Immunogenic compositions useful for self-administration by pigs
The immunogenic composition with recombinant PCV2 ORF2 protein and fragrance gel allows pigs to self-administer, addressing the challenges of conventional vaccine administration by enhancing immune response and reducing stress and labor.
Patent Information
- Authority / Receiving Office
- JP · JP
- Patent Type
- Applications
- Current Assignee / Owner
- BOEHRINGER INGELHEIM VETMEDICA GMBH
- Filing Date
- 2024-05-02
- Publication Date
- 2026-06-09
AI Technical Summary
Conventional vaccines for pigs against viral infections like PCV2 and PPV require laborious administration by injection, causing stress and potential adverse events, and there is a need for a composition that can be easily placed in the pig rearing environment for self-administration.
An immunogenic composition comprising recombinant PCV2 ORF2 protein and a fragrance gel composition that is self-administered by pigs, inducing an immune response without manual handling.
The composition effectively enhances the immune response in pigs against PCV2 and PPV, reducing stress and labor, while maintaining stability and palatability for self-administration.
Smart Images

Figure 2026518572000001 
Figure 2026518572000002 
Figure 2026518572000003
Abstract
Description
Technical Field
[0001] The present invention relates to an immunogenic composition comprising (i) an antigen composition comprising or consisting of a viral antigen and (ii) a gel composition comprising a fragrance, such immunogenic composition can be placed in the breeding environment of livestock, particularly pigs. Thereby, self-administration of the immunogenic composition by pigs becomes possible, and an immune response can be easily induced in animals with a minimal workload of personnel and reduction of stress on pigs.
Background Art
[0002] Viral infections pose significant health problems in animals with harmful economic impacts. For example, there are many viral pathogens that cause diseases in economically important livestock animals such as pigs. Viruses that infect pigs include, for example, Porcine circovirus type 2 and Porcine parvovirus. Porcine circovirus type 2 (PCV2) is a small (17 - 22 nm in diameter), icosahedral, non-enveloped DNA virus that contains a single-stranded circular genome. PCV2 shares approximately 80% sequence identity with Porcine circovirus type 1 (PCV1). However, in contrast to PCV1, which is usually non-toxic, pigs infected with PCV2 generally exhibit a syndrome called postweaning multisystemic wasting syndrome (PMWS). PMWS is clinically characterized by weakness, pale skin, reproductive failure, respiratory diseases, diarrhea, jaundice, and hemolytic jaundice. In some infected pigs, all combinations of symptoms are seen, while other pigs have only one or two of these symptoms. At necropsy, microscopic and gross lesions are also seen in multiple tissues and organs, with lymphoid organs being the most common site of lesions. A strong correlation is observed between the amount of PCV2 nucleic acid or antigen and the severity of microscopic lymphoid lesions. The mortality rate of pigs infected with PCV2 can reach 80%. In addition to PMWS, PCV2 is associated with several other infectious diseases including pseudorabies, porcine reproductive and respiratory syndrome (PRRS), Glässer's disease, streptococcal meningitis, salmonellosis, postweaning colibacillosis, dietary hepatosis, and suppurative bronchopneumonia. Several vaccines can be used to reduce the impact of PCV2 infection in pigs. U.S. Patent No. 6703023 (US6703023 B1) provides a DNA-based vaccine for the prevention of PMWS in pigs, and this document and the following documents referenced herein are incorporated in their entirety by reference. International Publication No. 2003049703 describes the preparation of a live chimeric vaccine containing non-pathogenic PCV1 virus, in which the ORF2 protein is replaced by the ORF2 protein of pathogenic PCV2. International Publication Nos. 199918214 and 199929717 provide procedures for the preparation of several PCV2 strains and dead PCV2 vaccines. The preparation of subunit vaccines is also described in International Publication Nos. 199918214 and 199929717. An effective ORF2-based subunit vaccine is reported in International Publication No. 2006072065. Furthermore, the ORF2-based subunit vaccine is also described in International Publication No. 200728823 and International Publication No. 2015051099. Porcine parvovirus (PPV) is an autonomously replicating virus belonging to the subfamily Parvovirinae of the genus Protoparvovirus, family Parvoviridae, containing a single-stranded DNA molecule of approximately 5100 nucleotides. Only the minus strand of DNA is packaged into virions. The viral genome encodes three capsid proteins (VP1, VP2, VP3) and one non-structural protein (NS1). The parvovirus capsid is approximately 22-25 nanometers in diameter and consists of VP1 and VP2 subunits. These proteins are derived from alternatively spliced versions of the same RNA molecule, and therefore their sequences overlap. Furthermore, porcine parvovirus exhibits a high level of sequence similarity with feline panleukopenia virus and canine parvovirus. PPV infection is a common cause of reproductive disorders in pig farms worldwide. Serological studies show that porcine parvovirus is widespread in all pig-producing regions of the world, with up to 80% of animals showing seroconversion to antibodies. On the one hand, currently available PPV vaccines are produced by culturing the native virus in porcine-derived primary cells or established cell lines, after which the infectious virus is isolated and inactivated with chemical agents to complete the total cell-killing viral vaccine. On the other hand, effective VP2-based subunit vaccines and their production have been reported in International Publication No. 2018083154 or International Publication No. 2018083156.
[0003] Vaccinating pigs with conventional vaccines against viruses such as PCV2 and PPV, typically administered by injection, is a laborious and time-consuming process because each animal must be handled separately. Furthermore, the vaccination process can stress the pigs and may lead to adverse events in some animals, such as decreased food intake. Therefore, an immunogenic composition is desired that can be easily placed in the pig rearing environment, remains stable in the barn for a sufficient period of time, and is then self-administered by the animals, thereby increasing the immune response against the virus in the animals. [Overview of the project]
[0004] The above technical problems are solved by the description and embodiments set forth in the claims. Therefore, the different embodiments of the present invention are carried out in accordance with the claims. The present invention is based on the remarkable discovery that placing an immunogenic composition comprising (i) recombinant PCV2 ORF2 protein and (ii) a fragrance gel composition in a pigsty results in the pigs self-consuming the immunogenic composition and the pigs becoming immune to PCV2. In the first aspect, the present invention is therefore, - Antigen compositions containing or consisting of viral antigens; and - Gel composition containing fragrance The present invention relates to an immunogenic composition containing, which is hereafter also referred to as "the immunogenic composition described in the present invention."
[0005] The antigen composition, which will hereafter also be referred to as "the antigen composition described in the present invention," preferably contains or consists of a viral protein. Therefore, the viral antigen, also referred to herein as “the viral antigen described in the present invention,” is in particular a viral protein. The term “viral protein” encompasses any protein of viral origin. Specific examples include viral capsid proteins, viral coat proteins, viral envelope proteins, and viral core proteins.
[0006] The gel composition, hereafter also referred to as "the gel composition described in the present invention," is a gel composition particularly suitable for oral and / or mucosal administration. As used herein, the term "gel composition" refers to a suitable liquid, semi-solid, or solid material containing an amount of one or more gelling agents effective for gelling the composition. The term “immunogenic composition” refers to a composition comprising at least one antigen that induces an immune response in a host to which the immunogenic composition is administered. Such an immunological response may be a cellular and / or antibody-mediated immune response to the immunogenic composition described in the present invention. The host is also referred to as “subject.” Preferably, any host or subject described or mentioned herein is an animal. When used herein, the term “animal” refers in particular to mammals, preferably swine, more preferably pig, most preferably piglet, or sow.
[0007] The term "antigen composition" refers to a composition containing a substance that stimulates the immune system and induces an immune response in a host or target. As used herein, the term "viral antigen" means a substance or component thereof derived from a virus, or both, which can induce an immune response. Typically, "immune response" includes, but is not limited to, one or more of the following effects: the production or activation of antibodies, B cells, helper T cells, suppressor T cells, and / or cytotoxic T cells and / or gamma-delta T cells that are specifically directed to one or more antigens contained in the immunogenic composition of the present invention. Preferably, the host exhibits either a protective immune response or a therapeutic response. A "protective immune response" is demonstrated by a reduction or absence of one or more clinical signs typically exhibited by the infected host, a rapid recovery time, and / or a reduction in the duration of infectivity, or a decrease in the pathogen's titer in the infected host's tissues, fluids, or excretions. For example, to assess the protective immune response against PCV2, PCV2-specific T-cell immunity can be evaluated according to the protocol of Koinig HC et al. Vet Res. 46:20 (2015). As is well known and described therein, pluripotent T cells that co-produce IFN-γ, interleukin-2 (IL-2), and TNF-α are strongly correlated with protection, and the appearance of IFN-γ / TNF-α co-producing T cells after PCV2 vaccination correlates with the prevention of viremia after PCV2 vaccination. When used herein, “pathogen” or “specific pathogen” refers in particular to a virus from which a viral antigen originates. For example, when used herein, the pathogen is PCV2 or PPV. An immunogenic composition is described as a “vaccine” if the host exhibits a protective immunological response that enhances resistance to new infections and / or reduces the clinical severity of the disease. As used herein, “antigen” means, but is not limited to, an immunogenic composition of interest containing such an antigen or an immunologically active component thereof, or a component that induces an immune response to a vaccine in a host. In particular, as used herein, the term “antigen” means a protein or protein domain that, when administered to a host, can induce an immunological response in the host. "Induction of an immune response," "to induce an immune response," or "to trigger an immune response" each typically involves administering an effective amount of the immunogenic composition of the present invention to a subject or group of subjects to which such treatment / prevention would be beneficial. The term “treatment and / or prevention” refers to a reduction in the incidence of a particular pathogen infection in a herd, or a reduction in the severity of one or more clinical signs caused by or associated with a particular pathogen infection. Accordingly, the term “treatment and / or prevention” also refers to a reduction in the number of animals in a herd infected with a particular pathogen (= reduction in the incidence of a particular pathogen infection), or a reduction in the severity of one or more clinical signs typically associated with or caused by a pathogen infection in a group of animals that have received an effective amount of the immunogenic composition provided herein, compared to a group of animals that have not received such an immunogenic composition. The term “treatment” refers to the administration of an effective dose of an immunogenic composition once at least some animals in a subject or herd have already been infected with such a pathogen and have already exhibited certain clinical signs caused by or associated with such pathogen infection. The term “prevention” refers to the administration to a subject prior to any infection of such subject by the pathogen, or at least all animals in such animal or herd of animals have not exhibited one or more clinical signs caused by or associated with such pathogen infection. The term “effective amount,” as used herein, means, but is not limited to, an amount of viral antigen, in particular the protein or virus-like particle of this disclosure, that induces or can induce an immune response in a subject. Such an effective amount can reduce the incidence of a particular pathogen infection in a population or reduce the severity of one or more clinical signs of a particular pathogen infection. Preferably, the incidence or severity of one or more clinical signs is reduced by at least 10%, more preferably at least 20%, even more preferably at least 30%, even more preferably at least 40%, even more preferably at least 50%, even more preferably at least 60%, even more preferably at least 70%, even more preferably at least 80%, even more preferably at least 90%, and most preferably at least 95%, compared to a subject that is not treated but subsequently infected with the particular pathogen. The term “clinical signs,” as used herein, refers to signs of infection of a subject from a particular pathogen. The clinical signs of infection depend on the selected pathogen. Examples of such clinical signs caused by PCV2 infection include, but are not limited to, wasting or weight loss, pallor of the skin, difficulty breathing, diarrhea, and occasional jaundice. Reducing the occurrence or severity of one or more clinical signs caused by or associated with specific pathogen infections in a subject can be achieved by administering one or more doses of the immunogenic composition of the present invention to the subject.
