Arrdc1-mediated microvesicle-based delivery of rna-guided proteins

EP4680617A1Inactive Publication Date: 2026-01-21TURN BIOTECHNOLOGIES INC
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
EP2024771593
Authority / Receiving Office
EP · EP
Patent Type
Applications
Current Assignee / Owner
Priority Date
2023-03-13
Filing Date
2024-03-12
Publication Date
2026-01-21
Estimated Expiration
Not applicable · inactive patent

AI Technical Summary

Technical Problem

Current RNA-guided genome editing technologies face challenges in delivering RNA-guided proteins, such as base editors, effectively in vivo, necessitating improved delivery mechanisms.

Method used

The use of ARRDC1-mediated microvesicles (ARMMs) to load and deliver RNA-guided proteins, including base editors, into cells, utilizing a lipid bilayer and ARRDC1 protein, along with guide RNA, to facilitate targeted cellular uptake.

Benefits of technology

This method enables efficient and targeted delivery of RNA-guided proteins into cells, enhancing the potential for treating a wide range of diseases by improving the efficacy of genome editing technologies.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure IMGF000022_0001
    Figure IMGF000022_0001
  • Figure IMGF000023_0001
    Figure IMGF000023_0001
  • Figure IMGF000024_0001
    Figure IMGF000024_0001
Patent Text Reader

Abstract

The present invention provides methods, systems, and compositions for ARMM-mediated delivery of RNA-guided proteins (e.g., base editors) to cells.
Need to check novelty before this filing date? Find Prior Art

Description

ARRDC1-MEDIATED MICROVESICLE-BASED DELIVERY OF RNA-GUIDED PROTEINSClaim of Priority

[0001] This application claims the benefit of U.S. Provisional Application Serial No. 63 / 451,898, filed on March 13, 2023. The entire contents of the foregoing are incorporated herein by reference.Field of the Invention

[0002] The present invention provides methods, systems, and compositions for ARMM- mediated delivery of RNA-guided proteins (e.g., base editors) to cells.Background of the Invention

[0003] RNA guided genome editing technologies have the potential to treat a wide range of currently incurable diseases. There remains a need for improved delivery mechanisms in general, and, in particular, for in vivo delivery.Summary of the Invention

[0004] The present disclosure relates to the discovery that RNA guided gene editors, such as base editors, can be loaded into microvesicles, specifically ARRDC1 -mediated microvesicles (ARMMs) for delivery into cells.

[0005] Provided herein, are among other things, arrestin domain-containing protein 1 (ARRDCl)-mediated microvesicle(s) (ARMMs), comprising: (i)a lipid bilayer and an ARRDC1 protein, fragment thereof, or variant thereof, (ii) a RNA-guided protein, and (iii) a gRNA.

[0006] In some embodiments, the RNA-guided protein is a Cas fusion protein. In some embodiments, the RNA-guided protein is a base editor. In some embodiments, the base editor is an adenine base editor. In some embodiments, the base editor is a cytosine base editor. In some embodiments, the base editor comprises a sequence having at least 70%, 80%, 85%, 90%, 95%, or 99% identity to any one of the base editors of Example 1, Example 2, Example 3, Example 4, Example 5, or Example 6. In some embodiments, the base editor comprises of consists of any one of the base editors of Example 1, Example 2, Example 3, Example 4, Example 5, or Example 6. In some embodiments, the gRNA is a sgRNA. In some embodiments, the gRNA is a crRNA + tracrRNA. In some embodiments, the RNA-guided protein and gRNA are complexed together as a ribonucleoprotein (RNP). In some embodiments, the ARRDC1 protein,fragment thereof, or variant thereof, is fused to the RNA-guided protein, optionally with an intervening linker and / or cleavage domain. In some embodiments, the RNA-guided protein is fused to a WW-domain, optionally with an intervening linker and / or cleavage domain.

[0007] Also provided herein are microvesicle-producing cell(s) comprising: nucleic acid construct(s) encoding: (i) an ARRDC1 protein, fragment thereof, or variant thereof, (ii) a RNA- guided protein, and (iii) a gRNA. In some embodiments, the RNA-guided protein is a Cas fusion protein. In some embodiments, the RNA-guided protein is a base editor. In some embodiments, the base editor is an adenine base editor. In some embodiments, the base editor is a cytosine base editor. In some embodiments, the base editor comprises a sequence having at least 70%, 80%, 85%, 90%, 95%, or 99% identity to any one of the base editors of Example 1, Example 2, Example 3, Example 4, Example 5, or Example 6. In some embodiments, the base editor comprises of consists of any one of the base editors of Example 1, Example 2, Example 3, Example 4, Example 5, or Example 6. In some embodiments, the gRNA is a sgRNA. In some embodiments, the gRNA is a crRNA + tracrRNA. In some embodiments, the ARRDC1 protein, fragment thereof, or variant thereof, is fused to the RNA-guided protein, optionally with an intervening linker and / or cleavage domain. In some embodiments, the RNA-guided protein is fused to a WW-domain, optionally with an intervening linker and / or cleavage domain.

[0008] Also provided herein are methods of delivering a molecule to a target cell, said method comprising contacting the target cell with any of the microvesicles described herein.

[0009] Also provided herein are methods of treating a disorder in a patient, the method consisting of administering to the patient any of the microvesicles described herein. A method of treating a disorder in a patient, the method consisting of administering to the patient any of the microvesicle-producing cells described herein. In some embodiments, said patient is a mammal. In some embodiments, said mammal is a primate. In some embodiments, said primate is a human.

[0010] Also provided herein are any of the ARMMs described herein, for use a medicament or manufacture of a medicament. Also provided herein are composition(s) substantially as shown and described. Also provided herein are method(s) substantially as shown and described.

[0011] ARMMs are microvesicles that are distinct from exosomes which, like budding viruses, are produced by direct plasma membrane budding (“DPMB”). DPMB is driven by a specific interaction of TSG101 w ith a tetrapeptide PSAP (SEQ ID NO: 1) motif of the arrestin- domain-containing protein ARRDC1 accessory protein, which is localized to the plasma membrane through its arrestin domain. ARMMs have been described in detail, for example, inPCT application number PCT / US2013 / 024839, filed February 6, 2013 (published as WO 2013 / 119602 Al on August 15, 2013) by Lu, Q., et al., and entitled “Arrdcl -Mediated Microvesicles (ARMMs) and Uses Thereof,” as well as in U.S. Pat. Nos.: 9,737,480; 9,816,080; 10,260,055; and PCT Publication WO2018 / 067546; the entire contents of which are hereby incorporated by reference in their entirety. The ARRDC1 / TSG101 interaction results in the relocation of TSG101 from endosomes to the plasma membrane and mediates the release of microvesicles that contain TSG101, ARRDC1, and other cellular components as well as the molecule of interest.

[0012] Molecules of interest, whether naturally or non-naturally, occurring include, but are not limited to, proteins, nucleic acids, and small molecules that can preferably associate with one or more ARMM related proteins (e.g., ARRDC1), or can be modified to associate with more specifically, TSG101 or ARRDC1 or specific motifis) therein. These associations facilitate the incorporation of the molecules into ARMMs, which in turn can be used to deliver the desired payload (molecule of interest) into a targeted cell. By way of example, but not limitation, a payload RNA can be fused to a trans-activation response (TAR) element, thereby allowing it to associate with an ARRDC1 protein that is fused to an RNA binding protein, such as a Tat protein (e.g., bovine TAT protein). Alternatively, a payload protein can be fused to one or more WW domains, which associate with the PPXY (SEQ ID NO: 2) motif of ARRDC1. The association of the molecule to an ARMM-related protein (e.g., ARRDC1), facilitates the loading of the molecule into the ARRDC 1 -containing ARMM. Alternatively, the molecule can be fused to an ARMM protein (e.g., TSG101 or ARRDC1) to load the payload into the ARMM. The molecule can be fused to the ARMM protein (e.g.. TSG101 or ARRDC1) via a linker that may be cleaved upon delivery to a target cell.

[0013] In some additional aspects of the invention, methods of delivering a molecule (e.g, one or more therapeutic agents) to a target cell type, tissue, or structure by contacting the target with a microvesicle, as described herein, are provided.

[0014] In some aspects of the invention, methods of treating a disorder in a patient by administering to the patient a microvesicle or a microvesicle-producing cell as described herein are provided. In other aspects of the invention, the disorder is either a gain-of-function disorder, a loss-of-function disorder, or a repeat expansion. In still other aspects of the invention, the disorder results from one or more substitutions (e.g., missense or nonsense), insertions, deletions, deletion-insertions, duplications, inversions, frameshifts, or repeat expansions.

[0015] Other advantages, features, and uses of the invention will be apparent from the detailed description of certain exemplar}’, non-limiting embodiments, the drawings, the nonlimiting working examples, and the claims.Description of the Drawings

[0016] FIG. 1 shows base editing efficiency at the two editing target sites in an in vivo study of ARMMs with ARRDC1-ABE and gRNAl.

[0017] FIG. 2 shows base editing efficiency at the two editing target sites in an in vivo study of ARMMs with ARRDC1-ABE and gRNA2.

[0018] FIG. 3 A shows base editing efficiency in human HEK293 cells with ARRDC1-CEB and HEK3 gRNA.

[0019] FIG. 3B shows base editing efficiency in human HEK293 cells with ARRDC1-CEB and HEK2 gRNA.

[0020] FIG. 4 shows CBE editing on GFP.

[0021] FIGS. 5A-5C show that base editing by CBE with GFP gRNA in human HEK293 GFP stable expression cells can introduce a premature termination stop codon which terminates translation of nascent GFP transcripts. FIG. 5A: control; FIG. 5B: CBE-GFP -gRNAl; FIG. 5C: CBE-GFP-double stop gRNA.Definitions

[0022] The terms “ARRDC1 -mediated microvesicle” or “ARMM,” as used herein, refers to a microvesicle comprising an ARRDC1 protein or variant thereof, and / or TSG101 protein, or variant thereof. ARMMs have been described in detail, for example, in PCT application number PCT / US2013 / 024839, filed February 6, 2013 (published as WO 2013 / 119602 Al on August 15, 2013) by Lu et al., and entitled “Arrdcl-Mediated Microvesicles (ARMMs) and Uses Thereof.” as well as in U.S. Pat Nos. 9,737,480; 9,816,080; 10,260,055, 10,945,954, 11,001,817, and PCT Publications WO2018 / 067546, WO2021 / 062196, and WO2021 / 252924; the entire contents of which are hereby incorporated by reference in their entirety. In some embodiments, the ARMM is shed from a cell (e.g, producer cell), and comprises an agent (payload), for example, a nucleic acid, protein, or small molecule, present in the cytoplasm or associated with the membrane of the cell. Exemplar}- payloads include, but are not limited to a nucleic acid, protein, or small molecule, present in the cytoplasm or associated with the membrane of the cell. In some embodiments, the ARMM is shed from a cell (e.g., a transgenic cell), and comprises an agent, for example, a nucleic acid, protein, or small molecule, present in the cytoplasm or associated with the membrane of the cell. In some embodiments, the ARMM is shed from a transgenic cellcomprising a recombinant expression construct that includes a transgene, and the ARMM comprises a gene product, for example, an RNA transcript and / or a protein (e.g, an ARRDC 1- Tat fusion protein and a TAR- payload RNA) encoded by the expression construct. In some embodiments, the ARMM is produced synthetically, for example, by contacting a lipid bilayer with an ARRDC 1 protein or a variant thereof, or a variant thereof, in a cell-free system in the presence of TSG101, or a variant thereof. In other embodiments, the ARMM is synthetically produced by contacting a lipid bilayer with HECT domain ligase, and VPS4a. In some embodiments, an ARMM lacks a late endosomal marker. Some of the ARMMs provided herein do not include, or are negative for, one or more exosomal biomarkers. Exosomal biomarkers are known to those of skill in the art and include, but are not limited to, CD63, Lamp-1, Lamp-2. CD9, HSPA8, GAPDH, CD81, SDCBP, PDCD6IP, EN01, ANXA2, ACTB, YWHAZ, HSP90AA1, ANXA5, EEF1A1, YWHAE, PPIA, MSN, CFL1, ALDOA, PGK1, EEF2, ANXA1, PKM2, HLA-DRA, and YWHAB. Certain ARMMs provided herein may include an exosomal biomarker. Accordingly, some ARMMs may be negative for one or more other exosomal biomarkers, but positive for one or more different exosomal biomarkers. For example, such an ARMM may be negative for CD63 and Lamp-1 but may include PGK1 or GAPDH; or may be negative for CD63, Lamp-1, CD9, and CD81, but may be positive for HLA-DRA. In some embodiments, ARMMs include an exosomal biomarker, but at a lower level than the level found in exosomes. For example, some ARMMs include one or more exosomal biomarkers at a level of less than about 1%, less than about 5%, less than about 10%, less than about 20%, less than about 30%, less than about 40%, or less than about 50% of the level of that biomarker found in exosomes. To give a non-limiting example, in some embodiments, an ARMM may be negative for CD63 and Lamp-1, include CD9 at a level of less than about 5% of the level of CD9 typically found in exosomes, and be positive for ACTB. Exosomal biomarkers in addition to those listed above are known in the art, and the invention is not limited in this regard.

[0023] The term ‘‘cargo protein,” as used herein, refers to a protein that may be incorporated in an ARMM, for example, into the liquid phase of the ARMM or into the lipid bilayer of an ARMM. The term ‘'cargo protein to be delivered” refers to any protein that can be delivered via its association with or inclusion in an ARMM to a subject, organ, tissue, or cell. In some embodiments, the cargo protein is to be delivered to a target cell in vitro, in vivo, or ex vivo. In some embodiments, the cargo protein to be delivered is a biologically active agent, i.e.. it has activity in a cell, organ, tissue, and / or subject. For instance, a protein that, when administered to a subject, has a biological effect on that subject, is considered biologically active. In certainembodiments, the cargo protein is a nuclease or variant thereof (e.g., a Cas9 protein or variant thereof). In certain embodiments, the nuclease may be a Cas9 nuclease, a TALE nuclease, a zinc finger nuclease, or any variant thereof. Nucleases, including Cas9 proteins and their variants, are described in more detail elsewhere herein. In some embodiments, the Cas9 protein or variant thereof is associated with nucleic acid. For example, the cargo protein may be a Cas9 protein associated with a gRNA. In some embodiments, a cargo protein to be delivered is a therapeutic agent.

