domain of neuregulin-1; or wherein the neuregulin comprises the amino acid sequence of SEQ ID NO: 1.