[0008] In a particularly preferred embodiment, the immunogenic composition of the present invention is adjuvant-free. In a particularly preferred embodiment, the immunogenic composition of the present invention is - Antigen compositions containing or consisting of viral antigens; and - Gel compositions containing one or more types of fragrances; and - One or more veterinary-acceptable carriers It consists of. In a particularly preferred embodiment, the immunogenic composition of the present invention is - Antigen compositions containing or consisting of viral antigens; and - A gel composition comprising one or more fragrances; and - One or more veterinarily acceptable carriers; and - At least one immunogenic substance different from the viral antigen Comprising.
[0009] In another preferred embodiment, the immunogenic composition of the present invention is - An antigen composition comprising or consisting of a viral antigen; and - A gel composition comprising one or more fragrances; and - One or more veterinarily acceptable carriers; and - An adjuvant Comprising. In yet another preferred embodiment, the immunogenic composition of the present invention is - An antigen composition comprising or consisting of a viral antigen; and - A gel composition comprising one or more fragrances; and - One or more veterinarily acceptable carriers; and - An adjuvant; and - At least one immunogenic substance different from the viral antigen Comprising.
[0010] Preferably, the viral antigen described in the present invention can form virus-like particles. As used herein, the term "virus-like particle" refers to a structure similar to a virus particle, but is non-pathogenic, non-replicating, and non-infectious because it lacks all or part of the viral genome.
[0011] In a more preferred embodiment, the viral antigen described in the present invention is a viral capsid protein. Preferably, the viral antigen described in the present invention is a circovirus capsid protein. In yet another embodiment, the viral antigen described in the present invention is a porcine circovirus (PCV) capsid protein. In particular, the viral antigen described in the present invention is the porcine circovirus type 2 (PCV2) ORF2 protein, and the PCV2 ORF2 protein preferably comprises, or consists of, an amino acid sequence having at least 90%, preferably at least 95%, more preferably at least 98%, even more preferably at least 99% or particularly 100% sequence identity with the sequence of SEQ ID NO: 1.
[0012] In another preferred embodiment, the viral antigen described in the present invention is selected from the group consisting of PCV2 genotype a (PCV2a) ORF2 protein, PCV2 genotype b (PCV2b) ORF2 protein, PCV2 genotype c (PCV2c) ORF2 protein, PCV2 genotype d (PCV2d) ORF2 protein, PCV2 genotype e (PCV2e) ORF2 protein, PCV2 genotype f (PCV2f) ORF2 protein, PCV2 genotype g (PCV2g) ORF2 protein, and PCV2 genotype h (PCV2h) ORF2 protein. The terms "PCV2a", "PCV2b", "PCV2c", "PCV2d", "PCV2e", "PCV2f", "PCV2g", "PCV2h" as used herein relate to the established PCV2 genotype classification described in particular in Franzo G & Segales J. PLos One 13(12):e0208585 (2018) and Link EK et al. Virol J. 18(1):70 (2021).
[0013] In a specific embodiment, the viral antigen described in the present invention is the PCV2 genotype a (PCV2a) ORF2 protein. Preferably, the PCV2a ORF2 protein described herein comprises, or consists of, an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99% or particularly 100% sequence identity with the sequence of SEQ ID NO: 1. In another specific embodiment, the viral antigen described in the present invention is the PCV2 genotype d (PCV2d) ORF2 protein. Preferably, the PCV2d ORF2 protein described herein comprises or consists of an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99%, or particularly 100% sequence identity with the sequence of SEQ ID NO: 2. In another preferred embodiment, the viral antigen described in the present invention is a parvovirus capsid protein. In one embodiment, the viral antigen described in the present invention is porcine parvovirus (PPV) capsid protein, particularly PPV viral protein 2 (VP2).
[0014] Preferably, the PPV VP2 described herein comprises or consists of the sequence of SEQ ID NO: 3 and an amino acid sequence having at least 90%, preferably at least 95%, more preferably at least 98%, even more preferably at least 99%, or particularly 100% sequence identity. In the context of the present invention, with respect to the term "at least 90%", the term is understood to preferably mean "at least 91%", more preferably "at least 92%", even more preferably "at least 93%", or particularly "at least 94%". In the context of the present invention, with respect to the term "at least 95%", the term is understood to preferably mean "at least 96%", more preferably "at least 97%", even more preferably "at least 98%", or particularly "at least 99%". In the context of the present invention, with respect to the term "at least 99%", the term is understood to preferably mean "at least 99.2%", more preferably "at least 99.4%", even more preferably "at least 99.6%", or particularly "at least 99.8%". More specifically, the term "at least 99% sequence identity" refers to sequence identity of 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9%. The term "having 100% sequence identity" is understood to be equivalent to the term "identical" as used herein. In its use herein, the term “sequence identity of sequence number X with the sequence” is understood to be equivalent to the term “sequence identity of sequence number X with the sequence over the length of sequence number X” or the term “sequence identity of sequence number X with the sequence over the entire length of sequence number X,” respectively. In this context, “X” is any integer selected from 1 to 3, and “sequence number X” represents any sequence number as described herein.
[0015] In a more general embodiment, the viral antigens described in the present invention are non-replicating viral antigens and replicating viral antigens.
[0016] Therefore, in a particularly preferred embodiment, the antigenic composition described in the present invention contains or comprises a non-replicating viral antigen. The term "non-replicating viral antigen" specifically refers to viral molecules, such as proteins, carbohydrates, lipids, or nucleic acids, or combinations thereof, that are generally pure. When prepared from a virus, the non-replicating antigen may refer to intact but dead (i.e., non-replicating) viruses, or parts thereof, such as extracts, fractions, homogenates, or sonicated products. Furthermore, the non-replicating viral antigen may be nucleic acid-based, or recombinant products, such as expression vectors or expression proteins, or products of in vitro expression systems. All of these are well known in the art.
[0017] In another particularly preferred embodiment, the antigen composition described in the present invention is a virus-like particle. Preferably, the viral antigen described in the present invention is recombinantly expressed, particularly baculovirus-expressed. For example, the viral antigen is preferably a recombinantly expressed viral protein, particularly a recombinant baculovirus-expressed viral protein. The term "recombinantly expressed" is understood to be equivalent to "recombinant" in particular, as used herein. Therefore, for example, "recombinantly expressed virus antigen" is equivalent to "recombinant virus antigen."
[0018] The viral antigen described in the present invention is preferably a recombinant viral protein, and more particularly a recombinant baculovirus-expressed viral protein. The terms “recombinant viral protein” or “recombinant expressed viral protein,” as used herein, refer in particular to viral proteins produced by recombinant DNA technology, where the DNA encoding the expressed protein is typically inserted into a suitable expression vector and then transformed, or, in the case of a viral vector, used to infect host cells and produce a heterologous protein. Therefore, the terms “recombinant viral protein” or “recombinant expressed viral protein,” as used herein, refer in particular to protein molecules expressed from recombinant DNA molecules. “Recombinant DNA molecule,” as used herein, refers to a DNA molecule composed of DNA segments joined together by molecular biological technology. Suitable systems for recombinant protein production include, but are not limited to, insect cells (e.g., baculoviruses), prokaryotic systems (e.g., Escherichia coli), fungi (e.g., thermophilic filamentous fungi (Myceliophthora thermophile), Aspergillus oryzae, Ustilago maydis), yeasts (e.g., Saccharomyces cerevisiae, methanol-assimilating yeast (Pichia pastoris)), mammalian cells (e.g., Chinese hamster ovary cells, HEK293), plants (e.g., safflower), algae, avian cells, amphibian cells, fish cells, and cell-free systems (e.g., rabbit reticulocyte lysate).
[0019] In another particularly preferred embodiment, the antigen composition described in the present invention is a virus-like particle containing a viral antigen. The viral antigen is preferably any of the above-described viral antigens of the present invention. Therefore, in one example, the viral antigen described in the present invention is a virus-like particle containing recombinant PCV2 ORF2 protein. In another example, the viral antigen described in the present invention is a virus-like particle containing recombinant PPV VP2.