[0024] As used herein, the term “therapeutic agent” refers to any agent that, when administered to a subject has a beneficial effect. In some embodiments, the therapeutic agent compnses a small molecule, a protein (or peptide), one or more nucleic acids, or an agent associated with a small molecule. In some embodiments, the payload to be delivered is a diagnostic agent. In some embodiments, the agent to be delivered is a prophylactic agent. In some embodiments, the agent to be delivered is useful as an imaging agent. In some of these embodiments, the diagnostic or imaging agent is, and in others, it is not, biologically active. In some embodiments, the therapeutic agent comprises an agent that reduces (knocks down) the expression of one or more genes in an organism (e.g., a subject). In other embodiments, the therapeutic agent comprises an agent that inactivates or removes (knocks out) one or more specific genes in an organism (e.g, a subject). In some embodiments, the therapeutic agent to be delivered to a cell is a transcription factor, a tumor suppressor, a developmental regulator, a growth factor, a metastasis suppressor, a pro-apoptotic protein, a nuclease, or a recombinase.

[0025] As used herein, the term “therapeutic effect” refers to a consequence of treatment, the results of which are judged to be desirable and beneficial. A therapeutic effect can include, directly or indirectly, the arrest, reduction, or elimination of a disease manifestation. A therapeutic effect can also include, directly or indirectly, the arrest reduction or elimination of the progression of a disease manifestation.

[0026] As used herein, the term “transcription factor” refers to a DNA-binding protein that regulates the transcription of DNA into RNA, for example, by activation or repression of transcription. Some transcription factors affect the regulation of transcription alone, while others act in concert with other proteins. Some transcription factors can both activate and repress transcription under certain conditions. In general, transcription factors bind a specific target sequence or sequences highly similar to a specific consensus sequence in a regulatory region of a target gene. Transcription factors may regulate the transcription of a target gene alone or in a complex with other molecules. Examples of transcription factors include, but are not limited to.Spl, NF1, CCAAT, GATA, HNF. PIT-1, MyoD, Myf5. Hox. Winged Helix, SREBP, p53. CREB, AP-1 , Mef2, STAT, R-SMAD, NF-Kp, Notch, TUBBY, and NF AT.

[0027] The term “binding RNA,” as used herein, refers to a ribonucleic acid (RNA) that binds to an RNA binding protein, for example, any of the RNA binding proteins known in the art and / or described herein. In some embodiments, a binding RNA is an RNA that specifically binds to an RNA binding protein. A binding RNA that “specifically binds” to an RNA binding protein, binds to the RNA binding protein with greater affinity, avidity, more readily, and / or with greater duration than it binds to another protein, such as a protein that does not bind the RNA or a protein that weakly binds to the binding RNA. In some embodiments, the binding RNA is a naturally occurring RNA, or non-naturally occurring variant thereof, that binds to a specific RNA binding protein. For example, the binding RNA may be a TAR element, a Rev response element, an MS2 RNA, or any variant thereof that specifically binds an RNA binding protein. In some embodiments, the binding RNA may be a trans-activating response element (TAR element), or variant thereof, which is an RNA stem-loop structure that is found at the 5'-ends of nascent HIV-1 transcripts and specifically binds to the trans-activator of transcription (Tat) protein. In some embodiments, the binding RNA is a Rev response element (RRE), or variant thereof, that specifically binds to the accessory' protein Rev (e.g., Rev from HIV-1). In some embodiments, the binding RNA is an MS2 RNA that specifically binds to a MS2 phage coat protein. The binding RNAs of the present disclosure may be designed to specifically bind a protein (e.g, an RNA binding protein fused to ARRDC1) to facilitate loading of the binding RNA (e.g., a binding RNA fused to a payload RNA) into an ARMM.

[0028] The term “aptamer,” as used herein, refers to nucleic acids (e.g., RNA, DNA) that bind to a specific target molecule, e.g.. an RNA binding protein. In some embodiments, nucleic acid (e.g., DNA or RNA) aptamers are engineered through repeated rounds of in vitro selection or alternatively, SELEX (systematic evolution of ligands by exponential enrichment) methodology, to bind to various molecular targets, for example, proteins, small molecules, macromolecules, metabolites, carbohydrates, metals, nucleic acids, cells, tissues, and organisms. Methods for engineering aptamers to bind to various molecular targets, such as proteins, are known in the art and include those described in U.S. Pat. Nos. 6,376,19; and 9,061,043; Shui, B., et al., “RNA aptamers that functionally interact with green fluorescent protein and its derivatives .” Nucleic Acids Res., Mar; 40(5): e39 (2012); Trujillo, U.H., et al., “DNA and RNA aptamers: from tools for basic research towards therapeutic applications f Comb. Chem. High Throughput Screen. 9(8):619- 32 (2006); Srisawat. C , et al.. “Streptavidin aptamers: Affinity)tags for the study ofRNAs and ribonucleoproteins f RNA, 7:632-641 (2001); and Tuerk and Gold, “Systematic evolution of ligands by exponential enrichment: RNA ligands to bacteriophage T4 DNA polymerase f Science, (1990); the entire contents of each of which are hereby incorporated by reference in their entirety.

[0029] The term "‘RNA binding protein.” as used herein, refers to a polypeptide molecule that binds to a binding RNA, for example, any of the binding RNAs known in the art and / or described herein. In some embodiments, an RNA binding protein is a protein that specifically binds to a binding RNA. An RNA binding protein that “specifically binds” to a binding RNA, binds to the binding RNA with greater affinity, avidity, more readily, and / or with greater duration than it binds to another RNA, such as a control RNA (e.g.. an RNA having a random nucleic acid sequence) or an RNA that weakly binds to the RNA binding protein. In some embodiments, the RNA binding protein is a naturally occurring protein or a non-naturally occurring variant thereof, that binds to a specific RNA. For example, in some embodiments, the RNA binding protein may be a trans-activator of transcription (Tat) protein that specifically binds a trans-activating response element (TAR element). In some embodiments, the Tat protein is from a bovine. In some embodiments, the RNA binding protein is a regulator of virion expression (Rev) protein (e.g., Rev from HIV-1) or variant thereof, that specifically binds to a Rev response element (RRE). In some embodiments, the RNA binding protein is a coat protein of an MS2 bacteriophage that specifically binds to an MS2 RNA. The RNA binding proteins useful in the present disclosure (e.g., a binding protein fused to ARRDC1) may be designed to specifically bind a binding RNA (e.g., a binding RNA fused to a payload RNA) to facilitate loading of the binding RNA into an ARMM.

[0030] The term “payload.” “payload protein,” “payload nucleic acid,” “payload DNA.” “payload RNA,” or “payload small molecule,” as used herein, refers to a protein, nucleic acid, including DNA or RNA, or a small molecule, respectively, that may be incorporated into an ARMM, for example, into the liquid phase of the ARMM or into the lipid bilayer of an ARMM. Types of payload protein, payload nucleic acid, payload DNA, payload RNA, and payload small molecule are known in the art and include those described in U.S. Pat. Nos.: 9,737,480; 9,816,080; 10,260,055; and PCT Publication WO2018 / 067546; the entire contents of each of which are hereby incorporated by reference in their entirety.

[0031] The payload can be delivered via its association with or inclusion in an ARMM to a subject, organ, tissue, or cell. In some embodiments, the payload is to be delivered to a targeted cell in vitro, in vivo, or ex vivo. In some embodiments, the payload to be delivered is abiologically active agent, i.e., it has activity in a cell, organ, tissue, and / or subject. For instance, a protein, nucleic acid (e.g., DNA or RNA), or small molecule that, when administered to a subject, has a biological effect on that subject or is biologically active. In some embodiments, a payload to be delivered is a therapeutic agent.

[0032] The term "linker." as used herein, refers to a chemical moiety linking two molecules or moi eties, e.g. , an ARRDC 1 protein and a Tat protein, a WW domain, and a Tat protein, or an ARRDC1 protein and a Cas9 nuclease. Typically, the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two. In some embodiments, the linker comprises an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker comprises a nucleotide (e.g., DNA or RNA) or a plurality of nucleotides (e.g. , a nucleic acid). In some embodiments, the linker is an organic molecule, functional group, polymer, or other chemical moiety / moieties. In some embodiments, the linker is a cleavable linker, e.g., the linker comprises a bond that can be cleaved upon exposure to, for example, UV light or a hydrolytic enzyme, such as a protease or esterase. In some embodiments, the linker is any stretch of amino acids having at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, at least 30, at least 40, at least 50, or more amino acids (e.g., 1, 2, 3, 4, 5, 6. 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22. 23. 24, 25, 26, 27, 28, 29, 30, 31, 32, 33. 34. 35, 36, 37, 38, 39, 40, 41, 42. 43. 44. 45. 46. 47. 48. 49. or 50 amino acids). In other embodiments, the linker is a chemical bond (e.g., a covalent bond, amide bond, disulfide bond, ester bond, carbon-carbon bond, carbon-heteroatom bond, and the like).

[0033] As used herein, the term "animal" refers to any member of the animal kingdom. In some embodiments, the term “animal” refers to a human of either sex at any stage of development. In some embodiments, the term “animal” refers to a non-human animal at any stage of development. In certain embodiments, the non-human animal is a mammal e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig). Animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, and worms. In some embodiments, the animal is a transgenic animal, a genetically engineered animal, or a clone. In some embodiments, the animal is a transgenic non-human animal, a genetically engineered non-human animal, or a non-human clone.

[0034] As used herein, the terms “associated with.” “conjugated,” “linked,” “attached,” and the like, when used with respect to two or more entities, for example, with chemical moieties, molecules, and / or ARMMs, means that the entities are physically associated or connected withone another, either directly or via one or more additional moieties that serve as a linker, to form a structure that is sufficiently stable so that the entities remain physically associated under the conditions in which the structure is used, e.g., under physiological conditions. An ARMM microvesicle is ty pically associated with an agent, for example, a nucleic acid, protein, or small molecule, by a mechanism that involves a covalent (e.g., via an amide bond) or non-covalent association (e.g. , between ARRDC 1 and a WW domain, or between a Tat protein and a TAR element). In certain embodiments, the agent (e.g., a therapeutic agent, a payload protein, payload nucleic acid, or pay load small molecule) is covalently bound to a molecule that associates non- covalently with a part of the ARMM that is fused to an ARRCD1 protein, a TSG101 protein or variant thereof, or a lipid bilayer-associated protein by a covalent bond (e.g., an amide bond), or variant thereof. In some embodiments, the association is via a linker, for example, a cleavable linker. In some embodiments, an entity (e.g., a payload protein, payload nucleic acid, or payload small molecule) is associated with an ARMM by inclusion in the ARMM, for example, by encapsulation of the molecule within the ARMM. For example, in some embodiments, a molecule (e.g. , a therapeutic agent, a payload protein, payload nucleic acid, or payload small molecule) present in the cytoplasm of an ARMM-producing cell is associated with an ARMM by encapsulation of the cytoplasm with the agent in the ARMM upon ARMM budding. Similarly, a membrane protein or other molecule associated with the cell membrane of an ARMM producing cell may be associated with an ARMM produced by the cell by inclusion into the ARMM’s membrane upon budding.

[0035] As used herein, the phrase “biologically active” refers to a characteristic of any substance that has activity in a cell, organ, tissue, and / or subject. For instance, a substance that when administered to an organism produces or elicits a biological effect on that organism is biologically active. As one example, a payload RNA may be considered biologically active if it increases or decreases the expression of a gene product when administered to a subject or cell. As another example, a nuclease payload protein may be considered biologically active if it increases or decreases the expression of a gene product when administered to a subject.

[0036] As used herein, the term “conserved” refers to nucleotides or amino acid residues of a polynucleotide sequence or amino acid sequence, respectively, that are those that occur unaltered in the same position of two or more related sequences being compared. Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences. In some embodiments, two or more sequences are said to be “completely conserved” if they are 100% identical to oneanother. In some embodiments, two or more sequences are said to be "highly conserved” if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be “highly conserved” if they are about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another. In some embodiments, two or more sequences are said to be “conserved” if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be “conserved” if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another.

[0037] The term “engineered,” as used herein, refers to a protein, nucleic acid, complex, substance, or entity that has been designed, produced, prepared, synthesized, and / or manufactured by a human. Accordingly, an engineered product is a product that does not occur in nature. In some embodiments, an engineered protein or nucleic acid is a protein or nucleic acid that has been designed to meet requirements or to have desired features. For example, a pay load RNA may be engineered to associate with the ARRDC1 by fusing one or more WW domains to a Tat protein and fusing the payload RNA to a TAR element to facilitate loading of the payload RNA into an ARMM. As another example, a payload RNA may be engineered to associate with the ARRDC1 by fusing a Tat protein to the ARRDC1 and by fusing the payload RNA to a TAR element to facilitate loading of the pay load RNA into an ARMM. As another example, a payload protein may be engineered to associate with the ARRDC1 by fusing one or more WW domains to the payload protein to facilitate the loading of the payload protein into an ARMM.

[0038] As used herein, the term “expression” of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA transcript from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g, by splicing, editing, 5' cap formation, and / or 3' end processing); (3) translation of an RNA transcript into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein.

[0039] The term “operably linked,” as used herein, refers to an arrangement of sequences or regions wherein the components are configured to perform their usual or intended function. Thus, a regulatory or control sequence operably linked to a coding sequence is capable of affecting the expression of the coding sequence. The regulatory or control sequences need not becontiguous with the coding sequence, so long as they function to direct the proper expression or polypeptide production. Thus, for example, intervening untranslated but transcribed sequences can be present between a promoter sequence and the coding sequence and the promoter sequence can still be considered operably linked to the coding sequence. A promoter sequence, as described herein, is a DNA regulatory region a short distance from the 5' end of a gene that acts as the binding site for RNA polymerase. The promoter sequence may bind RNA polymerase in a cell and / or initiate transcription of a dow nstream (3' direction) coding sequence. The promoter sequence may be a promoter capable of initiating transcription in prokaryotes or eukary otes. Some non-limiting examples of eukaryotic promoters include the cytomegalovirus (CMV) promoter, the chicken [3-actin (CBA) promoter, and a hybrid form of the CBA promoter (CBh).

[0040] As used herein, a “fusion protein’’ includes a first protein moiety', e.g. , an ARRCD1 protein or variant thereof, or a TSG101 protein or variant thereof, associated with a second protein moiety, for example, a protein to be delivered to a target cell through a peptide linkage. In certain embodiments, the fusion protein is encoded by a single fusion gene.

[0041] As used herein, the term “gene” has its meaning as understood in the art. It will be appreciated by those of ordinary skill in the art that the term “gene” may include gene regulatory7sequences (e.g., promoters, enhancers, etc.) and / or intron sequences. It will further be appreciated that the definition of a gene includes references to nucleic acids that do not encode proteins but rather encode functional RNA molecules, such as gRNAs, RNAi agents, ribozymes, tRNAs, etc. It should be noted that, as used in the present application, the term “gene” generally refers to a portion of a nucleic acid that encodes a protein; the term may optionally encompass regulatory sequences, as will be clear from context to those of ordinary skill in the art. This definition is not intended to exclude the application of the term “gene” to non-protein-coding expression units but rather to clarify that, in most cases, the term as used herein refers to a protein-coding nucleic acid.

[0042] As used herein, the terni “gene product” or “expression product” generally refers to an RNA transcribed from the gene (pre-and / or post-processing) or a polypeptide (pre- and / or post-modification) encoded by an RNA transcribed from the gene.

[0043] As used herein, the term “green fluorescent protein” (GFP) refers to a protein originally isolated from the jellyfish Aequorea victoria that fluoresces green when exposed to blue light or a derivative of such a protein (e.g., an enhanced or wavelength-shifted version of the protein). The amino acid sequence of wild-fype GFP is as follows:MSKGEELFTGWPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLP VPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKT RAEVKFEGDTLVNRIELKGI DFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRD HMVLLEFVTAAGITHGMDELYK (SEQ ID N0: 3)

[0044] Proteins that are at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% homologous to SEQ ID NO: 3 are also considered to be green fluorescent proteins.

[0045] As used herein, the term “homology” refers to the overall relatedness between nucleic acids (e.g., DNA molecules and / or RNA molecules) or polypeptides. In some embodiments, nucleic acids or proteins are considered to be “homologous” to one another if their sequences are at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical. In some embodiments, nucleic acids or proteins are considered “homologous” to one another if their sequences are at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical. The term “homologous” necessarily refers to a comparison between at least two sequences (nucleotide sequences or amino acid sequences). In accordance with the invention, two nucleotide sequences are considered homologous if the polypeptides they encode are at least about 50% identical, at least about 60% identical, at least about 70% identical, at least about 80% identical, or at least about 90% identical for at least one stretch of at least about 20 amino acids. In some embodiments, homologous nucleotide sequences are characterized by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. Both the identity and the approximate spacing of these amino acids relative to one another must be considered for sequences to be considered homologous. For nucleotide sequences less than 60 nucleotides in length, homology is determined by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. In accordance with the invention, two protein sequences are considered homologous if the proteins are at least about 50% identical, at least about 60% identical, at least about 70% identical, at least about 80% identical, or at least about 90% identical for at least one stretch of at least about 20 amino acids.

[0046] As used herein, the term “identity” refers to the overall relatedness between nucleic acids or proteins (e.g, DNA molecules, RNA molecules, and / or polypeptides). Calculation of the percent identity of two nucleic acid sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g. , gaps can be introduced in one or both of a first and second nucleic acid sequence for optimal alignment and non-identical sequences can bedisregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two nucleotide sequences can be determined using methods such as those described in Computational Molecular Biology’, Lesk, A.M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smth, D. W.. ed., Academic Press. New York. 1993; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G, eds., Humana Press, New Jersey, 1994; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; each of which is incorporated herein by reference. For example, the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4: 11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The percent identity’ between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix. Methods commonly employed to determine percent identity between sequences include, but are not limited to those disclosed in Carillo, H., and Lipman, D., SIAM J Applied Math., 48: 1073 (1988); incorporated herein by reference.Techniques for determining identity are codified in publicly available computer programs. Exemplary computer software to determine homology between two sequences include, but are not limited to, GCG program package, Devereux, J., et al.. Nucleic Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN, and FASTA Atschul, S.F., et al., J. Molec. Biol., 215, 403 (1990)).

[0047] As used herein, the term “zn vitro" refers to events that occur in an artificial environment, e.g. , in a test tube or reaction vessel, in cell culture, in a Petri dish, etc. , rather than within an organism (e.g.. animal, plant, or microbe).

[0048] As used herein, the term “in vivo” refers to events that occur within an organism (e.g., animal, plant, or microbe).

[0049] As used herein, the term “<?x vivo” refers to events outside of the living body and thusly is understood to refer to medical procedures in which an organ, cells, or tissue is taken from a living body for a treatment or procedure, and then returned to the same, or another, living body. In certain embodiments, ex vivo therapy comprises inducing one or more genetic modifications in a patient’s cells outside of their body to produce therapeutic effects therein and the subsequent transfer (e.g., transplantation) of the cells back into the patient.

[0050] As used herein, the term “‘isolated” refers to a substance or entity that has been: (1) separated from at least some of the components with which it was associated when initially produced (whether in nature or in an experimental setting); and / or (2) produced, prepared, and / or manufactured by the hand of man. Isolated substances and / or entities may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%. or more of the other components with which they were initially associated. In some embodiments, isolated substances are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is “pure” if it is substantially free of other components.

[0051] As used herein, the term “nucleic acid,” in its broadest sense, refers to a compound and / or substance that is or can be incorporated into an oligonucleotide chain via a phosphodiester linkage. In some embodiments, “nucleic acid” refers to individual nucleic acid residues (e.g., nucleotides and / or nucleosides). In some embodiments, “nucleic acid” refers to an oligonucleotide chain comprising individual nucleotides. As used herein, the terms “oligonucleotide” and “polynucleotide” can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least two nucleotides). In some embodiments, “‘nucleic acid” encompasses RNA as well as single and / or double-stranded DNA and / or complementary DNA (cDNA). Furthermore, the terms “nucleic acid,” “DNA,” “RNA,” and / or similar terms include nucleic acid analogs, z.e., analogs having other than a phosphodiester backbone. For example, the so-called “peptide nucleic acids,” which are known in the art and have peptide bonds instead of phosphodi ester bonds in the backbone, are considered within the scope of the present invention. The term “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and / or encode the same amino acid sequence. Nucleotide sequences that encode proteins and / or RNA may include introns. Nucleicacids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g. , in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, backbone modifications, etc. A nucleic acid sequence is presented in the 5' to 3' direction unless otherwise indicated. The term “nucleic acid segment” is used herein to refer to a nucleic acid sequence that is a portion of a longer nucleic acid sequence. In many embodiments, a nucleic acid segment comprises at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, or more residues. In some embodiments, a nucleic acid is or comprises natural nucleosides (e.g.. adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxy cytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo- pyrimidine, 3-methyl adenosine, 5 -methylcytidine, 2-aminoadenosine, C5-bromouridine, C5- fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine, and 2 -thiocytidine); chemically modified bases; biologically modified bases (e.g, methylated bases); intercalated bases; modified sugars (e.g. , 2'-fluororibose, ribose, 2'-deoxyribose, arabinose, and hexose); and / or modified phosphate groups (e.g., phosphorothioates and 5'-A-phosphoramidite linkages). In some embodiments, the present invention is specifically directed to “unmodified nucleic acids,” meaning nucleic acids (e.g., polynucleotides and residues, including nucleotides and / or nucleosides) that have not been chemically modified to facilitate or achieve delivery'.

[0052] As used herein, the term “protein” refers to a string of at least two amino acids linked to one another by one or more peptide bonds. Proteins may include moieties other than amino acids (e.g., may be glycoproteins) and / or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a “protein” can be a complete protein chain as produced by a cell (with or without a signal sequence) or can be a functional portion thereof. Those of ordinary’ skill will further appreciate that a protein can sometimes include more than one protein chain, for example linked by one or more disulfide bonds or associated by other means. Proteins may contain L-amino acids, D-amino acids, or both and may contain any of a variety’ of amino acid modifications or analogs known in the art. Useful modifications include, e.g., addition of a chemical entity such as a carbohydrate group, a phosphate group, a famesyl group, an isofamesyl group, a fatty acid group, an amide group, a terminal acetyl group, a linker for conjugation, functionalization, or other modification (e.g, alpha amidation), etc. In certainembodiments, the modifications of the protein lead to a more stable protein (e.g.. greater half-life in vivo). These modifications may include cyclization of the protein, the incorporation of D- amino acids, etc. None of the modifications should substantially interfere with the desired biological activity of the protein. In certain embodiments, the modifications of the protein lead to a more biologically active protein. In some embodiments, proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, amino acid analogs, and combinations thereof.

[0053] As used herein, the terms “subject,” or “patient” refer to any organism to which a composition in accordance with the invention may be administered, e.g., for experimental, diagnostic, prophylactic, and / or therapeutic purposes. Typical subjects include animals (e.g., mammals, such as mice, rats, rabbits, production and farm animals, pets, non-human primates, and humans). In some embodiments, the subject is a patient having or suspected of having a disease or disorder. In other embodiments, the subject is a healthy volunteer.

[0054] As used herein, the terms "disease," and “disorder” refer to any condition, pathological condition, or disorder that damages or interferes with the normal function of a cell, tissue, or organ.

[0055] As used herein, the terms “treating,” or "treatment" refer to partially or completely preventing, altering, and / or reducing the incidence of one or more symptoms or features of a particular disease or deleterious condition. In one sense of the invention, treatments can be performed either for prophylaxis or amelioration of a pathological condition in a subject. Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. Treatment may be administered to a subject who does not exhibit signs or symptoms of a disease, disorder, condition, or to a subject who exhibits only early signs or symptoms of a disease, or condition for the purpose of decreasing the risk of developing or progressing to more severe effects associated with the disease, disorder, or condition. A treatment may prevent the onset of the disorder or a symptom of the disorder in a subject. A treatment can prevent physical deterioration (e.g., loss of vision, loss of visual acuity7, low7vision, blindness, decrease in ambulation, and more generally, any ameliorable morbidity) caused by a by preventing or reversing its progression.

[0056] As used herein, the term "therapeutically effective amount” means an amount of an agent or payload to be delivered (e.g., nucleic acid, protein, drug, therapeutic agent, diagnostic agent, prophylactic agent, ARMM, or ARMM comprising a payload protein or payload RNA) that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and / or condition, to treat, improve symptoms thereof, diagnose, prevent, and / or delay the onset of the disease, disorder, and / or condition. A therapeutically effective amount may be initially determined from preliminary in vitro studies and / or animal models. A therapeutically effective dose may also be determined from human data. The applied dose may be adjusted based on the relative bioavailability and potency of the administered compound. Adjusting the dose to achieve maximal efficacy based on the methods described above and other well-known methods is within the capabilities of the ordinarily skilled artisan. General principles for determining therapeutic effectiveness, which may be found in Chapter 1 of Goodman and Gilman's The Pharmacological Basis of Therapeutics, 10th Edition, McGraw-Hill (New York) (2001), incorporated herein by reference in its entirety.

[0057] As used herein, the term "targeting ligand" refers to a ligand, or a function portion thereof, that binds to "a targeted receptor" that distinguishes the cell being targeted from other cells. The ligands may be capable of binding due to expression or preferential expression of a receptor for the ligand, accessible for ligand binding, on the target cells. Examples of such ligands include GE11 peptide, anti-EGFR nanobody, cRGD (cyclo (RGDfC). KE108 peptide, octreotide, prostate-specific membrane antigen (PSMA) aptamer, TRC105, chimeric monoclonal antibodies, tumor-specific monoclonal or polyclonal antibodies (e.g, Rituximab, Trastuzumab, Bevacizumab, Alemtuzumab, Panitumumab, etc., and bioequivalents and portions thereof), arginylglycylaspartic acid (“RGD”), DARPins, RNA aptamers, DNA aptamers, inteins, exteins, viral derived and nonviral derived cell-cell fusion protein (“fusogen(s)”) (e.g., VSV-G, syncytin- 1, -2, HAP2, SNAREs (e.g., VAMP1, 2, 3, 4, 7, 8)), membrane proteins, such as tetraspanins ("TM4SF proteins”) (e g., TSPAN1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29. 30. 31. 32, and 33. and the like), peptide ligands identified from library screens, tumor-specific peptides, tumor-specific aptamers. Fab or scFv ( / .e., a single chain variable region) fragments of antibodies such as, for example, an Fab fragment of an antibody directed to EphA2 or other proteins specifically expressed or uniquely accessible on metastatic cancer cells, growth factors, such as EGF, FGF, insulin, and insulin-like growth factors, and homologous polypeptides, somatostatin and its analogs, transferrin, lipoprotein complexes, Arg-Gly-Asp containing peptides, microtubule-associated sequence (MTAS),various galectins. 5-opioid receptor ligands, cholecystokinin A receptor ligands, ligands specific for angiotensin ATI or AT2 receptors, peroxisome proliferator-activated receptor y ligands, and other molecules that bind specifically to a receptor preferentially expressed on the surface of targeted cells or on an infectious organism, and fragments of any of these molecules.

[0058] The term "a targeted receptor," as used herein, refers to a receptor expressed by a cell that can bind a cell targeting ligand. The receptor may be expressed on the surface of the cell. The receptor may be a transmembrane receptor. Examples of such targeted receptors include, but are not limited to, EGFR, avp3 integrin, somatostatin receptor, folate receptor, prostate-specific membrane antigen, CD 105, mannose receptor, estrogen receptor, GM1 ganglioside, and the like.

[0059] In some embodiments, cell penetrating peptides may also be attached to one or more PEG terminal groups in place of or in addition to the targeting ligand. As used herein, the terms “cell penetrating peptide’’ (“CPP”), “protein transduction domain” (“PTD”), or “membrane translocating sequence,” refer to short peptides (e.g., from 4 to about 40 amino acids) that have the ability’ to translocate across a cellular membrane to gain access to the interior of a cell and to carry into the cells a variety of covalently and noncovalently conjugated cargoes, including proteins, and oligonucleotides. In preferred embodiments, CPPs comprise: 1) a high relative abundance of positively charged amino acids (e.g., lysine or arginine); 2) an amino acid sequence that comprises an alternating pattern of polar, charged amino acids and non-polar, hydrophobic amino acids; or 3) an amino acid sequence that comprises hydrophobic peptides (e.g., mostly apolar residues with low net charge or hydrophobic amino acid groups). (See, e.g., US Pat. Pub. No.: 20220177494; Oliveira, E.C, et al., ''Predicting cell-penetrating peptides using machine learning algorithms and navigating in their chemical space, ” Scientific Reports., 11(1): 7628 (2021); Derakhshankhah, H., and Jafari, S., “Cell penetrating peptides: A concise review with emphasis on biomedical applications Biomedicine & Pharmacotherapy., 108: 1090- 1096 (2018); Milletti, F., “Cell-penetrating peptides: classes, origin, and current landscape, " Drug Discover}' Today, 17(15-16):850-860 (2012); Stalmans, S., et al., “Chemical-functional diversity in cell-penetrating peptides " PLOS ONE, 8(8):e71752 (2013); Wagstaff, K.M., and Jans, D.A., “Protein transduction: cell penetrating peptides and their therapeutic applications f Current Medicinal Chemistry, 13(12): 1371-1387 (2006), the entire contents of each of which are hereby incorporated by reference in their entirety'). Examples of CPP peptides include, but are not limited to: TAT cell penetrating peptide; MAP; Penetratin or Antenapedia PTD; Penetratin- Arg; antitrypsin (358-374); Temporin L; Maurocalcine; pVEC (Cadherin-5); Calcitonin;Neurturin; Penetratin; TAT-HA2 Fusion Peptide; TAT (47-57); SynBl ; SynB3; PTD-4; PTD-5;FHV Coat-(35-49); BMV Gag-(7-25); HTLV-II Rex-(4-16); HIV-1 Tat (48-60) or D-Tat; R9- Tat; Transportan; SBP or Human Pl ; FBP; MPG(SNES); Pep-1 or Pep- 1 -Cysteamine; Pep-2; Periodic sequences, Polyarginines (RxN (4<N<17) chimera); Poly lysines (KxN (4<N<17) chimera); (RAca)6R; (RAbu)6R; (RG)6R; (RM)6R; (RT)6R; (RS)6R; RIO; (RA)6R; and R7.