[0020] In one embodiment, the antigen composition contains at least 10 μg of viral antigen per dose of the immunogenic composition. In one embodiment, the antigen composition contains at least 15 μg of viral antigen per dose of the immunogenic composition. In one embodiment, the antigen composition contains at least 30 μg of viral antigen per dose of the immunogenic composition. In one embodiment, the antigen composition contains at least 50 μg of viral antigen per dose of the immunogenic composition. In one embodiment, the antigen composition contains at least 100 μg of viral antigen per dose of the immunogenic composition. In one embodiment, the antigen composition contains at least 150 μg of viral antigen per dose of the immunogenic composition. In one embodiment, the antigen composition contains at least 200 μg of viral antigen per dose of the immunogenic composition. In one embodiment, the antigen composition contains at least 250 μg of viral antigen per dose of the immunogenic composition.
[0021] The expression "The antigenic composition contains [...] viral antigen per dose of the immunogenic composition" is understood to be equivalent, in particular, to the expression "The antigenic composition contains [...] viral antigen per dose of the immunogenic composition" or the expression "The immunogenic composition is formulated to allow administration of [...] viral antigen per dose." The terms “per dose” or “per dose of immunogenic composition” as used herein mean, respectively, “per dose of immunogenic composition administered to a subject” in order to achieve a desired effect, i.e., to induce an immune response in the subject, and the subject is in particular a pig. Preferably, one dose of the immunogenic composition has a volume of about 100 mL. In another, and more preferably, embodiment, the gel composition described in the present invention comprises water. In particular, the gel composition is a hydrogel composition. The gel compositions described in the present invention, which can be used in the preparation of the immunogenic composition of the present invention, are readily available. In one embodiment, commercially available Underline® gel concentrate (Animal Science Products, Nacogdoches, TX (USA)) is used as the gel composition included in the immunogenic composition of the present invention, but other gel compositions are equally suitable. In a more preferred embodiment, the immunogenic composition of the present invention is a liquid. In one embodiment, the immunogenic composition of the present invention is viscous.
[0022] In another embodiment, the immunogenic composition of the present invention has a viscosity of at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800 cP (mPa·seconds) or higher. In one embodiment, the immunogenic composition of the present invention has a viscosity of at least 150 mPa·seconds (at least 150 cP). In another embodiment, the immunogenic composition of the present invention has a viscosity of at least 100 mPa·seconds (at least 100 cP). In one embodiment, the immunogenic composition of the present invention has a viscosity of at least 50 mPa·sec or at least 50 cP. In another embodiment, the immunogenic composition of the present invention has a viscosity between 50 cP (50 mPa·sec) and 150 cP (150 mPa·sec). In yet another embodiment, the immunogenic composition of the present invention has a viscosity between 50 cP (50 mPa·sec) and 350 cP (350 mPa·sec). In one embodiment, the immunogenic composition of the present invention has a viscosity of at least 25 mPa·sec or at least 25 cP. In another embodiment, the immunogenic composition of the present invention has a viscosity between 25 cP (25 mPa·sec) and 150 cP (150 mPa·sec). In yet another embodiment, the immunogenic composition of the present invention has a viscosity between 25 cP (25 mPa·sec) and 350 cP (350 mPa·sec).
[0023] The unit of measurement for viscosity is Pa·second (Pascal-second) or mPa·second (millipascal-second). The conventional unit of measurement is cP (centipoise). Centipoise is equal to 1 millipascal-second (1 cP = 10⁻¹⁰). -3 Pa·second = 1 mPa·second. In another embodiment, the immunogenic composition of the present invention is a solid. In this context, the term “solid” refers, in particular, to a gel that is smearable and has some degree of elasticity or dimensional stability, compared to a “semi-solid” gel that does not have such dimensional stability. The gel composition described in the present invention contains one or more fragrances. As used herein, the expression "contains or consists of one or more fragrances" is understood to be particularly encompassed by the expression "contains fragrances". As used herein, the term “flavoring” refers to one or more compounds or mixtures that improve palatability and / or taste in animals, preferably pigs. In particular, flavorings, or one or more flavorings, can each attract pigs. Flavorings are well known to those skilled in the art. Flavorings include, but are not limited to, nutritional and non-nutritional sweeteners, flavor additives, by-products and substitute ingredients. Examples of preferred flavors include, but are not limited to, sucrose, glucose, sodium saccharin, sodium cyclamate, xylitol, perillartien, sucralose, D-tryptophan, aspartame, dihydrochalcone, artificial fruit flavors (e.g., strawberry flavor), plasma proteins (e.g., spray-dried plasma proteins), cheese and cheese-like flavors, powdered milk, chocolate and chocolate by-products.
[0024] Preferably, one or more flavorings include or consist of flavorings that impart a specific taste to the immunogenic composition of the present invention, and / or flavorings that impart a specific odor to the immunogenic composition of the present invention. In particular, one or more flavorings include or consist of flavorings that are edible by pigs, such as sweeteners, and / or flavorings that are smelled by pigs. In particular, one or more types of fragrances, Sweeteners and flavor additives that are smelled by pigs It includes or consists of. When used herein, the sweetener is preferably selected from the group consisting of sucrose, glucose, sodium saccharin, sodium cyclamate, xylitol, perillartin, sucralose, D-tryptophan, aspartame, and dihydrochalcone. When described herein, the flavor additive is preferably selected from the group consisting of artificial fruit flavors (e.g., strawberry flavor) and cheese and cheese-like flavors. Most preferably, the gel composition of the present invention comprises a sweetener and an artificial fruit flavor. At least one fragrance is preferably incorporated into the immunogenic composition of the present invention at a concentration of 0.1 to 0.5% by mass.
[0025] In some embodiments, in the immunogenic composition of the present invention, at least one fragrance is present in a final concentration of about 0.1%, 0.2%, 0.3%, 0.4%, 0.5% by mass, or any range between these, for example, about 0.1-0.4% by mass, about 0.1-0.3% by mass, about 0.1-0.2% by mass, about 0.2-0.4% by mass, about 0.2-0.3% by mass, and about 0.3-0.4% by mass. In one embodiment, the gel composition described in the present invention further comprises one or more colorants.
[0026] The term “coloring agent” may also be used in the compositions of the present invention as described, to provide visual stimulation to animals, particularly pigs, and / or visual verification to the animal handler that the composition is present, uniformly applied, and properly adhered. Preferably, the gel compositions described in the present invention further comprise one or more coloring agents that can attract pigs. The coloring agents are well known to those skilled in the art and include pigments or dyes or combinations thereof. Suitable coloring agents include, but are not limited to, FD&C coloring agents, e.g., FD&C Blue No. 1, FD&C Blue No. 2, FD&C Green No. 3, Orange B, Citrus Red No. 2, FD&C Red No. 2, FD&C Red No. 3, FD&C Red No. 40, FD&C Yellow No. 5, and FD&C Yellow No. 6. FD&C Blue No. 1 is a dye named Brilliant blue FCF, also known by its E number E133. FD&C Blue No. 2 is a pigment named indigotin, also known by its E number E132. FD&C Green No. 3 is the dye Fast Green FCF, also known by its E number E143. FD&C Red No. 2 is the pigment amaranth, also indicated by the E number E123. FD&C Red No. 3 is the dye erythrosine, also known by its E number E127. FD&C Red No. 40 is the dye Allura Red AC, also known by E number E129. FD&C Yellow No. 5 is the dye tartrazine, also known by its E number E102. FD&C Yellow No. 6 is the pigment Sunset yellow FCF, also known by its E number E110. The gel composition described in the present invention preferably contains at least one colorant selected from the group consisting of Brilliant blue FCF, indigotine, Fast Green FCF, amaranth, erythrosine, Allura Red AC, tartrazine, and Sunset yellow FCF. Preferably, the gel composition comprises the colorant Brilliant blue FCF and tartrazine. Therefore, the at least one colorant described herein is preferably a mixture of Brilliant blue FCF and tartrazine. Thus, in a preferred embodiment, the gel composition described in the present invention has a green color. In another preferred embodiment, the gel composition described in the present invention comprises water and / or an adhesion enhancer and / or a pH adjuster and / or a stabilizer.
[0027] In one embodiment, at least one adhesion enhancer is a linear or branched, crosslinked hydrophilic polymer or copolymer that is not biodegradable, or is selected from the group consisting of maltodextrin, hemicellulose extract, hemicellulose, xanthan gum, guar, pectin, gum, guar derivatives, chitosan, dextran, carrageenan, starch, polyethylene glycol, albumin, cellulose ether, hyaluronic acid, carboxymethyl hydroxyethylcellulose, hydroxypropyl methylcellulose (HPMC), hydroxypropylcellulose (HPC), hydroxyethylcellulose (HEC), carboxymethylcellulose (CMC), gelatin, vinyl acetate, polyvinylpyrrolidone, polyvinylpyrrolidone-vinyl acetate copolymer, polyvinyl alcohol, polyphosphoester, N-(2-hydroxypropyl)methacrylamide (HPMA) copolymer, polyacrylic acid, polyacrylamide, polyoxazoline, divinyl ether maleic anhydride, and polyphosphazene, and includes any of the aforementioned derivatives, substitutions and salts, as well as combinations thereof. In one embodiment, at least one adhesion enhancer is one or more adhesion enhancers based on starch and / or hemicellulose.
[0028] In another embodiment, at least one adhesion enhancer is maltodextrin and / or hemicellulose extract. In one embodiment, the gel composition described in the present invention contains maltodextrin. In one embodiment, the gel composition described in the present invention comprises a hemicellulose extract. Preferably, the hemicellulose extract described herein contains xanthan gum. In some embodiments, the immunogenic composition of the present invention contains at least one adhesion enhancer in amounts of about 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 1.1%, 1.2%, 1.3%, 1.4%, 1.5%, 1.6%, 1.7%, 1.8%, 1.9%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, and 12%. , 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, or 49%, or any range of final concentrations (w / v) in between, including, for example, approximately 0.5%~15% w / v, approximately 0.5%~10% w / v, approximately 0.5%~5% w / v, and approximately 0.5%~2% w / v. In one embodiment, the adhesion enhancer in the immunogenic composition of the present invention has a final concentration (w / v) of approximately 0.5% to 15% w / v.