[0060] As used herein, a “vector" means any nucleic acid or nucleic acid-bearing particle, cell, or organism capable of being used to transfer a nucleic acid into a host cell. The term “vector” includes both viral and nonviral products and means for introducing the nucleic acid into a cell. A “vector” can be used in vitro, ex vivo, or in vivo. Vectors capable of directing the expression of operatively linked genes are referred to herein as “expression vectors.” Non-viral vectors include plasmids, cosmids, artificial chromosomes (e.g., bacterial artificial chromosomes or yeast artificial chromosomes), liposomes, electrically charged lipids (cytofectins), DNA- protein complexes, and biopolymers, for example. Viral vectors include, but are not limited to, retroviruses, lentiviruses, adeno-associated virus, pox viruses, baculovirus, reoviruses, vaccinia viruses, herpes simplex viruses, Epstein-Barr viruses, and adenovirus vectors, for example. Vectors can also comprise the entire genome sequence or recombinant genome sequence of a virus. A vector can also comprise a portion of the genome that comprises the functional sequences to produce a virus capable of infecting, entering, or being introduced to a cell to deliver nucleic acid therein.

[0061] The term “WW domain” as used herein, refers to a protein domain having two basic residues at the C-terminus that mediates protein-protein interactions with short proline-rich or proline-containing motifs. It should be appreciated that the two basic residues (e.g., any two of: H, R, and K) of the WW domain are not required to be at the absolute C-terminal end of the WW protein domain. Rather, the two basic residues may be at a C-terminal portion of the WW protein domain (e.g., the C-terminal half of the WW protein domain). In some embodiments, the WW domain contains at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 tryptophan (W) residues. In some embodiments, the WW domain contains at least two W residues. In some embodiments, the at least two W residues are spaced apart by from 15-25 amino acids. In some embodiments, the at least two W residues are spaced apart by from 19-23 amino acids. In some embodiments, the at least two W residues are spaced apart by from 20-22 amino acids. The WW domain possessing the two basic C-terminal amino acid residues may have the ability to associate with short proline-rich or proline-containing motifs (e.g., a PPXY (SEQ ID NO; 2) motif). WW domains bind a variety of distinct peptide ligands including motifs with core proline-rich sequences, such as PPXY (SEQ ID NO: 2), which is found in ARRDC 1 . A WW domain may be a 30-40 aminoacid protein interaction domain with two signature tryptophan residues spaced by 20-22 amino acids. The three-dimensional structure of WW domains shows that they generally fold into a three-stranded, antiparallel P sheet with two ligand-binding grooves.

[0062] WW domains are found in many eukaryotes and are present in approximately 50 human proteins (Bork, P. & Sudol. M., “ZT / e WW domain: a signaling site in dystrophin?” Trends Biochem Sci., 19, 531-533 (1994)). WW domains may be present together with several other interaction domains, including membrane targeting domains, such as C2 in the NEDD4 family proteins, the phosphoty rosine-binding (PTB) domain in FE65 protein, FF domains in CA150 and FBPI1, and pleckstrin homology (PH) domains in PLEKHA5. WW domains are also linked to a variety of catalytic domains, including HECT E3 protein-ubiquitin ligase domains in NEDD4 family proteins, rotomerase or peptidyl prolyisomerase domains in Pinl, and Rho GAP domains in ArhGAP9 and ArhGAP12.

[0063] The WW domain may be a WW domain that naturally possesses two basic amino acids at the C-terminus. In some embodiments, a WW domain or WW domain variant may be from the human ubiquitin ligase WWP1, WWP2, Nedd4-1, Nedd4-2, Smurf 1, Smurf2, ITCH, NEDL1, orNEDL2. Exemplary amino acid sequences of WW domain containing proteins (WW domains underlined) are listed below. It should be appreciated that any of the WW domains or WW domain variants of the exemplary proteins may be used in the invention, described herein, and are not meant to be limiting.

[0064] Human WWP1 amino acid sequence (uniprot.org / uniprot / Q9H0M0). The four underlined WW domains correspond to amino acids 349 - 382 (WW1), 381 - 414 (WW2), 456 - 489 (WW3), and 496 - 529 (WW4).

[0067] Human Nedd4-2 amino acid sequence (>gi|21361472|ref|NP 056092.2| E3 ubiquitin- protein ligase NEDD4-like isoform 3 [Homo sapiens]). The four underlined WW domains correspond to amino acids 198 - 224 (WW1), 368 - 396 (WW2), 480 - 510 (WW3), and 531 - 561 (WW4).

[0068] Human Smurfl amino acid sequence (uniprot.org / uniprot / Q9HCE7). The two underlined WW domains correspond to amino acids 234 - 267 (WW1) and 306 - 339 (WW2).

[0069] Human Smurf2 amino acid sequence (uniprot.org / uniprot / Q9HAU4). The three underlined WW domains correspond to amino acids 157 - 190 (WW1). 251 - 284 (WW2). and 297 - 330 (WW3).

[0070] Human ITCH amino acid sequence (uniprot.org / uniprot / Q96J02). The four underlined WW domains correspond to amino acids 326 - 359 (WW1), 358 - 391 (WW2). 438 - 471 (WW3), and 478 - 511 (WW4).

[0071] Human NEDL1 amino acid sequence (uniprot.org / uniprot / Q76N89). The two underlined WW domains correspond to amino acids 829 - 862 (WW1), and 1018 - 1051 (WW2).

[0072] Human NEDL2 amino acid sequence (uniprot.org / uniprot / Q9P2P5). The two underlined WW domains correspond to amino acids 807 - 840 (WW1) and 985 - 1018 (WW2).

[0073] In some embodiments, the WW domain consists essentially of a WW domain or WW domain variant. Consists essentially of means that a domain, peptide, or polypeptide consists essentially of an amino acid sequence when such an amino acid sequence is present with only a few additional amino acid residues, for example, from about 1 to about 10 or so additional residues, typically from 1 to about 5 additional residues in the domain, peptide, or polypeptide.

[0074] Alternatively, the WW domain may be a WW domain that has been modified to include two basic amino acids at the C-terminus of the domain. Techniques are known in the art and are described in the art, for example, in Sambrook et al.. Molecular Cloning: a Laboratory Manual, 3rd ed., Cold Spring Harbor Laboratory Press (2001). Thus, a skilled person could readily modify an existing WW domain that does not normally have two C-terminal basic residues so as to include two basic residues at the C-terminus.

[0075] Basic amino acids are amino acids that possess a side-chain functional group that has a pKa of greater than 7 and includes lysine, arginine, and histidine, as w ell as basic amino acids that are not included in the twenty a-amino acids commonly included in proteins. The two basic amino acids at the C-terminus of the WW domain may be the same basic amino acid or may be different basic amino acids. In one embodiment, the two basic amino acids are two arginines.

[0076] The term WW domain also includes variants of a WW domain provided that any such variant possesses two basic amino acids at its C-terminus and maintains the ability of the WW domain to associate with the PPXY (SEQ ID NO: 2) motif. A variant of such a WW domain refers to a WW domain that retains the ability of the variant to associate with the PPXY (SEQ ID NO: 2) motif (i.e., the PPXY (SEQ ID NO:2) motif of ARRDC1 and that has been mutated at one or more amino acids, including point, insertion, and / or deletion mutations, but still retains the ability’ to associate with the PPXY (SEQ ID NO: 2) motif. A variant or derivative, therefore, includes deletions, including truncations and fragments; insertions and additions, for example, conservative substitutions, site-directed mutants and allelic variants: and modifications, including one or more non-amino acyl groups (e.g., sugar, lipid, etc. ) covalently linked to the peptide and post-translational modifications. In making such changes, substitutions of like amino acid residues can be made on the basis of relative similarity of side-chain substituents, for example, their size, charge, hydrophobicity, hydrophilicity, and the like, and such substitutions may be assayed for their effect on the function of the peptide by routine testing.

[0077] The WW domain may be part of a longer protein. Thus, the protein, in various different embodiments, comprises the WW domain, consists of the WW domain, or consists essentially of the WW domain, as defined herein. The polypeptide may be a protein that includes a WW domain as a functional domain within the protein sequence.

[0078] The term “Cas9,” or “Cas9 protein,” or “Cas9 polypeptide” refers to an RNA-guided nuclease comprising a Cas9 protein as well as fusion proteins containing such Cas9 proteins and variants thereof (e.g.. a protein comprising an active, inactive, or altered DNA cleavage domain of Cas9, and / or the gRNA binding domain of Cas9). In some embodiments, the fused proteinsmay include those that modify the epigenome or control transcriptional activity. The variants may include deletions or additions, such as, e.g., addition of one, two, or more nuclear localization sequences (such as from SV40 and others known in the art), e.g. , 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 such sequences or a range betw een and including any tw o of the foregoing values.

[0079] In some embodiments, the Cas9 polypeptide is a Cas9 protein found in a type II CRISPR-associated system. Suitable Cas9 polypeptides that may be used in certain embodiments of the present invention include, but are not limited to, Cas9 protein from Streptococcus pyogenes (Sp. Cas9), F. novicida, S. aureus, S. thermophiles, N. meningitidis , and variants thereof.

[0080] A Cas9 nuclease is also referred to sometimes as a casnl nuclease or a CR1SPR (clustered regularly interspaced short palindromic repeat)-associated nuclease. CRISPR is an adaptive immune system that provides protection against mobile genetic elements (e.g., viruses, transposable elements, and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). In type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA (tracrRNA), endogenous ribonuclease 3 (me) and a Cas9 protein. The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA. Subsequently. Cas9 / crRNA / tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer. The target strand not complementary' to crRNA is first cut endonucleolytically, then trimmed 3'-5' exonucleolytically. In nature, DNA-binding and cleavage ty pically requires protein and both RNAs. How ever, single guide RNAs (“sgRNA,”, or simply "gRN A") can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. (See, e.g., Jinek M., et al., Science, 337:816-821 (2012), the entire contents of which is hereby incorporated by reference). Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self. Cas9 nuclease sequences and structures are well known to those of skill in the art. (See, e.g., Ferretti et al. , “Complete genome sequence of an Ml strain of Streptococcus pyogenes f Proc. Natl. Acad. Sci. U.S.A., 98:4658-4663 (2001);“CRISPR RNA maturation by trans-encoded small RNA and host factor RNase Ulf Deltcheva E., et al. , “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase Ulf Nature, 471 :602-607 (2011); and Jinek, M., et al., “A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity f Science, 337:816-821 (2012), the entire contents of each of w hich are incorporated herein by reference). Additional suitable Cas9 nucleases andsequences will be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in the art. (See, e.g., Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems ,” RNA Biology, 10:5, 726-737 (2013); Karvelis, G ., et al., “Harnessing the natural diversity and in vitro evolution of Cas9 to expand the genome editing toolbox.” Current Opinion in Microbiology, 37:88-94 (2017); Komor, A. C., et al., “CRISPR- Based Technologies for the Manipulation of Eukaryotic Genomes.” Cell, 168:20-36 (2017); and Murovec, J., et al., “New variants of CRISPR RNA-guided genome editing enzymes,” Plant Biotechnol. J., 15:917-26 (2017), the entire contents of each of which are incorporated herein by reference).

[0081] In some embodiments, the Cas9 polypeptide is a wild-type Cas9, a nickase, or comprises a nuclease inactivated (“dCas9” for nuclease-" dead" Cas9) protein.

[0082] Methods for generating a Cas9 protein (or a variant thereof) having an inactive DNA cleavage domain are known (See, e.g.. Jinek et al. , Science. 337:816-821(2012); Qi et al., “Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression.” Cell, 28; 152(5): 1173-83 (2013), the entire contents of each of which are incorporated herein by reference). For example, the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvC 1 subdomain. The HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvCl subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9. For example, the mutations D10A and H841A completely inactivate the nuclease activity of S. pyogenes Cas9 (Jinek et al., Science, 337:816-821 (2012); Qi el al., Cell, 28;152(5): 1173-83 (2013)). In some embodiments, proteins comprising variants of Cas9 are provided. For example, in some embodiments, a protein comprises one of two Cas9 domains: (1) the gRNA binding domain of Cas9; or (2) the DNA cleavage domain of Cas9. In some embodiments, proteins comprising Cas9 or variants thereof are referred to as "Cas9 variants." A Cas9 variant shares homology to Cas9, or a variant thereof. For example, a Cas9 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to wild type Cas9. In some embodiments, the Cas9 variant comprises a variant of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical,at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to the corresponding variant of wild type Cas9. In some embodiments, wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC 017053.1, SEQ ID NO: 61 (nucleotide); SEQ ID NO: 62 (amino acid)).In some embodiments, wild type Cas9 corresponds to. or comprises SEQ ID NO: 63 (nucleotide) and / or SEQ ID NO: 64 (amino acid):In some embodiments, dCas9 corresponds to, or comprises in part or in whole, a Cas9 amino acid sequence having one or more mutations that inactivate the Cas9 nuclease activity.For example, in some embodiments, a dCas9 domain comprises D10A and / or H820A mutation. dCas9 (D10A and H840A):

[0083] In other embodiments, dCas9 variants having mutations other than D10A and H820A are provided, which e.g.. result in nuclease inactivated Cas9 (dCas9). Such mutations, by way of example, include other amino acid substitutions at DIO and H820, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and / or the RuvCl subdomain). In some embodiments, variants or homologues of dCas9 (e. , variants ofSEQ ID NO: 65) are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to SEQ ID NO: 65. In some embodiments, variants of dCas9 (e.g., variants of SEQ ID NO: 65) are provided having amino acid sequences which are shorter, or longer than SEQ ID NO: 65, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.

[0084] In some embodiments, Cas9 fusion proteins as provided herein comprise the full- length amino acid of a Cas9 protein, e.g., one of the sequences provided above. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Cas9 sequence, but only a fragment thereof. For example, in some embodiments, a Cas9 fusion protein provided herein comprises a Cas9 fragment, wherein the fragment binds crRNA and tracrRNA or sgRNA, but does not comprise a functional nuclease domain, e.g, in that it comprises only a truncated version of a nuclease domain or no nuclease domain at all. Exemplary amino acid sequences of suitable Cas9 domains and Cas9 fragments are provided herein, and additional suitable sequences of Cas9 domains and fragments will be apparent to those of skill in the art. In some of these embodiments, the fusion protein comprises a transcriptional activator (e.g., VP64), a transcriptional repressor (e.g., KRAB, SID), a nuclease domain (e.g., FokI). base editors, prime editors, a recombinase domain (e.g, Hin, Gin, or Tn3), a deaminase (e g., a cytidine deaminase or an adenosine deaminase) or an epigenetic modifier domain (e.g. , TET1, p300).

[0085] In some embodiments, Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC 015683.1, NC 017317.1): Corynebacterium diphtheria (NCBI Refs: NC 016782.1. NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma tarwanense (NCBI Ref: NC_021846. 1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquisl (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820832.1); Listeria innocua (NCBI Ref: NP 472073.1); Campylobacter jejuni (NCBI Ref: YP_002344900.1); or Neisseria meningitidis (NCBI Ref: YP_002342100. 1).

[0086] The term "deaminase" refers to an enz me that catalyzes a deamination reaction. In some embodiments, the deaminase is a cytidine deaminase, catalyzing the hydrolytic deamination of cytidine or deoxycytidine to uracil or deoxyuracil, respectively.

[0087] The terms "RNA-programmable nuclease" and "RNA-guided nuclease" are used interchangeably herein and refer to a nuclease that forms a complex with (e.g., binds or associates with) one or more RNA molecules that are not a target for cleavage. In some embodiments, an RNA-programmable nuclease, when in a complex with an RNA, may be referred to as a nuclease:RNA complex. RNA-programmable nucleases include Cas9 nucleases. Typically, the bound RNA(s) is referred to as a guide RNA (gRNA). gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule. gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), though "gRNA" is used interchangeably to refer to guide RNAs that exist as either single molecules or as two or more molecules. Typically, gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g. , directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein. The gRNA comprises a nucleotide sequence that complements a target site, which mediates binding of the nuclease / RNA complex to said target site and provides the sequence specificity of the nuclease:RNA complex.

[0088] The term "recombinase," as used herein, refers to a site-specific enzyme that mediates the recombination of DNA between recombinase recognition sequences, which results in the excision, integration, inversion, or exchange (e.g., translocation) of DNA fragments between the recombinase recognition sequences. Recombinases can be classified into two distinct families: serine recombinases (e.g., resolvases and invertases) and tyrosine recombinases (e.g, integrases). Examples of serine recombinases include, without limitation, Hin, Gin, Tn3, P-six, CinH, ParA, y6, Bxbl, <pC31, TP901, TGI, rpBTl, R4, cpRVl, cpFCl, MR11, A118, U153, and gp29. Examples of tyrosine recombinases include, without limitation, Cre, FLP, R, Lambda, HK101, HK.022, and pSAM2. The serine and tyrosine recombinase names stem from the conserved nucleophilic amino acid residue that the recombinase uses to attack the DNA and which becomes covalently linked to the DNA during strand exchange. Recombinases have numerous applications, including the creation of gene knockouts / knock-ins and gene therapy applications. (See, e.g. Brown et al., “Serine recombinases as tools for genome engineering.” Methods, 53(4):372-379 (2011); Hirano etal., '‘Site-specific recombinases as tools for heterologous gene integration, ” Appl. Microbiol. Biotechnol., 92(2):227-239 (2011); Chavez and Calos, “Therapeutic applications of the <>C31 integrase system." Curr. Gene Then, 11 (5):375-381 (2011); Turan and Bode, “Site-specific recombinases: from tag-and-target- to tag-and-exchange- based genomic modifications f FASEB J.. 25(12):4088-4107 (2011); Venken and Bellen, “Genome-wide manipulations of Drosophila melanogaster with transposons, Flp recombinase,and C31 integrase.” Methods Mol. Biol., 859:203-228 (2012); Murphy, " hage recombinases and their applications ” Adv. Virus Res., 83:367-414 (2012); Zhang et al., “Conditional gene manipulation: Cre-ating a new biological era,” J. Zhejiang Univ. Sci. B., 13(7):511-524 (2012); Karpenshif and Bernstein, “From yeast to mammals: recent advances in genetic control of homologous recombination,” DNA Repair (Amst), 1;11(10): 781 -788 (2012); the entire contents of each are hereby incorporated by reference in their entirety). The recombinases provided herein are not meant to be exclusive examples of recombinases that can be used in embodiments of the invention. The methods and compositions of the invention can be expanded by mining databases for new orthogonal recombinases or designing synthetic recombinases with defined DNA specificities. (See, e.g., Groth et al., “Phage integrases: biology and applications ,” J . Mol. Biol., 335, 667-678 (2004); Gordley et al., “Synthesis of programmable integrases,” Proc. Natl. Acad. Sci. USA., 106, 5053-5058 (2009); the entire contents of each are hereby incorporated by reference in their entirety). Other examples of recombinases that are useful in the methods and compositions described herein are known to those of skill in the art. and any new recombinase that is discovered or generated is expected to be able to be used in the different embodiments of the invention. In some embodiments, a recombinase (or catalytic domain thereof) is fused to a Cas9 protein (e.g., dCas9).

[0089] The terms ‘“recombine” and ‘“recombination,” in the context of a nucleic acid modification (e.g., a genomic modification), are used to refer to the process by which two or more nucleic acid molecules, or two or more regions of a single nucleic acid molecule, are modified by the action of a recombinase protein. Recombination can result in, inter aha, the insertion, inversion, excision, or translocation of a nucleic acid sequence, e.g., in or between one or more nucleic acid molecules.

[0090] As used herein, the terms “approximately,” or “‘about,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range of values that fall within 10%, 9%, 8%, 7%, 6%, 5%, 4%. 3%, 2%, 1%. or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (for example, when such number would exceed 100% of a possible value).General Description of the Invention

[0091] ARMMs related compositions and methods for producing and using said particles are known in the art, and are described in, but not limited to, U.S. Pat. Nos. 9,737,480; 9,816,080;10,260.055; PCT Application Publication WO2018 / 067546; and U.S. Pat. Pub. Nos.202201 19785; 20220170013; 20220220462; and 20220282275; the entire contents of each of which are hereby incorporated by reference in their entirety.General Pharmaceutical Formulations and Compositions

[0092] Additional aspects of the present disclosure relate to pharmaceutical compositions comprising any of the ARMMs or microvesicle (e.g., ARMM) producing cells provided herein. The term “pharmaceutical composition,” as used herein, refers to a composition formulated for pharmaceutical use. In some embodiments, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier. In some embodiments, the pharmaceutical composition comprises additional agents (e.g, for specific delivery, increasing half-life, potency, efficacy, biological effect, and the like, as well as other therapeutic agents and compounds).

[0093] As used here, the term “pharmaceutically-acceptable carrier” means a pharmaceutically-acceptable material, composition, or vehicle, such as a liquid or solid filler, diluent, excipient, manufacturing aid (e.g, lubricant, talc magnesium, calcium or zinc stearate, or steric acid), or solvent encapsulating material, involved in carrying or transporting the compound from one site (e.g , the delivery site) of the body, to another site (e.g, organ, tissue, system, or portion of the body). A pharmaceutically acceptable carrier is “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the cell and tissue of the subject (e.g, physiologically compatible, sterile, physiologic pH, etc.). Some examples of materials which can serve as pharmaceutically-acceptable carriers include, but are not limited to: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as com starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository' waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil. sesame oil. olive oil. com oil and soybean oil; (10) glycols, such as propylene glycol; (1 1) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer’s solution; (19) ethyl alcohol; (20) pH buffered solutions; (21) polyesters, polycarbonates and / or polyanhydrides; (22) bulking agents, such as polypeptides and amino acids (23) serum component, such as serum albumin, HDL andLDL; (22) C2-C12 alcohols, such as ethanol; and (24) other non-toxic compatible substances employed in pharmaceutical formulations. Wetting agents, coloring agents, release agents, coating agents, sweetening agents, flavoring agents, perfuming agents, preservatives, antioxidants, and the like, can also optionally be present in a formulation. Terms such as “excipient,” “carrier,” “pharmaceutically acceptable carrier.” and the like, are used interchangeably herein.

[0094] In some embodiments, the pharmaceutical composition is formulated for delivery to a subject, e.g., for delivering a therapeutic agent, payload protein, or payload nucleic acid to a cell. Suitable routes of administrating of the pharmaceutical compositions described herein include, without limitation: subretinal, suprachoroidal, intrvitereal, topical, subcutaneous, transdermal, intradermal, intralesional, intraarticular, intraperitoneal, intravesical, transmucosal, gingival, intradental, intracochlear, transtympanic, intraorgan, epidural, intramuscular, intravenous, intravascular, intraosseus, periocular, intratumoral, intrathecal, intracerebral, intra-cistema magna, and intracerebroventricular administration. (See. e.g, Hartman, R.R., and Kompella, U.B., “Intravitreal, Subretinal, and Suprachoroidal Injections: Evolution of Microneedles for Drug Delivery f J. Ocul. Pharmacol. Then, 34(1-2): 141-153 (2018)).

[0095] In some embodiments, a pharmaceutical composition described herein is administered locally to a diseased site. In some embodiments, the pharmaceutical compositions described herein are administered to a subject by injection, by means of a catheter, by means of a suppository', or by means of an implant, the implant being of a porous, non-porous, or gelatinous material, including a membrane, such as a sialastic membrane, or a fiber.

[0096] In some embodiments, the compositions are formulated in accordance with routine procedures and is a composition adapted for injection, intravenous, or subcutaneous administration to a subject, e.g., a human. In some embodiments, the compositions for administration by injection comprise a solution in a sterile isotonic aqueous buffer. Where necessary, the formulations can also include a solubilizing agent and a local anesthetic such as lidocaine to ease pain at the site of the injection. Where the formulations are administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients can be mixed prior to administration. Where the formulations are to be administered by infusion, they can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.

[0097] A formulation (a pharmaceutical composition) for systemic administration may be a liquid, e.g., sterile saline, lactated Ringer’s solution, or Hank’s solution. In addition, thepharmaceutical composition can be in solid forms and re-dissolved or suspended immediately prior to use. Lyophilized forms of certain formulations are also contemplated.

[0098] The compositions described herein may be administered or packaged as a unit dose. The term “unit dose’' when used in reference to a pharmaceutical composition of the present disclosure refers to physically discrete units suitable as unitary dosage for the subject, each unit containing a predetermined quantity of active material calculated to produce the desired therapeutic effect in association with the required diluent, i.e., carrier, or vehicle.

[0099] Further, the compositions can be provided as kits comprising: 1) a container containing an ARMM or microvesicle producing cell of the invention; and 2) a second container containing a pharmaceutically acceptable diluent (e.g., sterile water) for injection. The pharmaceutically acceptable diluent can be used, e.g., for reconstitution or dilution of the ARMM or microvesicle producing cell of the invention. Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use, or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use, or sale for human administration. In this regard, state-specific and regional regulatory agencies are understood to include, but are not limited to, the U.S. Food and Drug Administration, the U.S. Department of Agriculture, the European Medicines Agency, the United Kingdom Medicines and Healthcare Products Regulatory Agency, the National Medical Products Administration, and the like.

[0100] In another aspect, an article of manufacture containing materials useful for treating the diseases described herein is included. In some embodiments, the article of manufacture comprises a container and a label. Suitable containers include, for example, bottles, vials, syringes, and test tubes. The containers may be formed from various materials such as glass or plastic. Suitable containers are further understood to include materials that are sufficiently non- reactive and protective of the contents therein. In some embodiments, the container holds a composition that is effective for treating a disease described herein and may have a sterile access port. For example, the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle. The active agent in the composition is a compound of the invention. In some embodiments, the label on or associated with the container indicates that the composition is used for treating one or more diseases of choice. The article of manufacture may further comprise a second container comprising a pharmaceutically acceptable buffer, such as phosphate-buffered saline, Ringer's solution, or dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers,diluents, filters, needles, syringes, and package inserts with instructions and indications for acceptable, recognized, or permitted use(s).

[0101] In some embodiments, treatments are contemplated wherein one therapeutic agent is administered using ARMM-mediated delivery of an agent to target cells, tissues, systems, or mammalian subjects.

[0102] In some other embodiments, treatments are contemplated wherein two therapeutic agents are administered using ARMM-mediated delivery of the respective agents to target cells, tissues, systems, or mammalian subjects.

[0103] In still some other embodiments, treatments are contemplated wherein three or more therapeutic agents are administered using ARMM-mediated delivery of the respective agents to target cells, tissues, systems, or mammalian subjects.

[0104] It is contemplated that within the compositions and methods described herein, when two or more respective therapeutic agents are administered (e.g., co-administered) to a target, cell, tissue, system, or subject that the respective (i.e., two or more) agents are provided in a single ARRDC 1 -mediated microvesicle (ARMM) particle for administration.

[0105] It is likew ise further contemplated that within the compositions and methods described herein, when two or more respective therapeutic agents are administered (e.g, concomitantly administered) to a target cell, tissue, system, or subject that the respective (i.e., two or more) agents are provided respectively in different ARRDC1 -mediated microvesicles (ARMMs) particles for administration.Kits, Vectors, and Cells

[0106] Some aspects of this disclosure provide kits comprising a nucleic acid construct comprising a nucleotide sequence encoding one or more of any of the proteins (e.g. ARRDC1, and TSG101), fusion proteins and / or nucleic acids provided herein. In some embodiments, the nucleotide sequence encodes any of the proteins, fusion proteins, and / or RNAs provided herein. In some embodiments, the nucleotide sequence comprises a heterologous promoter that drives the expression of any of the proteins, fusion proteins, and / or RNAs provided herein.

[0107] Some aspects of this disclosure provide microvesicle (e.g., ARMM) producing cells comprising any of the proteins, fusion proteins, and nucleic acids (e g, RNAs) provided herein. In some embodiments, the cells specifically comprise a nucleotide that encodes any of the proteins, fusion proteins, and / or RNAs provided herein. In some embodiments, the cells comprise any of the nucleotides or vectors provided herein. In some embodiments, the vectorcomprises one or more cell targeting or cell entry proteins (e.g.. viral and / or human fusogen(s)).

[0108] It should be appreciated, however, that additional proteins, fusion proteins, and RNAs would be apparent to the skilled artisan based on the present disclosure and knowledge in the art.

[0109] The function and advantage of these and other embodiments of the present invention will be more fully understood from the Examples below. The following Examples are intended to illustrate the benefits of the present invention and to describe particular embodiments but are not intended to exemplify the full scope of the invention.