[0029] In a more preferred embodiment, the gel composition described in the present invention comprises, in particular, one or more pharmaceutically acceptable carriers selected from the group consisting of stabilizers, pH adjusting compositions, alcohols, glycols, glycerol, and glycerin, lanolin and its derivatives, fatty acids and their derivatives, fatty alcohols and their derivatives, and fatty esters and their derivatives, or combinations thereof. Preferably, one or more pharmaceutically acceptable carriers are selected from the group consisting of propylene glycol (PG), propylene glycol monolaurate (PGML), propylene glycol caprylic acid (capryiate), polyethylene glycol monolaurate (PEGML), glycerol monolaurate (GML), methylformamide (DMF), allantoin, urazole, N,N-dimethylacetamide (DMA), dimethyl sulfoxide (DMSO), decylmethyl sulfoxide, lecithin, polyoxylglycerides, 1-substituted azacycloheptan-2-one, particularly 1-n-dodecylcyclazacycloheptan-2-one, alcohols, and oils safe for consumption by pigs, such as vegetable oils. In particular, the gel composition described in the present invention contains a stabilizer, and the stabilizer is preferably propylene glycol.
[0030] Typically, a "pH adjuster" is added to bring the pH of the composition to a desired value. The desired pH value is between about 6 and about 8. The immunogenic compositions of the present invention can therefore be formulated to have a pH value in the range of about 6 and about 8, or between about 6.5 and about 7.5. Suitable pH adjusters include, but are not limited to, one or more adipic acids, glycine, citric acid, calcium hydroxide, magnesium aluminometasilicate, disodium phosphate, sodium phosphate, potassium phosphate, potassium chloride, sodium citrate, calcium lactate, sodium succinate, sodium glutamate, sodium bicarbonate, and potassium bicarbonate, as well as combinations thereof. As used herein, “stabilizer” is an agent that helps stabilize the activator in the immunogenic composition of the present invention. Stabilizers include, but are not limited to, reducing agents. Possible stabilizers include sodium thiosulfate, sodium metabisulfite, sodium bisulfite, sodium sulfite, sulfur dioxide, ammonium bisulfite, and ammonium thiosulfate. Sodium thiosulfate is preferred because it has high neutralizing ability, is considered safe, and is not corrosive. The term "stabilizer" also includes chelating agents. Chelating agents may be added to the gel compositions described in the present invention to enhance the preservative or antiseptic system. Preferred chelating agents are mild agents, such as ethylenediaminetetraacetic acid (EDTA), EDTA derivatives, or any combination thereof. Suitable stabilizers or preservatives for use in the immunogenic compositions of the present invention include, but are not limited to, one or more alkanols, disodium EDTA (ethylenediaminetetraacetate), EDTA salts, EDTA fatty acid conjugates, isothiazolinone, parabens such as methylparaben and propylparaben, propylene glycol, sorbate, urea derivatives such as diazolidinyl urea, or any combination thereof.
[0031] In some aspects of the present invention, the immunogenic composition of the present invention contains at least one pharmaceutically acceptable carrier in amounts of about 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, and 39%. The final concentration (v / v) is any range between %, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, or 49%, or any range between them, including, for example, approximately 5% to 10%, approximately 10% to 15%, approximately 12% to 13%, approximately 15% to 20%, approximately 20% to 25%, approximately 25% to 30%, approximately 30% to 35%, approximately 35% to 40%, approximately 40% to 45%, and approximately 45% to 50%. In one aspect of the present invention, the gel composition described in the present invention comprises water, an adhesion enhancer, and a stabilizer.
[0032] In one embodiment, the gel composition described in the present invention comprises water, an adhesion enhancer and a stabilizer, and a pH adjuster. In one embodiment, the gel composition described in the present invention comprises water, maltodextrin, hemicellulose extract, and propylene glycol. In another embodiment, the gel composition described in the present invention comprises water, maltodextrin, cellulose, gum, and a stabilizer, preferably propylene glycol as the stabilizer. In one embodiment, the gel composition described in the present invention comprises water, maltodextrin, hemicellulose extract, propylene glycol, and an artificial coloring agent. In a particularly preferred embodiment, the gel composition described in the present invention is - water, - Maltodextrin - Propylene glycol, - Hemicellulose extract, - One or more types of colorants, and - One or more types of fragrances It includes or consists of these.
[0033] In another preferred embodiment, the immunogenic composition of the present invention comprises or contains one or more veterinarily acceptable carriers. In one aspect of the present invention, one or more veterinarily acceptable carriers are diluents. The "diluent" may include water, physiological saline, dextrose, ethanol, glycerol, etc. The isotonic agent may include sodium chloride, dextrose, mannitol, sorbitol, and lactose. The stabilizer may include albumin and alkali salts of ethylenediaminetetraacetic acid. In one aspect of the present invention, one or more veterinarily acceptable carriers are physiological buffers. In one aspect of the present invention, one or more veterinarily acceptable carriers are phosphate-buffered saline.
[0034] Preferably, one or more veterinarily acceptable carriers are selected from the group consisting of solvents, dispersions, coatings, stabilizers, diluents, preservatives, antimicrobial and antifungal agents, isotonic agents, adsorption retarders, and combinations thereof. Preferably, the immunogenic composition further comprises a sucrose gelatin stabilizer. Preferably, the immunogenic composition may further include one or more other immunomodulators, such as interleukins, interferons, or other cytokines. In another embodiment, the immunogenic composition of the present invention comprises or contains an adjuvant. In the context of the present invention, it will be understood that a suitable adjuvant for oral and / or mucosal administration is preferably selected. Accordingly, the immunogenic composition of the present invention preferably comprises or contains an adjuvant suitable for oral and / or mucosal administration. In a further embodiment, the immunogenic composition of the present invention comprises or contains at least one immunogenic substance different from the viral antigen. In one embodiment, the viral antigen described in the present invention is a PCV2a ORF2 protein, and the at least one immunogenic substance different from the viral antigen is a PCV2d ORF2 protein, preferably, The PCV2a ORF2 protein contains, or consists of, an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99%, or particularly 100% sequence identity with the sequence of SEQ ID NO: 1, and The PCV2d ORF2 protein comprises, or consists of, an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99%, or particularly 100% sequence identity with the sequence of SEQ ID NO: 2.
[0035] In another embodiment, the immunogenic substance distinct from the subunit antigen comprises a bacterial antigen. Preferably, the immunogenic substance distinct from the subunit antigen comprises a Lawsonia intracellularis and / or Salmonella spp. antigen.
[0036] In yet another aspect, the present invention also relates to the use of the immunogenic composition of the present invention in the preparation of pharmaceuticals, preferably vaccines. The present invention also provides immunogenic compositions described herein for use as pharmaceuticals, preferably as vaccines. The present invention further provides immunogenic compositions described herein for use in a method of inducing an immune response in a subject, wherein the immune response is preferably an immune response to a virus.
[0037] Preferably, the “immune response to a virus” as used herein refers to an immune response to a virus, where the virus is - The viral antigen described in the present invention, or - Amino acid sequence of the antigenic determinant of the viral antigen described in the present invention It is a species that possesses a genome that codes for [something]. As used herein, the term “antigenic determinant” is understood to refer, in particular, to a portion of an antigen that is specifically recognized by either B or T lymphocytes. B lymphocytes respond to foreign antigenic determinants through antibody production, while T lymphocytes are mediators of cellular immunity. Thus, an antigenic determinant or epitope is a portion of an antigen that is recognized by an antibody or by a T cell receptor in the context of major histocompatibility complex (MHC). An antigenic determinant may contain one or more epitopes.
[0038] With reference to the further disclosed sections below, in some embodiments, the present invention provides immunogenic compositions designated in any one of sections 13-19 and 24-64 for use in a method of inducing an immune response to PCV2 in a subject. In a preferred embodiment, the immune response described herein is a protective immune response. The present invention also provides immunogenic compositions described herein for use in a method of reducing one or more clinical signs, viral load and / or viremia caused by viral infection in a subject. Preferably, "viral infection," as used herein, means an infection caused by a virus, and the virus is - The viral antigen described in the present invention, or - Amino acid sequence of the antigenic determinant of the viral antigen described in the present invention It is a species that possesses a genome that codes for [something]. With reference to the further disclosed sections below, in some embodiments, the present invention provides immunogenic compositions designated in any one of sections 13-19 and 24-64 for use in a method of reducing one or more clinical signs, viral load and / or viremia caused by PCV2 infection in a subject. In one embodiment, the immunogenic composition described in the present invention is administered orally to a subject, particularly in the form of an oral liquid drug.
[0039] In another preferred embodiment, the immunogenic composition of the present invention is administered to a subject via mucosal administration. The present invention relates to a method for reducing one or more clinical signs, viral load, and / or viremia caused by viral infection in a subject, - The steps of placing the immunogenic composition of the present invention in the target rearing environment, and - A step in which the immunogenic composition is self-administered to the target. Further methods including this will be provided.
[0040] In some embodiments, a method for reducing one or more clinical signs, viral load and / or viremia caused by PCV2 infection in a subject, with reference to the items further disclosed below, - The step of placing an immunogenic composition specified in any one of items 13-19 and 24-64 into the target rearing environment, - A step in which the immunogenic composition is self-administered to the target. This provides a method that includes this. Preferably, the method includes the step of placing the immunogenic composition in the enclosure of the subject, wherein the immunogenic composition is placed on the floor of the enclosure of the subject.
[0041] In another preferred embodiment, the method comprises the step of placing the immunogenic composition into a kennel of interest, wherein the immunogenic composition is placed in a bowl or vessel that is placed in the breeding environment of interest. Preferably, the immunogenic composition is placed in the target rearing environment only once. In a particularly preferred embodiment, the method includes the step of placing the immunogenic composition into the enclosure of the subject, wherein the immunogenic composition is placed in the enclosure of the subject by using a dosing unit, the dosing unit is preferably a hand pump backpack sprayer. Therefore, the present invention also provides a dosage unit containing the immunogenic composition of the present invention, in particular a hand pump backpack sprayer.