[0110] Accordingly, it will be understood that the Examples are not meant to limit the scope of the invention.Detailed Description of Certain Embodiments of the Invention

[0111] The present invention provides methods, systems, and compositions for ARRDC1- mediated microvesicles (“ARMMs”) delivery of molecules of interest (e.g., therapeutic agents) to cells and tissues. The present invention further relates to compositions and methods of producing, testing, and administering ARMMs. More particularly, the present invention provides compositions and methods of producing, testing, and administering ARMMs comprising one or more therapeutic agents (e.g., biological molecules including, but not limited to, CRISPR / Cas9, and other similar endonucleases, base editors, small molecules, proteins, and nucleic acids (e.g., DNA, RNA, siRNA, mRNA, miRNA, and the like)). Also provided are methods of administering therapeutic agents associated with ARMMs, including, but not limited to, methods of treating or contacting cells and tissues in one or more exemplary7dosing regimens (e.g., 1) in vivo administration of ARMMs to a patient; 2) ex vivo administration of ARMMs to target cells and implantation of the ARMMs treated cells to a / the patient; and 3) m vivo and ex vivo regimens). Additionally, the present invention relates to methods of manufacturing (e.g., culturing, clarifying, separating, and concentrating) the inventive compositions obtained from stable producer cell lines and / or from transient cell cultures.ARMMs

[0112] Arrestin Domain Containing Protein 1 mediated microvesicles (“ARMMs”) are extracellular vesicles (“EVs”) that are distinct from exosomes. The budding of ARMMs requires ARRDC1, which is localized to the cytosolic side of the plasma membrane and, through a tetrapeptide motif, recruits the ESCRT-I complex protein TSG101 to the cell surface to initiate the outward membrane budding. Thus, in contrast to exosomes, the biogenesis of ARMMsoccurs at the plasma membrane. ARMMs exhibit several additional features that make them potentially ideal vehicles for therapeutic delivery. ARRDC1 is not only necessary but also sufficient to drive ARMMs budding. Overexpression of the ARRDC1 protein increases the production of ARMMs in cells. This allows controlled production of ARMMs using modem biological manufacturing methods. Moreover, endogenous proteins such as cell surface receptors are actively recruited into ARMMs and can be delivered into recipient cells to initiate intercellular communication, suggesting that the exogenous payload molecules may be similarly packaged and delivered via ARMMs.

[0113] In some cases, the ARMM further comprises a targeting moiety, e.g., that targets particular cell type(s), e.g., as described herein.ARRDC1

[0114] In preferred embodiments, ARRDC1 is a protein that comprises a PSAP (SEQ ID NO: 1) motif and a PPXY (SEQ ID NO: 2) motif in its C-terminus, and interacts with TSG101 as shown herein. It should be appreciated that the PSAP (SEQ ID NO: 1) motif and the PPXY (SEQ ID NO: 2) motif are not required to be at the absolute C-terminal end of the ARRDC1. Rather, they may be at a C-tenninal portion of the ARRDC1 protein (e.g., the C-terminal half of the ARRDC1). The disclosure also contemplates variants of ARRDC1, such as fragments of ARRDC1 and / or ARRDC1 proteins that have a degree of identity e.g., 60%, 70%, 80%, 85%, 90%, 95%, 98%, or 99% identity) to an ARRDC1 protein and are capable if interacting with TSG101. Accordingly, an ARRDC1 protein may be a protein that comprises a PSAP (SEQ ID NO: 1) motif and a PPXY (SEQ ID NO: 2) motif and interacts with TSG101. In some embodiments, the ARRDC 1 protein is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the amino acid sequence of any one of SEQ ID NOs: 42-44, comprises a PSAP (SEQ ID NO: 1) motif and a PPXY (SEQ ID NO: 2) motif, and interacts with TSG101. In some embodiments, the ARRDC1 protein has at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80. at least 90. at least 100, at least 110. at least 120, at least 130, at least 140, at least 150, at least 160, at least 170, at least 180, at least 190, at least 200, at least 210, at least 220, at least 230, at least 240, at least 250, at least 260, at least 270, at least 280, at least 290, at least 300, at least 310, at least 320, at least 330, at least 340, at least 350, at least 360, at least 370, at least 380, at least 390, at least 400, at least 410, at least 420. or at least 430 identical contiguous amino acids of any one of SEQ ID NOs: 42-44, comprises a PSAP (SEQ ID NO: 1) motif and a PPXY (SEQ ID NO: 2) motif, and interacts with TSG101. Insome embodiments, the ARRDC1 protein has 1. 2, 3, 4. 5, 6, 7, 8. 9, 10, 11, 12, 13. 14. 15. 16. 17, 18, 19, 20, 21 , 22, 21 , 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50 or more mutations compared to any one of the amino acid sequences set forth in SEQ ID NOs: 42-44 comprises a PSAP (SEQ ID NO: 1) motif and a PPXY (SEQ ID NO: 2) motif, and interacts with TSG101. In some embodiments, the ARRDC1 protein comprises any one of the amino acid sequences set forth in SEQ ID NOs: 42-44. Exemplary, non-limiting ARRDC1 protein sequences are provided herein, and additional, suitable ARRDC 1 protein variants according to aspects of this invention are know n in the art. It will be appreciated by those of skill in the art that this invention is not limited in this respect. Exemplary ARRDC1 sequences include the following (PSAP (SEQ ID NO: 1) and PPXY (SEQ ID NO: 2) motifs are marked):42 )

[0116] >gi|244798004|ref|NP_001155957. 11 arrestin domain-containing protein 1 isoform a[Mils musculus] LIHIDYYLQVSMKAPEATVTLPLFVGNIAVNQTPLSPCPGRESSPGTLSLW|PSAP|PQEEAEAV

[0117] >gi|244798112|ref]NP_848495.2| arrestin domain-containing protein 1 isoform b [Mits musculus] I L[P PEY|S SWGY PYEAPTSG101

[0118] In certain embodiments, the inventive microvesicles further comprise TSG101 (tumor susceptibility gene 101) TSG101 belongs to a group of putative inactive homologs of ubiquitin- conjugating enzy mes. The protein contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. TSG101 is a protein that comprises a UEV domain and interacts with ARRDC1. As referred to herein, UEV refers to the Ubiquitin E2 variant domain of approximately 145 amino acids. The structure of the domain contains a o / 0 fold similar to the canonical E2 enzy me but has an additional N-terminal helix and further lacks the tw o C-terminal helices. Often found in TSG101 / Vps23 proteins, the UEV interacts with a ubiquitin molecule and is essential for the trafficking of a number of ubiquitylated payloads to multivesicular bodies (MVBs). Furthermore, the UEV domain can bind to Pro-Thr / Ser- Ala-Pro peptide ligands, a fact exploited by viruses such as HIV. Thus, the TSG101 UEV domain binds to the PTAP tetrapeptide motif in the viral Gag protein that is involved in viral budding. The disclosure also contemplates variants of TSG101, such as fragments of TSG101 and / or TSG101 proteins that have a degree of identity (e.g, 60%, 70%, 80%, 85%, 90%, 95%, 98%, or 99% identity) to a TSG101 protein and are capable of interacting with ARRDC1 . Accordingly, a TSG101 protein may be a protein that comprises a UEV domain and interacts with ARRDC1. In some embodiments, the TSG101 protein is at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the amino acid sequence of any one of SEQ ID NOs: 45-47, comprises a UEV domain, and interacts with ARRDC1. In some embodiments, the TSG101 protein has at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, atleast 80, at least 90, at least 100, at least 110, at least 120. at least 130, at least 140. at least 150, at least 160, at least 170, at least 180, at least 190, at least 200, at least 210, at least 220, at least 230, at least 240, at least 250, at least 260, at least 270, at least 280, at least 290, at least 300, at least 310, at least 320, at least 330, at least 340, at least 350, at least 360, at least 370, at least 380, or at least 390, and any integer between the numbers, identical contiguous amino acids of any one of SEQ ID NOs: 45-47, comprises a UEV domain and interacts with ARRDC1. In some embodiments, the TSG101 protein has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more mutations compared to any one of the amino acid sequences set forth in SEQ ID NOs: 45-47 and comprises a UEV domain. In some embodiments, the ARRDC1 protein comprises any one of the amino acid sequences set forth in SEQ ID NOs: 45-47.Exemplary, non-limiting TSG101 protein sequences are provided herein, and additional, suitable TSG101 protein sequences, isoforms, and variants are known in the art. It will be appreciated by those of skill in the art that this invention is not limited in this respect. Exemplary’ TSG101 sequences include the following sequences (the UEV domain in these sequences includes amino acids 1-145 and is underlined in the sequences below):

[0120] >gi| 11230780|ref]NP_068684. 11 tumor susceptibility gene 101 protein [Mus musculus]

[0121] >gi|48374087|ref|NP_853659.2| tumor susceptibility gene 101 protein [Rattus norvegicus]

[0122] The structure of UEV domains is known to those of skill in the art. (See, e.g. , OwenPomillos etal., Structure and functional interactions of the TsglOl UEV domain. EMBO J., 21(10): 2397-2406 (2002), the entire contents of which are incorporated herein by reference).RNA-Guided Proteins

[0123] In some cases, the ARMMs described herein comprise an RNA-guided protein. RNA-guided proteins such as Cas (e.g., Cas9) proteins, base editors, prime editors, and the like are described in the art.

[0124] In some cases, the RNA-guided protein is a base editor (e.g., a protein comprising a fusion protein comprising a programmable DNA binding domain such as a Cas domain and a deaminase domain). In some cases, the deaminase is a cytodine deaminase and / or an adenosine deaminase. In some embodiments, the adenosine deaminase is TadA or a TadA variant. In some embodiments, the TadA is a TadA*8 or TadA*9. In some cases, the cytodine deaminase is APOBEC or an APOBEC variant. In some cases, the base editor is a cytosine base editor. In some cases, the base editor is an adenine base editor.

[0125] In some cases, the base editor is a base editor described in any one of

[0126] In some cases, the ARMMs described herein comprise a nucleic acid encoding an RNA-guided protein. In some cases, the nucleic acid is DNA and encodes an mRNA which, in turn, encodes the RNA-guided protein. In some cases, the nucleic acid is an mRNA which encodes the RNA-guided protein. gRNAs

[0127] In some cases, the ARMMs comprise one or more gRNAs. gRNAs are described in the art. In some cases, the gRNA(s) are a single guide RNA (sgRNA). In some cases, the gRNA(s) are crisprRNA + tracrRNA. In some cases, the gRNA(s) are a combination of sgRNA(s) and crisprRNA + tracrRNA(s).Expression Constructs

[0128] Some aspects of this invention provide expression constructs for encoding a gene product or gene products that induce or facilitate the generation of ARMMs in cells harboring such a construct. In some embodiments, the expression constructs described herein encode a fusion protein as described herein, such as ARRDC1 fusion proteins and TSG101 fusion proteins. In some embodiments, the expression constructs encode an ARRDC1 protein, or variant thereof, and / or a TSG101 protein, or variant thereof. In some embodiments, overexpression of either or both gene products in a cell increases the production of ARMMs in the cell, thus turning the cell into a microvesicle producing cell. In some embodiments, such an expression construct comprises at least one restriction or recombination site that allows in-frame cloning of a protein sequence to be fused, either at the C-terminus, or at the N-terminus of the encoded ARRDC1, or variant thereof. As another example, an expression construct comprises at least one restriction or recombination site that allows in-frame cloning of a protein sequence to be fused either at the C-terminus or at the N-terminus of one or more encoded WW domains.

[0129] In some embodiments, the expression construct comprises (a) a nucleotide sequence encoding an ARRDC 1 protein, or variant thereof, operably linked to a heterologous promoter,and (b) a restriction site or a recombination site positioned adjacent to the ARRDC1 -encoding nucleotide sequence allowing for the insertion of a nucleotide sequencing encoding a payload protein, or an RNA binding protein or RNA binding protein variant sequence, in frame with the ARRDC1 -encoding nucleotide sequence. In some embodiments, the heterologous promoter may be a constitutive promoter, in some embodiments, the heterologous promoter may be an inducible promoter. Some aspects of this invention provide an expression construct comprising (a) a nucleotide sequence encoding a TSG101 protein, or variant thereof, operably linked to a heterologous promoter, and (b) a restriction site or a recombination site positioned adjacent to the TSG101 -encoding nucleotide sequence allowing for the insertion of anucleotide sequencing encoding a payload protein, or an RNA binding protein, DNA binding protein, or variant sequence thereof, in frame with the TSG101 -encoding nucleotide sequence. In some embodiments, the heterologous promoter may be a constitutive promoter, in some embodiments, the heterologous promoter may be an inducible promoter.

[0130] Some aspects of this invention provide an expression construct comprising (a) a nucleotide sequence encoding a WW domain, or variant thereof, operably linked to a heterologous promoter, and (b) a restriction site or a recombination site positioned adjacent to the WW domain-encoding nucleotide sequence allowing for the insertion of a payload protein or RNA binding protein, or a protein variant sequence thereof in frame with the WW domainencoding nucleotide sequence. In some embodiments, the heterologous promoter may be a constitutive promoter, in some embodiments, the heterologous promoter may be an inducible promoter. The expression constructs may encode a payload protein, or an RNA binding protein fused to at least one WW domain. In some embodiments, the expression constructs encode a payload protein or an RNA binding protein, or variant thereof, fused to at least one WW domain, or variant thereof. Any of the expression constructs, described herein, may encode any WW domain or variant thereof. In some embodiments, the heterologous promoter may be a constitutive promoter, in some embodiments, the heterologous promoter may be an inducible promoter.

[0131] The expression constructs, described herein, may comprise any nucleic acid sequence capable of encoding a WW domain or variant thereof. For example, a nucleic acid sequence encoding a WW domain or WW domain variant may be from the human ubiquitin ligase WWP1, WWP2, Nedd4-1, Nedd4-2, Smurfl. Smurf2, ITCH, NEDL1, or NEDL2. Exemplary nucleic acid sequences of WW domain containing proteins are listed below. It should be appreciated thatany of the nucleic acids encoding WW domains or WW domain variants of the exemplary proteins may be used in the invention, described herein, and are not meant to be limiting.

[0132] Human WWP1 nucleic acid sequence (uniprot.org / uniprot / Q9H0M0).

[0135] Human Nedd4-2 nucleic acid sequence (>gi|345478679|ref|NM_015277.51 Homo sapiens neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase (NEDD4L), transcript variant d, mRNA).

[0141] Some aspects of this invention provide expression constructs that encode any of the proteins, nucleic acids, such as RNAs, or fusions thereof described herein.

[0142] Nucleic acids encoding any of the proteins and / or nucleic acid (including RNA) described herein, may be in any number of nucleic acid vectors known in the art. Vectors suitable for use in the compositions and methods of the present invention include both viral and nonviral products and additional means for introducing nucleic acid(s) into cells.