[0042] All of the aforementioned methods for inducing an immune response in a subject and reducing one or more clinical signs, viral load, and / or viremia caused by a viral infection in a subject are hereafter referred to as "methods of the present invention." In one embodiment, the method of the present invention involves administering the immunogenic composition of the present invention as a booster to the subject during a prime-boost administration, the subject preferably having been initially stimulated by administration of a vaccine that does not contain a fragrance-containing gel composition. In another preferred embodiment, the method of the present invention involves subjects that are not prevaccinated with a vaccine against a virus, and the virus is a species having a genome that encodes the antigenic determinant of the viral antigen. In some embodiments of the present invention, the target is a PCV2 vaccine-naive target. In one embodiment, the method of the present invention, - The aforementioned immune response, or - In the subject, the step of reducing one or more clinical signs, viral load and / or viremia caused by viral infection. This is obtained by administration of an immunogenic composition. In another embodiment, in the method of the present invention, - The aforementioned immune response, or - In the subject, the aforementioned step of reducing one or more clinical signs, viral load and / or viremia caused by viral infection. This is obtained without further administration of a vaccine against the virus to the subject, and the virus is a species having a genome that encodes the antigenic determinant of the viral antigen contained in the immunogenic composition. In one preferred embodiment of the method of the present invention, the subject is preferably an animal, particularly a pig. In a more preferred embodiment of the method of the present invention, the subject is a piglet or a sow. The present invention further provides a dosage unit comprising the immunogenic composition of the present invention, which will hereafter also be referred to as "the dosage unit described in the present invention."
[0043] Preferably, the administration unit described in the present invention is a hand pump backpack sprayer. In another aspect, the present invention also relates to the use of the dosage units described in the present invention for placing the immunogenic composition of the present invention into the target rearing environment. In a more preferred embodiment, the present invention relates to any of the methods described above, which include the step of placing the immunogenic composition of the present invention into a subject enclosure, wherein the dosing unit described in the present invention is used to place the immunogenic composition into the subject's rearing environment. [Examples]
[0044] The following embodiments are intended to illustrate the present disclosure only; they are not intended to limit the scope of the claims. (Example 1) Results of the PCV2 VLP Gel Administration Test the purpose: To investigate whether porcine circovirus type 2 (PCV2) virus-like particles (VLPs) are immunogenic when administered to pigs via gel, and therefore whether oral and mucosal vaccines prevent PCV2-related disease in pigs. method: To investigate the immunogenicity of porcine circovirus type 2 virus-like particles administered to pigs via gel, the experiment was conducted using two treatment groups. On day 0 of the trial, SPF pigs approximately 6 weeks old were randomly assigned to either treatment group 1) unvaccinated control group or 2) GelVLP vaccinated group. These groups consisted of 7 and 10 pigs, respectively. On day 0 of the trial, the pigs in the Gel VLP vaccine group were provided with the immunogenic composition of the present invention, such that each pig contained a total of 300 μg of recombinant baculovirus-expressing PCV2d ORF2 protein (SEQ ID NO: 2 (corresponding to SEQ ID NO: 1 in WO2015051099)), the viral antigens also referred herein as “porcine circovirus type 2d, dead baculovirus vector-expressing virus-like particles” or “PCV2 VLP,” respectively. The PCV2d ORF2 protein was produced as described in WO2015051099 (Examples 1-3) and subsequently subjected to the downstream processing described in WO2019191005 (Example 1, without mixing with carbomer solution (adjuvant)). The final adjusted Gel VLP vaccine is prepared according to the manufacturer's instructions. Prepared by mixing commercially available Underline® gel concentrate (Animal Science Products, Nacogdoches, TX (USA)), containing water, maltodextrin, propylene glycol, hemicellulose extract, artificial colorings, and natural and artificial flavors, with PCV2 VLP in the following ratio: 1 part Underline® gel concentrate mixed with 2 parts cold PCV2 VLP solution.
[0045] The gel VLP vaccine was placed in the pigpens by adding a total of 500 mL (containing 1,500 μg of PCV2 VLP) to each cage containing 5 pigs. This composition was added to two bowls (gel feeders) per cage, and the pigs consumed the gel vaccine mixture themselves. This vaccine does not contain adjuvants. On day 23 after vaccination, all pigs were collected for peripheral blood mononuclear cell (PBMC) extraction, and PCV2-specific T-cell immunity was evaluated according to the protocol of Koinig HC et al. Vet Res. 46:20 (2015). All blood samples were also submitted to test for PCV2 viremia by PCR. result: PCV2 viremia was not detected in any of the pigs. The pigs were immediately attracted to the gel VLP mixture and consumed it completely. This allows for immunization of pigs against PCV2 without the need to handle each pig individually, significantly reducing the effort and time required to immunize the animals. The vaccine composition was well tolerable, and no adverse events were observed. Cellular immunity analysis revealed that pigs in the Gel VLP vaccine group developed PCV2 antigen-specific T cells, while pigs in the unvaccinated control group did not. On day 23 after vaccination, the Oral VLP vaccine group developed PCV2 antigen-specific interferon-gamma and tumor necrosis factor-producing CD4 + The vaccinated group had T cells, but the unvaccinated control group did not (Figure 1). Conclusion: Porcine circovirus type 2 virus-like particles, when combined with semi-solid, liquid, or gel formulations of the composition for consumption, are immunogenic to pigs and therefore constitute a method and vaccine for preventing disease caused by PCV2 in pigs. [Brief explanation of the drawing]
[0046] [Figure 1] This graph shows the percentage of interferon-gamma (IFNg) and tumor necrosis factor alpha (TNFa)-positive PCV2 antigen-specific CD4+ T cells measured in the blood of pigs 23 days after vaccination.
[0047] Sequences included in the sequence list Sequence ID 1 Sequence ID 1 corresponds to the sequence of the PCV2a ORF2 protein (233 amino acid residues in length). Sequence ID 1 is the amino acid sequence (single-letter representation of amino acid residues from the N-terminus to the C-terminus, including the N-terminal methionine residue (M) at amino acid position 1): MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKAT TVTTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGS TAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKR NQLWLRLQTSRNVDHVGLGTAFENSKYDQDYNIRVTMYVQFREFNLKDPPLEP It holds.
[0048] Sequence ID 2 Sequence ID 2 corresponds to the sequence of the PCV2d ORF2 protein (234 amino acid residues in length). Sequence ID 2 is the amino acid sequence (single-letter representation of amino acid residues from the N-terminus to the C-terminus, with the N-terminal methionine residue (M) at amino acid position 1): MTYPRRRFRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTIGYTVKKT TVTTPSWNVDMMRFNINDFLPPGGGSNPLTVPFEYYRIRKVKVEFWPCSPITQGDRGVGS TAVILDDNFVTKANAALTYDPYVNYSSRHTITQPFSYHSRYFTPKPVLDRTIDYFQPNNKR NQLWLRLQTTGNVDHVGLGTAFENSIYDQDYNIRITMYVQFREFNLKDPPLNPK It holds.
[0049] Sequence ID 3 Sequence ID 3 corresponds to the sequence of PPV VP2 (579 amino acid residues in length). Sequence ID 3 is the amino acid sequence (single-letter representation of amino acid residues from the N-terminus to the C-terminus, with the N-terminal methionine residue (M) at amino acid position 1): MSENVEQHNPINAGTELSATGNESIGGGGGGGGRGSIGVGVSTGSFNNQTEFQYLGEGLV RITAHASRLIHLNMPEHETYKRIHVLNSESSGVAGQMVQDDAHTQMVTPWSLIDANAWGVW FNPADWQLISNNMTEINLVSFEQEIFNVVLKTITESATSPPTKIYNNDLTASLMVALDTTN NTLPYTPAAPRSETLGFYPWLPTKPTQYRYYLSCTRNNLNPPTYTGQSEQITDSIQTGLHS DIMFYTIENAVPIHLLRTGDEFSTGIYHFDTKPLKLTHSWQTNRSLGLPPKLLTEPTTEG DQHPGTLPAANTRKGYHQTINNSYTEATAIRPAQVGYNTPYMNFEYSNGGPFLTPIVPTA DTQYNDDEPNGAIRFTMGYQHGQLTTSSQELERYTFNPQSKCGRAPKQQFNQQSPLNLQN TNNGTLLPSDPIGGKTNMHFMNTLNTYGPLTALNNTAPVFPNGQIWDKELDTDLKPRLHV TAPFVCKNNPPGQLFVKIAPNLTDDFNADSPQQPRIITYSNFWWKGTLTFTAKMRSSNMW NPIQQHTTTAENIGNYIPTNIGGIKMFPEYSQLIPRKLY It holds.
[0050] The following sections are also disclosed herein. Accordingly, this disclosure further includes aspects characterized by the following sections. 1. - Antigen compositions containing or consisting of viral antigens; and - Gel composition containing fragrance; An immunogenic composition containing [the specified substance]. 2. - Antigen compositions containing or consisting of viral antigens; and - Gel compositions containing one or more types of fragrances; and - One or more veterinary-acceptable carriers An immunogenic composition according to item 1, comprising the above. 3. - Antigen compositions containing or consisting of viral antigens; and - Gel compositions containing one or more types of fragrances; and - One or more veterinarily acceptable carriers; and - At least one immunogenic substance different from the aforementioned viral antigen. An immunogenic composition according to item 1, comprising the above. 4. - Antigen compositions containing or consisting of viral antigens; and - Gel compositions containing one or more types of fragrances; and - One or more veterinarily acceptable carriers; and - Adjuvant An immunogenic composition according to item 1, comprising the above. 5. - Antigen compositions containing or consisting of viral antigens; and - Gel compositions containing one or more types of fragrances; and - One or more veterinarily acceptable carriers; and - Adjuvant; and - At least one immunogenic substance different from the aforementioned viral antigen. An immunogenic composition according to item 1, comprising the above. 6. An immunogenic composition according to any one of claims 1 to 5, wherein the gel composition is suitable for oral and / or mucosal administration. 7. An immunogenic composition according to any one of items 1 to 6, wherein the viral antigen is a viral protein. 8. An immunogenic composition according to any one of items 1 to 7, wherein the viral antigen is a non-replicating viral antigen. 9. An immunogenic composition according to any one of items 1 to 8, wherein the viral antigen can form virus-like particles. 10. An immunogenic composition according to any one of items 1 to 9, wherein the viral antigen is a viral capsid protein. 11. An immunogenic composition according to any one of items 1 to 10, wherein the viral antigen is a circovirus capsid protein. 12. An immunogenic composition according to any one of items 1 to 11, wherein the viral antigen is porcine circovirus (PCV) capsid protein. 13. An immunogenic composition according to any one of items 1 to 12, wherein the viral antigen is the porcine circovirus type 2 (PCV2) ORF2 protein. 14. The immunogenic composition according to item 13, wherein the PCV2 ORF2 protein comprises or consists of an amino acid sequence having at least 90%, preferably at least 95%, more preferably at least 98%, even more preferably at least 99%, or particularly 100% sequence identity with SEQ ID NO: 1. 15. An immunogenic composition according to any one of items 1 to 14, wherein the viral antigen is selected from the group consisting of PCV2 subtype a (PCV2a) ORF2 protein, PCV2 subtype b (PCV2b) ORF2 protein, PCV2 subtype c (PCV2c) ORF2 protein, PCV2 subtype d (PCV2d) ORF2 protein, PCV2 subtype e (PCV2e) ORF2 protein, PCV2 subtype f (PCV2f) ORF2 protein, PCV2 subtype g (PCV2g) ORF2 protein, and PCV2 subtype h (PCV2h) ORF2 protein. 16. An immunogenic composition according to any one of items 1 to 15, wherein the viral antigen is the PCV2 subtype a (PCV2a) ORF2 protein. 17. The immunogenic composition according to claim 15 or 16, wherein the PCV2a ORF2 protein comprises or consists of an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99%, or particularly 100% sequence identity with the sequence of SEQ ID NO: 1. 18. An immunogenic composition according to any one of items 1 to 15, wherein the viral antigen is the PCV2 subtype d (PCV2d)ORF2 protein. 19. The immunogenic composition according to any one of claims 1 to 15 and 18, wherein the PCV2d ORF2 protein comprises or consists of an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99%, or particularly 100% sequence identity with the sequence of SEQ ID NO: 2. 20. An immunogenic composition according to any one of items 1 to 10, wherein the viral antigen is parvovirus capsid protein. 21. An immunogenic composition according to any one of items 1 to 10 and 20, wherein the viral antigen is porcine parvovirus (PPV) capsid protein. 22. An immunogenic composition according to any one of items 1 to 10, 20, and 21, wherein the PPV capsid protein is PPV viral protein 2 (VP2). 23. The immunogenic composition according to item 22, wherein the PPV VP2 comprises or consists of an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99%, or particularly 100% sequence identity with the sequence of Sequence ID No. 3. 24. An immunogenic composition according to any one of items 1 to 23, wherein a viral antigen is recombinantly expressed. 25. An immunogenic composition according to any one of items 1 to 24, wherein the viral antigen is expressed by a baculovirus. 26. The immunogenic composition according to any one of claims 1 to 25, wherein the antigen composition is a virus-like particle. 27. The immunogenic composition according to item 26, wherein the antigen composition is a virus-like particle containing a viral antigen. 28. The immunogenic composition according to claim 27, wherein the viral antigen is a viral antigen specified in any one of claims 7 to 25. 29. An immunogenic composition according to any one of claims 1 to 28, wherein the antigen composition contains at least 10 μg of viral antigen per dose of the immunogenic composition, or the antigen composition contains at least 15 μg of viral antigen per dose of the immunogenic composition. 30. An immunogenic composition according to any one of claims 1 to 29, wherein the antigen composition contains at least 30 μg of viral antigen per dose of the immunogenic composition, or the antigen composition contains at least 50 μg of viral antigen per dose of the immunogenic composition. 31. An immunogenic composition according to any one of claims 1 to 30, wherein the antigen composition comprises at least 100 μg of viral antigen per dose of the immunogenic composition. 32. An immunogenic composition according to any one of claims 1 to 31, wherein the antigen composition comprises at least 150 μg of viral antigen per dose of the immunogenic composition. 33. An immunogenic composition according to any one of claims 1 to 32, wherein the antigen composition comprises at least 200 μg of viral antigen per dose of the immunogenic composition. 34. An immunogenic composition according to any one of claims 1 to 33, wherein the antigen composition comprises at least 250 μg of viral antigen per dose of the immunogenic composition. 35.1 An immunogenic composition according to any one of claims 1 to 34, wherein the immunogenic composition in dose 1 has a volume of about 100 mL. 36. The immunogenic composition according to any one of claims 1 to 35, wherein the gel composition contains water. 37. The immunogenic composition according to any one of claims 1 to 36, wherein the gel composition is a hydrogel composition. 38. The immunogenic composition according to any one of claims 1 to 37, wherein the gel composition comprises at least one adhesion enhancer. 39. The immunogenic composition according to claim 38, wherein at least one adhesion enhancer is selected from the group consisting of maltodextrin, hemicellulose extract, hemicellulose, xanthan gum, guar, pectin, gum, guar derivatives, chitosan, dextran, carrageenan, starch, polyethylene glycol, albumin, cellulose ether, hyaluronic acid, carboxymethyl hydroxyethylcellulose, hydroxypropyl methylcellulose (HPMC), hydroxypropylcellulose (HPC), hydroxyethylcellulose (HEC), carboxymethylcellulose (CMC), gelatin, vinyl acetate, polyvinylpyrrolidone, polyvinylpyrrolidone-vinyl acetate copolymer, polyvinyl alcohol, polyphosphoester, N-(2-hydroxypropyl)methacrylamide (HPMA) copolymer, polyacrylic acid, polyacrylamide, polyoxazoline, divinyl ether maleic anhydride, and polyphosphazene, and comprises derivatives and substitutions thereof, as well as combinations thereof. 40. The immunogenic composition according to any one of claims 1 to 39, wherein the gel composition comprises maltodextrin. 41. The immunogenic composition according to any one of claims 1 to 40, wherein the gel composition comprises a hemicellulose extract. 42. An immunogenic composition according to any one of items 39 to 41, wherein the hemicellulose extract contains xanthan gum. 43. The immunogenic composition according to any one of claims 1 to 42, wherein the gel composition comprises one or more pharmaceutically acceptable carriers. 44. An immunogenic composition according to item 43, wherein one or more pharmaceutically acceptable carriers are selected from the group consisting of propylene glycol (PG), propylene glycol monolaurate (PGML), propylene glycol caprylic acid (capryiate), polyethylene glycol monolaurate (PEGML), glycerol monolaurate (GML), methylformamide (DMF), allantoin, urazole, N,N-dimethylacetamide (DMA), dimethyl sulfoxide (DMSO), decylmethyl sulfoxide, lecithin, polyoxylglycerides, 1-substituted azacycloheptan-2-one, in particular 1-n-dodecylcyclazacycloheptan-2-one, alcohols, and oils safe for consumption by pigs, such as vegetable oils. 45. The immunogenic composition according to any one of claims 1 to 44, wherein the gel composition comprises propylene glycol. 46. The immunogenic composition according to any one of claims 1 to 45, wherein the gel composition comprises one or more colorants. 47. The immunogenic composition according to any one of claims 1 to 46, wherein the gel composition comprises one or more fragrances. 48. The gel composition is: - water, - Maltodextrin - Propylene glycol, - Hemicellulose extract, - One or more types of colorants, and - One or more types of fragrances An immunogenic composition according to any one of claims 1 to 47, comprising or consisting of the following. 49. An immunogenic composition according to any one of claims 46 to 48, wherein one or more colorants are selected from the group consisting of pigments, dyes and combinations thereof, and / or one or more colorants are capable of attracting pigs. 50. An immunogenic composition according to any one of claims 46 to 49, wherein one or more colorants are selected from the group consisting of FD&C Blue No. 1, FD&C Blue No. 2, FD&C Green No. 3, Orange B, Citrus FD&C Red No. 2, FD&C Red No. 2, FD&C Red No. 3, FD&C Red No. 40, FD&C Yellow No. 5, and FD&C Yellow No. 6. 51. An immunogenic composition according to any one of claims 47 to 50, wherein one or more flavorings can attract pigs. 52. An immunogenic composition according to any one of claims 47 to 51, wherein one or more flavorings are selected from the group consisting of sucrose, glucose, sodium saccharin, sodium cyclamate, xylitol, perillartin, sucralose, D-tryptophan, aspartame, dihydrochalcone, artificial fruit flavors (e.g., strawberry flavor), plasma proteins (e.g., spray-dried plasma proteins), cheese and cheese-like flavors, powdered milk, chocolate and chocolate by-products. 53. An immunogenic composition according to any one of items 1 to 52, which is a liquid. 54. An immunogenic composition according to any one of items 1 to 53, which is viscous. 55. An immunogenic composition according to any one of claims 1 to 54, having a viscosity of at least 50 mPa·seconds or at least 50 cP. 56. An immunogenic composition according to any one of items 1 to 52, 54, and 55, which is a solid. 57. An immunogenic composition according to any one of items 1 to 56, comprising an adjuvant. 58. An immunogenic composition according to any one of claims 1 to 57, further comprising or containing one or more veterinarily acceptable carriers. 59. The immunogenic composition according to any one of claims 2 to 58, wherein the one or more veterinarily acceptable carriers are selected from the group consisting of solvents, dispersions, coatings, stabilizers, diluents, preservatives, antimicrobial agents and antifungal agents, isotonic agents, and adsorption retarders. 60. An immunogenic composition according to any one of claims 1, 3, and 5 to 59, comprising or containing at least one immunogenic substance different from the viral antigen. 61. The immunogenic composition according to any one of claims 3, 5-17, and 24-60, wherein the viral antigen is a PCV2a ORF2 protein, and at least one immunogenic substance different from the viral antigen is a PCV2d ORF2 protein. 