[0143] Expression of any of the proteins and / or nucleic acid (including RNA) described herein, may be controlled by any regulatory sequence (e.g., a promoter sequence) known in the art. Regulatory sequences, as described herein, are nucleic acid sequences that regulate the expression of a nucleic acid sequence. A regulatory or control sequence may include sequences that are responsible for expressing a particular nucleic acid or may include other sequences, such as heterologous, synthetic, or partially synthetic sequences. The sequences can be of eukary otic, prokaryotic, or viral origin that stimulate or repress transcription of a gene in a specific or nonspecific manner and in an inducible or non-inducible manner. Regulatory or control regions may include origins of replication, RNA splice sites, introns, chimeric or hybrid introns, promoters, enhancers, transcriptional termination sequences, poly A sites, locus control regions, signal sequences that direct the polypeptide into the secretory pathways of the target cell. A heterologous regulatory region is a regulatory region not naturally associated with the expressed nucleic acid it is linked to. Included among the heterologous regulatory regions are regulatory regions from a different species, regulatory' regions from a different gene, hybrid regulatory' sequences, and regulatory sequences that do not occur in nature, but which are designed by one of ordinary skill in the art.Exemplary Cells Producing ARMMs Containing Payload

[0144] A microvesicle-producing cell of the present invention may be a cell containing any of the expression constructs, any of the fusion proteins, or any of the pay loads of molecules (e.g, biological molecules, small molecules, proteins, and nucleic acids described herein. For example, an inventive microvesicle-producing cell may contain one or more recombinant expression constructs encoding (1) an ARRDC1 protein, or PSAP (SEQ ID NO: 1) motifcontaining variant thereof and (2) an RNA binding protein (e.g., a Tat protein), that is associated with the ARRDC1 protein, or PSAP (SEQ ID NO: 1) motif-containing variant thereof. In some embodiments, a microvesicle-producing cell may contain one or more recombinant expression constructs encoding (1) an ARRDC1 protein, or PSAP (SEQ ID NO: 1) motif-containing variant thereof, and (2) a payload protein, such as an RNA binding protein fused to at least one WW domain, or variant thereof, under the control of a heterologous promoter. In certain embodiments, the expression construct in the microvesicle producing cell encodes a payload protein with one or more WW domains or variants thereof. In certain embodiments, an expression construct in the microvesicle producing cell encodes an RNA that associates with (e.g., binds specifically) an RNA binding protein, for example a therapeutic RNA.

[0145] Any of the expression constructs, described herein, may be stably inserted into the genome of the cell. In some embodiments, the expression construct is maintained in the cell, but not inserted into the genome of the cell. In some embodiments, the expression construct is in a vector, for example, a plasmid vector, a cosmid vector, a viral vector, or an artificial chromosome. In some embodiments, the expression construct further comprises additional sequences or elements that facilitate the maintenance and / or the replication of the expression construct in the microvesicle-producing cell, or that improve the expression of the fusion protein in the cell. Such additional sequences or elements may include, for example, an origin of replication, an antibiotic resistance cassette, a polyA sequence, and / or a transcriptional isolator. Some expression constructs suitable for the generation of microvesicle producing cells according to aspects of this invention are described elsewhere herein. Methods and reagents for the generation of additional expression constructs suitable for the generation of microvesicle producing cells according to aspects of this invention will be apparent to those of skill in the art based on the present disclosure. In some embodiments, the microvesicle producing cell is a mammalian cell, for example, a mouse cell, a rat cell, a hamster cell, a rodent cell, or a nonhuman primate cell. In some embodiments, the microvesicle producing cell is a human cell.

[0146] One skilled in the art may employ conventional techniques, such as molecular or cell biology, virology, microbiology, and recombinant DNA techniques. Exemplary7techniques are explained fully in the literature. For example, one may rely on the following general texts to make and use the invention: Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition (1989) Cold Spring Flarbor Laboratory7Press, Cold Spring Harbor, New York, and Sambrook etai.. Third Edition (2001); DNA Cloning: A Practical Approach, Volumes I and II (D.N. Glover ed. 1985); Oligonucleotide Synthesis (M.J. Gaited. 1984); Nucleic Acid Hybridization (B.D. Hames & S.J. Higgins eds. (1985)); Transcription and Translation Hames & Higgins, eds. (1984); Animal Cell Culture (RI. Freshney, ed. (1986)); Immobilized Cells And Enzymes (1RL Press, (1986)); Gennaro et al., (eds.) Remington's Pharmaceutical Sciences, 18th edition; B. Perbal, A Practical Guide To Molecular Cloning (1984); F.M. Ausubel et al., (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (updates through 2001), Coligan et al., (eds ), Current Protocols in Immunology, John Wiley & Sons, Inc.(updates through 2001); W. Paul et al., (eds.) Fundamental Immunology. Raven Press: E.J. Murray et al., (ed.) Methods in Molecular Biology: Gene Transfer and Expression Protocols, The Humana Press Inc. (1991)(especially vol.7); and J.E. Celis et al., Cell Biology: A Laboratory Handbook, Academic Press (1994).Delivery of ARMMs Containing Payload Molecules

[0147] The inventive microvesicles (e.g., ARMMs containing any of the expression constructs and / or any of the payload of molecules (e.g., therapeutic agents, biological molecules, small molecules, proteins, and nucleic acids (e.g., DNA, RNA), DNA plasmids, siRNA, shRNA. mRNA)), may optionally further comprise a targeting moiety. The targeting moiety may be used to target the delivery of ARMMs to specific cell types, resulting in the release of the contents of the ARMM into the cy toplasm of the specific targeted cell type. A targeting moiety may be a viral envelope protein, or portion thereof, that normally functions to aid viral attachment and entry into cells. The viral envelope protein may allow for the targeting of cells of the CNS. Viral envelope proteins include, but are not limited to, vesicular stomatitis virus G protein (VSV-G; Genbank Accession and Version Number: AJ318514.1) or rabies virus glycoprotein (RVG; Genbank Accession and Version Number: M38452. 1). VSV-G protein, facilitates viral entry by mediating viral attachment to an LDL receptor (LDLR) or an LDLR family member present on a target cell. Subsequent to binding, the VSV-G-LDLR complex is rapidly endocytosed and proceeds to mediate the fusion of the viral envelope with the endosomal membrane. VSV-Genters the cell through partially clathrin-coated vesicles; virus-containing vesicles contain more clathrin and clathrin adaptor than conventional vesicles. VSV-G is a common coat protein for vector expression systems used to introduce genetic material into in vitro systems or animal models, mainly because of its extremely broad tropism. RVG is a trimeric and surface-exposed viral coat protein known to use the nicotinic acetylcholine receptor and the low affinity nerve growth factor receptor for viral entry. In some embodiments, a viral envelope protein (e.g., VSV- G, RVG) facilitates binding (e.g., targeting) of the ARMMs to targeted cells.

[0148] In some embodiments, producer cells (e.g., Expi293 cells) are optionally transfected with VSV-G expression constructs from about 0.5-25% of the total plasmid per transfection. In some additional embodiments, producer cells are optionally transfected with VSV-G expression constructs from about 10-25% of the total plasmid per transfection.

[0149] A targeting moiety may selectively bind a surface antigen of the target cell. For example, the targeting moiety' may be a membrane-bound immunoglobulin, an integrin, a receptor, a receptor ligand, an aptamer, a small molecule, or a variant thereof. Any number of cell surface proteins may also be included in an ARMM to facilitate the binding of an ARMM to a target cell and / or to facilitate the uptake of an ARMM into a target cell. Integrins, receptor tyrosine kinases, G-protein coupled receptors, and membrane-bound immunoglobulins suitable for use with embodiments of this invention will be apparent to those of skill in the art and the invention is not limited in this respect. For example, in some embodiments, the integrin is an al (31 , a2|Bl, a4pi, a5pi, a6pi, aLp2, aMp2, allb|33, aVp3, aVp5, aVp6, or a a6p4 integrin. In some embodiments, the receptor tyrosine kinase is a an EGF receptor (ErbB family), insulin receptor, PDGF receptor. FGF receptor, VEGF receptor, HGF receptor, Trk receptor. Eph receptor, AXL receptor, LTK receptor, TIE receptor, ROR receptor, DDR receptor, RET receptor, KLG receptor, RYK receptor, or MuSK receptor. In some embodiments, the G-protein coupled receptor is a rhodopsin-like receptor, the secretin receptor, metabotropic glutamate / pheromone receptor, cyclic AMP receptor, frizzled / smoothened receptor, CXCR4, CCR5, or beta-adrenergic receptor.

[0150] Additional molecules, such as synthetic small molecules or natural products, can be modified to associate with an ARMM protein (e.g., TSG101 or ARRDC1) for the purpose of targeting. This association can facilitate their incorporation with ARMMs, which in turn can be used to augment delivery of ARMMs to target cells. The incorporation of a cleavable linker may be used to allow the small molecule to be released upon delivery in or to a target cell. As a nonlimiting example, a small molecule can be linked to biotin, thereby allowing it to associate withan ARRDC1 protein which is fused to a streptavidin. As another non-limiting example, a small molecule can be linked to synthetic high affinity ligand that specifically binds to a mutant form of FKBP12 such as FKBP12(F36V) (Yang, W., el al., “Investigating protein-ligand interactions with a mutant FKBP possessing a designed specificity pocket" J. Med. Chem., 43(6): 1135-1142 (2000)), which will associate with an ARRDC1 protein which is fused to FKBP12(F36V). The association of the small molecule to an ARMM protein e.g., TSG101 or ARRDC1), facilitates the loading of the small molecule into the ARRDC 1 -containing ARMM.

[0151] Some aspects of this invention relate to the recognition that ARMMs are taken up by target cells and ARMM uptake results in the release of the contents of the ARMM into the cytoplasm of the target cells. In some embodiments, the payload is an agent that affects a desired change in the target cell, for example, a change in cell survival, proliferation rate, a change in differentiation stage, a change in cell identity, a change in chromatin state, a change in the transcription rate of one or more genes, a change in the transcriptional profile, or a post- transcriptional change in gene compression of the target cell, and the like. It will be understood by those of skill in the art, that the agent to be delivered will be chosen according to the desired effect in the target cell (e.g., a base editor).

[0152] In some embodiments, cells from a subject are obtained and a payload is delivered to the cells by a system or method provided herein ex vivo. In some embodiments, the treated cells are selected for those cells in which a desired gene is expressed or repressed. In some embodiments, treated cells carrying a desired payload are returned to the subject they were obtained from.

[0153] In some embodiments, the ARMMs further comprise a detectable label. In certain embodiments, detectably labeled ARMMs allow for the labeling of target cells without genetic manipulation. Detectable labels suitable for direct delivery to target cells are known in the art, and include, but are not limited to, fluorescent proteins, fluorescent dyes, membrane-bound dyes, and enzymes, for example, membrane-bound or cytosolic enzy mes, catalyzing the reaction resulting in a detectable reaction product. Detectable labels suitable according to some aspects of this invention further include membrane-bound antigens, for example, membrane-bound ligands that can be detected with commonly available antibodies or antigen binding agents. Detectably labeled ARRMs find use in various diagnostic and analytical methods and applications.

[0154] In some embodiments, ARMMs are provided that comprise a payload RNA that encodes a transcription factor, a transcriptional repressor, a fluorescent protein, a kinase, a phosphatase, a protease, a ligase, a chromatin modulator, a recombinase, and the like. In someembodiments, ARMMs are provided that comprise a payload RNA that inhibits the expression of a transcription factor, a transcriptional repressor, a fluorescent protein, a kinase, a phosphatase, a protease, a ligase, a chromatin modulator, or a recombinase. In some embodiments, the payload RNA is a therapeutic RNA. In some embodiments, the payload RNA is an RNA that affects a change in the state or identity’ of a target cell. For example, in some embodiments, the payload RNA encodes a reprogramming factor. Suitable transcription factors, transcriptional repressors, fluorescent proteins, kinases, phosphatases, proteases, ligases, chromatin modulators, recombinases, and reprogramming factors may be encoded by a payload RNA that is associated with a binding RNA to facilitate their incorporation into ARMMs and their function may be tested by any methods that are known to those skilled in the art, and the invention is not limited in this respect.

[0155] Methods for isolating the ARMMs described herein are also provided. One exemplary method includes employing conventional techniques of collecting culture medium, or supernatant, from a cell culture comprising microvesicle-producing cells. In some embodiments, the cell culture comprises cells obtained from a subject, for example, cells suspected to exhibit a pathological phenotype, for example, a hyperproliferative phenotype. In some embodiments, the cell culture comprises genetically engineered cells producing ARMMs, for example, cells expressing a recombinant protein, for example, a recombinant ARRDC1 or TSG101 protein, such as an ARRDC1 or TSG101 protein, optionally fused to an RNA binding protein (e.g, a Tat protein) or variant thereof. In some embodiments, the supernatant is pre-cleared of cellular debris by centrifugation, for example, by two consecutive centrifugations of increasing G value (e.g., 500G and 2000G). In some embodiments, the method comprises passing the supernatant through a 0.2 pm filter, eliminating all large pieces of cell debris and whole cells. In some embodiments, the supernatant is subjected to ultracentrifugation, for example, at 120,000G for 2 hours, depending on the volume of centrifugate. The pellet obtained comprises microvesicles. In some embodiments, exosomes are depleted from the microvesicle pellet by staining and / or sorting (e.g., by FACS or MACS) using an exosome marker as described herein. Isolated or enriched ARMMs can be suspended in culture media or a suitable buffer, as described herein.Methods of ARMMs -Mediated Delivery of Payload to Cells

[0156] Some aspects of this invention provide a method of delivering an agent (e.g. , a therapeutic agent or agents) to a target cell. The target cell can be contacted with an ARMM in different ways. For example, a target cell may be contacted directly with an ARMM as describedherein, or with an isolated ARMM from a microvesicle producing cell. The contacting can be done in vitro by administering the ARMM to the target cell in a culture dish, or in vivo by administering the ARMM to a subject. In some embodiments, the ARMMs are produced from cells obtained from a subject. In some embodiments, ARMMs that are produced from a cell obtained from a particular subject are administered to the same subject. Conversely, in some other embodiments, ARMMs produced from a cell that was obtained from the subject are administered to a different subject. As one example, a cell may be obtained from a subject and engineered to express one or more of the constructs provided herein (e.g., engineered to express a pay load RNA associated with a binding RNA, an ARRDC1 protein, an ARRDC1 protein fused to an RNA binding protein, an RNA binding protein fused to a WW domain, a Cas9 protein, a base editor, guide and regulator sequences, and the like).

[0157] Alternatively, a target cell can be contacted with a microvesicle producing cell as described herein, for example, contacted in vitro by co-culturing the target cell and the microvesicle producing cell, or contacted in vivo by administering a microvesicle producing cell to a subject harboring the target cell. Accordingly, the method may include contacting the target cell with a microvesicle, for example, an ARMM containing any of the pay loads to be delivered, as described herein. The target cell may be contacted with a microvesicle-producing cell, as described herein, or with an isolated microvesicle that has a lipid bilayer, an ARRDC1 protein or variant thereof, a payload (e.g., therapeutic agent(s)), and optionally a viral envelope protein.

[0158] It should be appreciated that the target cell may be of any origin, for example, from an organism. In some embodiments, the target cell is a mammalian cell. Some non-limiting examples of a mammalian cell include, without limitation, a mouse cell, a rat cell, a hamster cell, a rodent cell, and a nonhuman primate cell. In some embodiments, the target cell is a human cell. It should also be appreciated that the target cell may be of any cell type. In other cases, the target cell may be any differentiated cell type found in a subject. In some embodiments, the target cell is a cell in vitro, and the method includes administering the microvesicle to the cell in vitro, or co-culturing the target cell with the microvesicle-producing cell in vitro. In some embodiments, the target cell is a cell in a subject, and the method comprises administering the microvesicle or the microvesicle-producing cell to the subject. In some embodiments, the subject is a mammalian subject, for example, a rodent, a mouse, a rat, a hamster, or a non-human primate. In some embodiments, the subject is a human subject.