62. The PCV2a ORF2 protein contains or consists of an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99%, or particularly 100% sequence identity with the sequence of SEQ ID NO: 1. The immunogenic composition according to claim 61, wherein the PCV2d ORF2 protein comprises or consists of an amino acid sequence having at least 95%, preferably at least 98%, more preferably at least 99%, or particularly 100% sequence identity with the sequence of SEQ ID NO: 2. 63. An immunogenic composition according to any one of claims 3 and 5 to 62, wherein at least one immunogenic substance different from the viral antigen comprises a bacterial antigen. 64. An immunogenic composition according to any one of claims 3 and 5 to 63, wherein at least one immunogenic substance different from the viral antigen comprises Lawsonia intracellularis antigen and / or Salmonella antigen. 65. Use of an immunogenic composition according to any one of items 1 to 64 in the preparation of a pharmaceutical, preferably a vaccine. 66. An immunogenic composition as described in any one of items 1 to 64 for use as a pharmaceutical. 67. An immunogenic composition according to any one of items 1 to 64 for use as a vaccine. 68. An immunogenic composition according to any one of items 1 to 64 for use in a method of inducing an immune response in a subject. 69. An immunogenic composition for use in the method described in item 68, wherein the immune response is an immune response to a virus. 70. The aforementioned immune response, - Viral antigen, or - Amino acid sequence of the antigenic determinant of the viral antigen An immunogenic composition for use in the method described in item 69 against viruses of species having a genome encoding [a specific gene]. 71. An immunogenic composition according to any one of subsections 13-19 and 24-64, for use in a method of inducing an immune response to PCV2 in a subject. 72. An immunogenic composition for use in the method described in any one of items 68 to 71, wherein the immune response is a protective immune response. 73. An immunogenic composition according to any one of sub-sub-sub-sub-sub-sub-sub-sub-sub-sub-sub-subjects, for use in a manner that reduces one or more clinical signs, viral load and / or viremia caused by viral infection. 74. The aforementioned viral infection, - Viral antigen, or - Amino acid sequence of the antigenic determinant of the viral antigen An immunogenic composition for use in the method described in item 73, which is an infection by a virus of a species having a genome encoding [the specified code]. 75. An immunogenic composition according to any one of subsections 13-19 and 24-64, for use in a manner that reduces one or more clinical signs, viral load and / or viremia caused by PCV2 infection in a subject. 76. A method for inducing an immune response in a subject, comprising the step of administering an effective amount of an immunogenic composition described in any one of items 1 to 64 to the subject. 77. The immune response to the virus is preferably, - Viral antigen, or - Amino acid sequence of the antigenic determinant of the viral antigen The method described in paragraph 76, which is an immune response to a virus of a species having a genome encoding the following: 78. A method for inducing an immune response to PCV2 in a subject, comprising the step of administering an effective amount of an immunogenic composition described in any one of the items 13-19 and 24-64 to the subject. 79. The method according to any one of items 76 to 78, wherein the immune response is a protective immune response. 80. A method for reducing one or more clinical signs, viral load and / or viremia caused by a viral infection in a subject, comprising the step of administering an effective amount of an immunogenic composition described in any one of items 1 to 64 to the subject. 81. The aforementioned viral infection, - Viral antigen, or - Amino acid sequence of the antigenic determinant of the viral antigen The method described in paragraph 80, which is an infection by a virus of a species having a genome that encodes the following: 82. A method for reducing one or more clinical signs, viral load and / or viremia caused by PCV2 infection in a subject, comprising the step of administering an effective amount of an immunogenic composition described in any one of the items 13-19 and 24-64 to the subject. 83. A method for inducing an immune response in a subject, - The step of placing an immunogenic composition according to any one of items 1 to 64 into the target rearing environment, - A step in which the immunogenic composition is self-administered to the target. Methods that include... 84. The immune response to the virus is preferably, - Viral antigen, or - Amino acid sequence of the antigenic determinant of the viral antigen The method described in paragraph 83, which is an immune response to a virus of a species having a genome encoding the following: 85. The method according to claim 83 or 84, wherein the immune response is an immune response to PCV2 in a subject, and the immunogenic composition is an immunogenic composition according to any one of claims 13-19 and 24-64. 86. The method according to any one of items 83 to 85, wherein the immune response is a protective immune response. 87. A method for reducing one or more clinical signs, viral load and / or viremia caused by viral infection in a subject, The steps of placing an immunogenic composition according to any one of items 1 to 64 into the target rearing environment, and A step in which the subject self-administers an immunogenic composition. Methods that include... 88. The aforementioned viral infection, - Viral antigen, or - Amino acid sequence of the antigenic determinant of the viral antigen The method described in paragraph 87, which is an infection by a virus of a species having a genome that encodes the following: 89. A method for reducing one or more clinical signs, viral load and / or viremia caused by PCV2 infection in a subject, The steps of placing an immunogenic composition according to any one of items 13-19 and 24-64 into the target rearing environment, A step in which the subject self-administers an immunogenic composition. Methods that include... 90. The method according to any one of items 83 to 89, wherein the immunogenic composition is placed on the floor of the breeding environment in question. 91. The method according to any one of claims 83 to 90, wherein the immunogenic composition is placed in a bowl or vessel that is placed in the breeding environment of the subject. 92. Use of an immunogenic composition described in any one of items 1 to 64 in the preparation of a pharmaceutical product for use in a method of inducing an immune response in a subject. 93. The immune response to the virus is preferably, - Viral antigen, or - Amino acid sequence of the antigenic determinant of the viral antigen The use described in paragraph 92 is an immune response to a virus of a species having a genome encoding the same thing. 94. Use of an immunogenic composition according to any one of subsections 13-19 and 24-64 in the preparation of a pharmaceutical product for use in a manner that induces an immune response to PCV2 in a subject. 95. The use described in any one of paragraphs 92 to 94, wherein the immune response is a protective immune response. 96. Use of an immunogenic composition according to any one of sub-sub 97. The aforementioned viral infection, - Viral antigen, or - Amino acid sequence of the antigenic determinant of the viral antigen The use described in paragraph 96 is an infection by a virus of a species having a genome that encodes the following: 98. Use of an immunogenic composition according to any one of subsections 13-19 and 24-64 in the preparation of a pharmaceutical product for use in reducing one or more clinical signs, viral load and / or viremia caused by PCV2 infection in a subject. 99. An immunogenic composition as described in any one of the items 68 to 75, a method as described in any one of the items 76 to 82, or a use as described in any one of the items 92 to 98, wherein the immunogenic composition is administered orally to a subject. 100. An immunogenic composition as described in any one of sections 68 to 75, a method as described in any one of sections 76 to 82, or a use as described in any one of sections 92 to 98, wherein the immunogenic composition is administered mucosally to a target. 101. An immunogenic composition as administered within a prime-boost dose as a booster to a subject, as described in any one of the immunogenic compositions described in any one of the sections 68 to 75, as described in any one of the sections 76 to 82, or as described in any one of the sections 92 to 98. 102. The immunogenic composition described in item 101, the method described in item 101, or the use described in item 101, wherein the subject is first stimulated by administration of an immunogenic composition that does not contain a gel composition containing a fragrance. 103. An immunogenic composition according to any one of sections 68-75, 99, and 100, a method according to any one of sections 76-82, 99, and 100, or a use according to any one of sections 92-100, wherein the method comprises the step of administering only one dose of the immunogenic composition to the target. 104. The method according to any one of items 83 to 91, wherein the immunogenic composition is placed only once in the target rearing environment. 105. An immunogenic composition according to any one of paragraphs 69-75, 99, 100, and 103, a method according to any one of paragraphs 76-91, 99, 100, 103, and 104, or a use according to any one of paragraphs 92-100 and 103, wherein the subject is not previously vaccinated with a vaccine against a virus of a species having a genome encoding the antigenic determinant of the viral antigen. 106. An immunogenic composition as described in any one of paragraphs 69-75, 99, 100, 103, and 105, a method as described in any one of paragraphs 76-91, 99, 100, and 103-105, or a use as described in any one of paragraphs 92-100, 103, and 105, wherein the subject is a PCV2 vaccine-naive subject. 107. - The aforementioned immune response, or - The aforementioned reduction in one or more clinical signs, viral load, and / or viremia caused by viral infection in the subject. However, the immunogenic compositions described in any one of claims 69-75, 99, 100, 103, 105, and 106, obtained by administration of the immunogenic composition, the method described in any one of claims 76-91, 99, 100, and 103-106, or the use described in any one of claims 92-100, 103, 105, and 106. 108. - The aforementioned immune response, or - The aforementioned reduction in one or more clinical signs, viral load, and / or viremia caused by viral infection in the subject. An immunogenic composition according to any one of claims 69-75, 99, 100, 103, and 105-107, a method according to any one of claims 76-91, 99, 100, and 103-107, or a use according to any one of claims 92-100, 103, and 105-107, obtained without further administration of a vaccine to the subject against a virus of a species having a genome encoding an antigenic determinant of the viral antigen contained in the immunogenic composition. 109. An immunogenic composition described in any one of subheadings 69-75, 99-103, and 105-108, a method described in any one of subheadings 76-91, and 99-108, or a use described in any one of subheadings 92-103, and 105-108, wherein the subject is an animal. 110. The immunogenic compositions described in subheading 109, the methods described in subheading 109, or the uses described in subheading 109, wherein the subject is a pig. 111. The immunogenic compositions described in subheading 109 or 110, the methods described in subheading 109 or 110, or the uses described in subheading 109 or 110, wherein the subject is a piglet or a sow. 112. A dose unit comprising any one of the immunogenic compositions described in any one of items 1 to 64. 113. The dose unit as described in item 112, wherein the dose unit is a hand pump backpack sprayer. 114. Use of the dosage units described in subsection 112 or 113 for placing the immunogenic composition in the target rearing environment. 115. The method according to any one of the items 82-91 and 99-111, wherein the dose unit described in item 112 or 113 is used to place the immunogenic composition into the breeding environment of the subject.
Claims
1. - Antigen compositions containing or consisting of viral antigens; and - Gel composition containing fragrance; An immunogenic composition containing [the specified substance].
2. - Antigen compositions containing or consisting of viral antigens; and - A gel composition containing one or more fragrances, which may be a gel composition suitable for oral and / or mucosal administration; and - One or more veterinary-acceptable carriers It consists of, - The immunogenic composition according to claim 1, which may consist of an adjuvant and / or at least one immunogenic substance different from the viral antigen.
3. The viral antigen - It is a viral protein; and / or - It is a non-replicating viral antigen; and / or - Can form virus-like particles; and / or - It is a viral capsid protein; and / or - Circovirus capsid protein or porcine parvovirus (PPV) capsid protein; and / or - This is the capsid protein of porcine circovirus (PCV). The immunogenic composition according to claim 1 or 2.
4. The viral antigen is the porcine circovirus type 2 (PCV2) ORF2 protein. The immunogenic composition according to any one of claims 1 to 3, wherein the PCV2 ORF2 protein comprises, or may consist of, an amino acid sequence having at least 90%, preferably at least 95%, more preferably at least 98%, even more preferably at least 99%, or particularly 100% sequence identity with the sequence of SEQ ID NO:
1.
5. The antigen composition is At least 10 μg of viral antigen per dose of the immunogenic composition, or At least 15 μg of viral antigen per dose of the immunogenic composition, or At least 30 μg of viral antigen per dose of the immunogenic composition, or At least 50 μg of viral antigen per dose of the immunogenic composition, or At least 100 μg of viral antigen per dose of the immunogenic composition, or At least 150 μg of viral antigen per dose of the immunogenic composition, or At least 200 μg of viral antigen per dose of the immunogenic composition, or At least 250 μg of viral antigen per dose of the immunogenic composition An immunogenic composition according to any one of claims 1 to 4, comprising:
6. The immunogenic composition according to any one of claims 1 to 5, wherein the gel composition contains water and / or the gel composition is a hydrogel composition.
7. The immunogenic composition according to any one of claims 1 to 6, wherein the gel composition comprises at least one adhesion enhancer, and the at least one adhesion enhancer is preferably selected from the group consisting of maltodextrin, hemicellulose extract, hemicellulose, xanthan gum, guar, pectin, gum, guar derivative, chitosan, dextran, carrageenan, starch, polyethylene glycol, albumin, cellulose ether, hyaluronic acid, carboxymethyl hydroxyethylcellulose, hydroxypropyl methylcellulose (HPMC), hydroxypropylcellulose (HPC), hydroxyethylcellulose (HEC), carboxymethylcellulose (CMC), gelatin, vinyl acetate, polyvinylpyrrolidone, polyvinylpyrrolidone-vinyl acetate copolymer, polyvinyl alcohol, polyphosphoester, N-(2-hydroxypropyl) methacrylamide (HPMA) copolymer, polyacrylic acid, polyacrylamide, polyoxazoline, divinyl ether maleic anhydride, and polyphosphazene, and comprises derivatives, substitutions, and combinations thereof.
8. The gel composition is - Maltodextrin; and / or - Hemicellulose extract; and / or - Xanthan gum; and / or - One or more pharmaceutically acceptable carriers The immunogenic composition according to any one of claims 1 to 7, comprising, wherein one or more pharmaceutically acceptable carriers are preferably selected from the group consisting of propylene glycol (PG), propylene glycol monolaurate (PGML), propylene glycol caprylic acid, polyethylene glycol monolaurate (PEGML), glycerol monolaurate (GML), methylformamide (DMF), allantoin, urazole, N,N-dimethylacetamide (DMA), dimethyl sulfoxide (DMSO), decylmethyl sulfoxide, lecithin, polyoxylglycerides, 1-substituted azacycloheptan-2-one, particularly 1-n-dodecylcyclazacycloheptan-2-one, alcohol, and oils safe for consumption by pigs, such as vegetable oils.
9. The gel composition comprises one or more colorants, and in particular, one or more colorants that can attract pigs. One or more colorants are preferably selected from the group consisting of pigments, dyes, and combinations thereof. The immunogenic composition according to any one of claims 1 to 8, wherein the and / or one or more colorants are preferably selected from the group consisting of FD&C Blue No. 1, FD&C Blue No. 2, FD&C Green No. 3, Orange B, Citrus FD&C Red No. 2, FD&C Red No. 2, FD&C Red No. 3, FD&C Red No. 40, FD&C Yellow No. 5, and FD&C Yellow No.
6.
10. The gel composition comprises one or more fragrances, Preferably, one or more fragrances can attract pigs. The immunogenic composition according to any one of claims 1 to 9, wherein the and / or one or more flavorings are preferably selected from the group consisting of sucrose, glucose, sodium saccharin, sodium cyclamate, xylitol, perillartin, sucralose, D-tryptophan, aspartame, dihydrochalcone, artificial fruit flavors (e.g., strawberry flavor), plasma proteins (e.g., spray-dried plasma proteins), cheese and cheese-like flavors, powdered milk, chocolate and chocolate by-products.
11. The gel composition is - water, - Maltodextrin, - Propylene glycol, - Hemicellulose extract, - One or more types of colorants, and - One or more types of fragrances An immunogenic composition according to any one of claims 1 to 10, comprising or consisting of the following.
12. It is a liquid or a solid, and / or It is viscous and / or An immunogenic composition according to any one of claims 1 to 11, having a viscosity of at least 50 mPa·seconds or at least 50 cP.
13. An immunogenic composition according to any one of claims 1 to 12 for use as a pharmaceutical, particularly as a vaccine.
14. A method for inducing an immune response in a subject, The aforementioned immune response may be an immune response against a virus. and / or the immune response is preferably, - The aforementioned viral antigen, or - Amino acid sequence of the antigenic determinant of the aforementioned viral antigen An immune response to viruses of species that have a genome encoding, An immunogenic composition according to any one of claims 1 to 12 for use in a method.
15. A method for reducing one or more clinical signs, viral load, and / or viremia caused by viral infection in a subject, The aforementioned viral infection is preferably, - The aforementioned viral antigen, or - Amino acid sequence of the antigenic determinant of the aforementioned viral antigen It is an infection caused by a virus from a species that has a genome that codes for the following: An immunogenic composition according to any one of claims 1 to 12 for use in a method.
16. The immunogenic composition according to claim 4 for use in a manner that induces an immune response to PCV2 in a subject, and / or for use in a manner that reduces one or more clinical signs, viral load and / or viremia caused by PCV2 infection in a subject.
17. A method for inducing an immune response in a subject, comprising the step of administering an effective amount of the immunogenic composition described in any one of claims 1 to 12 to the subject, The aforementioned immune response to the virus is preferably, - The aforementioned viral antigen, or - Amino acid sequence of the antigenic determinant of the aforementioned viral antigen A method that is an immune response to a virus of a species having a genome that codes for [something].
18. A method for inducing an immune response to PCV2 in a subject, comprising the step of administering an effective amount of the immunogenic composition according to claim 4 to the subject.
19. A method for reducing one or more clinical signs, viral load, and / or viremia caused by a viral infection in a subject, comprising the step of administering an effective amount of the immunogenic composition described in any one of claims 1 to 12 to the subject. The aforementioned viral infection is preferably, - The aforementioned viral antigen, or - Amino acid sequence of the antigenic determinant of the aforementioned viral antigen A method of infection by a virus of a species that has a genome that codes for [something].
20. A method for reducing one or more clinical signs, viral load, and / or viremia caused by PCV2 infection in a subject, comprising the step of administering an effective amount of the immunogenic composition according to claim 4 to the subject.
21. A method for inducing an immune response in a subject, - The step of placing the immunogenic composition according to any one of claims 1 to 12 into the target rearing environment, - Step of self-administering an immunogenic composition to the target. Includes, The aforementioned immune response to the virus is preferably, - The aforementioned viral antigen, or - Amino acid sequence of the antigenic determinant of the aforementioned viral antigen A method that is an immune response to a virus of a species having a genome that codes for [something].
22. The method according to claim 21, wherein the immune response is an immune response to PCV2 in a subject, and the immunogenic composition is the immunogenic composition according to claim 4.
23. An immunogenic composition for use according to claim 14 or 16, wherein the immune response is a protective immune response, or the method according to any one of claims 17, 18, 21, and 22.
24. A method for reducing one or more clinical signs, viral load, and / or viremia caused by viral infection in a subject, - The step of placing the immunogenic composition according to any one of claims 1 to 12 into the target rearing environment, - Step of self-administering an immunogenic composition to the target. The virus infection is preferably, - The aforementioned viral antigen, or - Amino acid sequence of the antigenic determinant of the aforementioned viral antigen A method of infection by a virus of a species that has a genome that codes for [something].
25. A method for reducing one or more clinical signs, viral load, and / or viremia caused by PCV2 infection in a subject, - The step of placing the immunogenic composition described in claim 4 into the target rearing environment, and - Step of self-administering an immunogenic composition to the target. A method that includes this.
26. The immunogenic composition is placed on the floor of the target rearing environment. The method according to any one of claims 21 to 25, wherein the immunogenic composition is placed in a bowl or vessel that is placed in the breeding environment of the subject.
27. The target is, - Animals, and / or - Pigs, and / or - Piglet or sow An immunogenic composition for use in the method according to any one of claims 14 to 16 and 23, or the method according to any one of claims 17 to 26.
28. A dose unit comprising the immunogenic composition according to any one of claims 1 to 12, wherein the dose unit may be a hand pump backpack sprayer.
29. The use of the dosage unit according to claim 28 for placing the immunogenic composition in the target rearing environment.
30. The method according to any one of claims 21 to 27, wherein the administration unit according to claim 28 is used to place the immunogenic composition in the target rearing environment.