[0159] In some embodiments, the target cell is a pathological cell. In some embodiments, the target cell is a cancer cell. In some embodiments, the microvesicle is associated with a bindingagent that selectively binds an antigen on the surface of the target cell. In some embodiments, the compositions and methods of the present invention comprise one or more targeting ligands that associate (<?.g. , bind) to one or more targeting receptors. In some embodiments, the antigen of the target cell is a cell surface antigen. In some embodiments, the binding agent is a membranebound immunoglobulin, an integrin, a receptor, a receptor ligand, or a lectin, among other suitable candidate molecules and moieties. Suitable surface antigens of target cells are known to those of skill in the art as are suitable binding agents that specifically bind such antigens. Methods for producing membrane-bound binding agents, for example, membrane-bound immunoglobulins, membrane-bound antibodies, or antibody fragments that specifically bind a surface antigen expressed on the surface of cells, are also known to those of skill in the art. The choice of the binding agent will depend, of course, on the identity or the type of target cell. Cell surface antigens specifically expressed on various types of optical tissues and cells that can be targeted by ARMMs comprising membrane-bound binding agents will be apparent to those of skill in the art. It will be appreciated that the present invention is not limited in this respect.EXAMPLESExample 1: ARRDC1-TEV-G4S-ABE8 v. 1

[0160] ARRDC1 was cloned in frame with the ABE8 base editor into a plasmid backbone, resulting in the expression construct having the following DNA sequences (with the base editor portion of the construct in bold):

[0161] The expressed polyprotein has the following structure: [ARRDC] — [linker] — [TEV protease cleavage sequence] — [linker] — [Base Editor (ABE8)] and the following amino acids sequence (with the base editor portion of the polyprotein in bold):(SEQ ID NO : 72)Example 2; ARRDC1-TEV-G4S-ABE8 v. 2

[0162] ARRDC1 was cloned in frame with the ABE8 base editor into a plasmid backbone, resulting in the expression construct having the following DNA sequences:

[0163] The expressed polyprotein has the following structure: [ARRDC] — [linker] — [TEV protease cleavage sequence] — [linker] — [Base Editor (ABE8)] and the following amino acids sequence:Example 7: ARRDC1-Cas9

[0164] ARRDC1-Cas9 expression construct was made by cloning full-length DNA fragment of wild-type ARRDC1 and Cas9 with the G4S linker at the C-terminus of ARRDC1 into the pcDNA3.1(+) vector.Example 8: ARMMs production, purification, and characterization

[0165] ARMMs were produced by transiently transfecting wild type Expi293 cells with an expression construct comprising a nucleic acid sequence encoding an ARRDC1 polynucleotide(see Examples 1-7), and with an expression construct comprising a nucleic acid sequence encoding a gRNA, using Expifectamine.

[0166] To purify the ARMMs, the CM was processed by tangential flow filtration (TFF) followed by ultracentrifugation and concentration. ARMMs were stored at 4°C.

[0167] To quantify the concentration and size of particles, NTA was done using the ParticleMetrix Zetaview with the following settings: Sensitivity 82.4, shutter 100, minimum area 10, maximum area 3000, and minimum brightness 20. The particles were diluted in distilled water such that there were 50 - 200 on the screen, which is within the instrument’s linear range of detection.

[0168] ARRDC1 and payloads were quantified using Western blot analysis.

[0169] To quantify gRNA packaged in ARMMs, a custom Taqman probe was designed against the scaffold sequence in the single gRNA (sgRNA). The quantification of gRNA included three steps: preparation of RNA samples, cDNA synthesis, and droplet digital PCR(ddPCR). The relative amount of gRNA in ARMMs was reported as fold enrichment by normalization to control ARMMs.

[0170] The quantification results for A1-ABE8 and various gRNAs as well as Al-Cas9 is shown in the table below.Example 9: In vivo study for testing the ARMMs with ARRDC1-ABE8 with gRNAl

[0171] Two C57BL / 6 mice were dosed intranasally with two doses of 50 uL solution containing 2E11 ARMMs particle (comprising ARRDC1-ABE8 and gRNAl) separated by 30min. Ninety six hours later, samples were collected and subjected to genome DNA extraction. Targeted PCR and sequence was performed to amplify the genomic regions harboring the target genome editing sites. NGS data to show the base editing efficiency at the two editing target sites is shown in FIG. 1.Example 10: In vivo study for testing the ARMMs with ARRDC1-ABE8 with gRNA2.

[0172] Two C57BL / 6 mice were dosed intranasally with one dose of 50 uL solution containing 4E11 ARMMs particle (comprising ARRDC1-ABE8 and gRNA2).

[0173] Ninety six hours later, samples were collected and subjected to genome DNA extraction. Targeted PCR and sequence was performed to amplify the genomic regions harboring the target genome editing sites. NGS data to show the base editing efficiency at the two editing target sites is shown in FIG. 2.Example 11; In vitro testing of the ARRDC1-CBE construct activity with HEK2 and HEK3 gRNAs

[0174] Day 1, HEK293 cells were seeded in a 6-well plate at 2xl 05per well with 10% DMEM.

[0175] Day 2, one ug of DNA (0.5 ug of ARRDC1-CBE + 0.5 ug of HEK2 or HEK3) was mixed with 1.5 uL of transfection reagent (expifectamine) and applied to cells following the manufacturer’s recommendations.

[0176] Day 4, Cells were harvested and subjected to genomic DNA extraction. Genomic DNA was extracted using the DNeasy Blood & Tissue Kit (Qiagen) following the manufacturer’s recommendation.

[0177] Day 5, Targeted PCR was performed to amplify genomic regions harboring the genome editing sites. One microliter of gDNA solution was used as a template in the PCR reaction using Q5 High-Fidelity 2X Master Mix (NEB, M0492) following the manufacturer’s recommendations. PCR products were confirmed by electrophoresis and purified using the Qiagen PCR purification kit (Qiagen, 28181). PCR products were submitted for Sanger sequencing or NGS analysis for the evaluation of editing.

[0178] Sanger sequencing data to show base editing efficiency by CBE with HEK2 and HEK3 gRNA in human HEK293 cells is shown in FIG. 3A and FIG. 3B.Example 12; In vitro evaluation of ARRDC1-CBE construct and GFP targeting gRNAs to introduce a stop codon to terminate translation

[0179] Day 1, HEK293 GFP expressing cells were seeded in 6-well plate at 2e5 per well with 10% DMEM.

[0180] Day 2, one ug of DNA (0.5 ug of ARRDC 1-CBE + 0.5 ug of GFP-gRNA) was mixed with 1.5 uL of transfection reagent (expifectamine) and applied to cells following the manufacturer’s recommendations.

[0181] Day 4 and Day 6. 20% percent of cells in each well were reseeded.

[0182] Day 8, cells were harvested, 50% of the cells were analyzed by Flow Cytometry to quantify GFP positive cells. The remaining 50% of the cells were used for genomic DNA extraction.

[0183] Day 9, genomic DNA was extracted using the DNeasy Blood & Tissue Kit and following the manufacturer’s recommendations. Targeted PCR was performed to amplify thegenomic regions harboring the genome editing sites. One microliter of gDNA solution was used as template in the PCR reaction using Q5 High-Fidelity 2X Master Mix (NEB, M0492) following the manufacturer’s recommendations. PCR products were confirmed by electrophoresis on E-gels and purified using the Qiagen PCR purification kit (Qiagen, 28181). PCR products were submitted for Sanger sequencing or NGS analysis for the evaluation of editing.

[0184] Sanger sequencing data to show the base editing efficiency of CBE with GFP gRNA in human HEK293 GFP stable expression cells is shown in FIG. 4.

[0185] Flow Cytometry’ data to show the GFP negative cells in HEK293 GFP stable expression cells treated with ARMMs loaded with CBE and GFP targeting gRNA. The base editing of ‘C to T’ by CBE with GFP gRNA can introduce a premature termination stop codon which terminates translation of nascent GFP transcripts is show n in FIG. 5A. FIG. 5B, and FIG.5C.References

[0186] All publications, patents and sequence database entries mentioned herein, including those items listed above, are hereby incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference. In case of conflict, the present application, including any definitions herein, will control.Equivalents and Scope

[0187] Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. The scope of the present invention is not intended to be limited to the above description, but rather is as set forth in the appended claims.

[0188] In the claims articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention also includes embodiments in which more than one. or all the group members are present in, employed in, or otherwise relevant to a given product or process.

[0189] Additionally, although the terms “first,” “second,” etc., may be used herein to describe various elements, these elements should not be limited by these terms. These terms are only used to distinguish one element from another. Thus, a “first” element discussed below could also be termed a “second” element without departing from the teachings of the present disclosure. The sequence of operations (or acts / steps) is not limited to the order presented in the claims or figures unless specifically indicated otherwise.

[0190] Furthermore, it is to be understood that the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc. , from one or more of the claims or from relevant portions of the description is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Furthermore, where the claims recite a composition, it is to be understood that methods of using the composition for any of the purposes disclosed herein are included, and methods of making the composition according to any of the methods of making disclosed herein or other methods known in the art are included, unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise.

[0191] Where elements are presented as lists, e.g., in Markush group format, it is to be understood that each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It is also noted that the term “comprising” is intended to be open and permits the inclusion of additional elements or steps. It should be understood that, in general, where the invention, or aspects of the invention, is / are referred to as comprising particular elements, features, steps, etc., certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements, features, steps, etc. For purposes of simplicity those embodiments have not been specifically set forth in haec verba herein. Thus, for each embodiment of the invention that comprises one or more elements, features, steps, etc., the invention also provides embodiments that consist or consist essentially of those elements, features, steps, etc.

[0192] Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and / or the understanding of one of ordinary' skill in the art, values that are expressed as ranges can assume any specific value within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise. It is also to be understood that unless otherwise indicated or otherwise evident from the context and / or the understanding ofone of ordinary skill in the art. values expressed as ranges can assume any subrange within the given range, wherein the endpoints of the subrange are expressed to the same degree of accuracy as the tenth of the unit of the lower limit of the range.

[0193] hi addition, it is to be understood that any embodiment of the present invention may be explicitly excluded from any one or more of the claims. Where ranges are given, any value within the range may explicitly be excluded from any one or more of the claims. Any embodiment, element, feature, application, or aspect of the compositions and / or methods of the invention, can be excluded from any one or more claims. For purposes of brevity, all the embodiments in which one or more elements, features, purposes, or aspects is excluded are not set forth explicitly herein.

Claims

ClaimsWhat is claimed is:

1. An arrestin domain-containing protein 1 (ARRDCl)-mediated microvesicle (ARMM), comprising:(i) a lipid bilayer and an ARRDC1 protein, fragment thereof, or variant thereof,(ii) a RNA-guided protein, and(iii) a gRNA.

2. The ARMM of claim 1, wherein the RNA-guided protein is a Cas fusion protein.

3. The ARMM of claim 1 or claim 2, wherein the RNA-guided protein is a base editor.

4. The ARMM of any one of claims 1-3, wherein the base editor is an adenine base editor.

5. The ARMM of any one of claims 1-3, wherein the base editor is a cytosine base editor.

6. The ARMM of any one of claims 1-5, wherein the base editor comprises a sequence having at least 70%, 80%, 85%, 90%, 95%, or 99% identity to any one of the base editors of Example 1, Example 2, Example 3, Example 4, Example 5, or Example 6.

7. The ARMM of claim 6, wherein the base editor comprises of consists of any one of the base editors of Example 1, Example 2, Example 3, Example 4, Example 5, or Example 6.

8. The ARMM of any one of claims 1-7, wherein the gRNA is a sgRNA.

9. The ARMM of any one of claims 1-7, wherein the gRNA is a crRNA + tracrRNA.

10. The ARMM of any one of claims 1-9, wherein the RNA-guided protein and gRNA are complexed together as a ribonucleoprotein (RNP).

11. The ARMM of any one of claims 1-10, wherein the ARRDC1 protein, fragment thereof, or variant thereof, is fused to the RNA-guided protein, optionally with an intervening linker and / or cleavage domain.

12. The ARMM of any one of claims 1-10, wherein the RNA-guided protein is fused to a WW-domain, optionally with an intervening linker and / or cleavage domain.

13. A microvesicle-producing cell comprising: nucleic acid construct(s) encoding:(i) an ARRDC1 protein, fragment thereof, or variant thereof,(ii) a RNA-guided protein, and(iii) a gRNA.

14. The cell of claim 13, wherein the RNA-guided protein is a Cas fusion protein.

15. The cell of claim 13 or claim 14, wherein the RNA-guided protein is a base editor.

16. The cell of any one of claims 13-15, wherein the base editor is an adenine base editor.

17. The cell of any one of claims 13-15, wherein the base editor is a cytosine base editor.

18. The cell of any one of claims 13-17, wherein the base editor comprises a sequence having at least 70%, 80%, 85%, 90%, 95%, or 99% identity to any one of the base editors of Example 1, Example 2, Example 3, Example 4, Example 5, or Example 6.

19. The cell of claim 18, wherein the base editor comprises of consists of any one of the base editors of Example 1, Example 2, Example 3, Example 4, Example 5, or Example 6.

20. The cell of any one of claims 13-19. wherein the gRNA is a sgRNA.

21. The cell of any one of claims 13-19. wherein the gRNA is a crRNA + tracrRNA.

22. The cell of any one of claims 13-21, wherein the ARRDC1 protein, fragment thereof, or variant thereof, is fused to the RNA-guided protein, optionally with an intervening linker and / or cleavage domain.

23. The cell of any one of claims 13-21, wherein the RNA-guided protein is fused to a WW-domain, optionally with an intervening linker and / or cleavage domain.

24. A method of delivenng a molecule to a target cell, said method comprising contacting the target cell with the microvesicle of any of claims 1-12.

25. A method of treating a disorder in a patient, the method consisting of administering to the patient a microvesicle of any of claims 1-12.

26. A method of treating a disorder in a patient, the method consisting of administering to the patient a microvesicle-producing cell of any of claims 13-23.

27. The method of claim 25 or 26, wherein said patient is a mammal.

28. The method of claim 27, wherein said mammal is a primate.

29. The method of claim 15, wherein said primate is a human.

30. The ARMM of any one of claims 1-12, wherein the ARMM further comprises a fusogen or the cell of any one of claims 13-23, further comprising a nucleic acid encoding a fusogen.

31. The ARMM or cell of claim 30, wherein the fusogen is VSV-G.

32. The ARMM of any one of claims 1-12, 30, or 31, or the cell of any one of claims 13- 23, 30, or 31, for use a medicament or manufacture of a medicament.

33. A composition substantially as shown and described.

34. A method substantially as shown and described.