Multispecific antibodies and uses thereof

WO2025157223A1PCT designated stage expired Publication Date: 2025-07-31WUXI BIOLOGICS (SHANGHAI) CO LTD +1
View PDF 5 Cites 0 Cited by

Patent Information

Application Number
PCT/CN2025/074329
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-01-23
Filing Date
2025-01-23
Publication Date
2025-07-31

Smart Images

  • Figure PCTCN2025074329-FTAPPB-I100001
    Figure PCTCN2025074329-FTAPPB-I100001
  • Figure PCTCN2025074329-FTAPPB-I100002
    Figure PCTCN2025074329-FTAPPB-I100002
  • Figure PCTCN2025074329-FTAPPB-I100003
    Figure PCTCN2025074329-FTAPPB-I100003
Patent Text Reader

Abstract

Provided in the present disclosure are multispecific antibodies, the nucleic acid molecules encoding the same, expression vectors and host cells used for the expression of the multispecific antibodies. The disclosure further provides the methods for preventing and treating cancers by administering the multispecific antibodies.
Need to check novelty before this filing date? Find Prior Art

Description

MULTISPECIFIC ANTIBODIES AND USES THEREOFCROSS-REFERENCEThis application claims priority to International Patent Application PCT / CN2024 / 073605, filed January 23, 2024, the entire contents of which are incorporated herein by reference.SEQUENCE LISTINGThe instant application contains a sequence listing which has been submitted electronically and is hereby incorporated by reference in its entirety.FIELDThis application generally relates to antibodies. More specifically, the application relates to multi-specific antibodies and polypeptide complexes, a method of preparing the same, and uses thereof.BACKGROUNDMonospecific antibodies are not optimal for many therapeutic applications, which has led to the design of a vast number of unique multispecific antibody formats that enable targeting of multiple antigens or multiple epitopes on the same antigen. Multispecific antibody may be used as a flexible platform that offers a way to deliver precise combinations of immunomodulatory signals (for example, a co-stimulatory signal and a checkpoint blocker) specifically in the tumor micro-environment, which might be safer and more effective than the systemic administration of combinations of individual, single-specificity immunomodulatory antibodies.A variety of trispecific antibodies have been developed. Wu et al. reported the development of a trispecific antibody against three targets: a cancer cell, a receptor that activates T cells, and a T-cell protein that promotes long-lasting T-cell activity against the cancer cell (Wu L, Seung E, Xu L, et al. Trispecific antibodies enhance the therapeutic efficacy of tumor-directed T cells through T cell receptor co-stimulation. Nat Can. 2020; 1 (1) : 86-98) . SAR441236, which targets three epitopes on HIV envelope, and SAR442257, which targets CD3, CD28 and CD38, have been developed by Sanofi and are in clinical trials.Despite the diversity of multispecific antibody formats, a common challenge in generating multispecific antibodies is that they display suboptimal physical and chemical properties relative to conventional IgGs and are more difficult to develop into therapeutics. Because many multispecific antibodies are composed of recombined antibody fragments, stabilization of the individual fragments is a common problem of multispecific design strategies. Particularly for Fab-based multispecific antibodies, addressing mispairing issue arising from multiple light chains demands significant engineering efforts. Such engineering is difficult to balance with other properties of the molecule, such as stability, solubility, affinity, immunogenicity, etc. These properties will greatly impact the desired efficacy, development cost, timeline, and potential toxicities in clinical trials. Achieving the self-assembly of different Fab fragments into a fully functional multispecific antibody without compromising other critical attributes requires a delicate and complex process.Thus, there is a great need to design a universal multispecific platform that can accommodate different Fab fragments, while ensuring desirable expression level, stability, affinity to antigens and / or PK profiles. The present disclosure describes multispecific polypeptide complexes with one or more desired properties.SUMMARYThese and other objectives are provided for by the present disclosure which, in a broad sense, is directed to compounds, methods, compositions and articles of manufacture that provide antibodies with improved efficacy. The benefits provided by the present disclosure are broadly applicable in the field of antibody therapeutics and diagnostics. Specifically, the disclosure provides the design of a platform for generating multispecific antibodies with drug-like properties, including favorable stability, solubility, specificity, pharmacokinetic properties and / or tumor inhibition abilities. The platform can easily be utilized for constructing and engineering of multi-specific (especially trispecific) antibodies with desired antigen targeting specificities.In one aspect, provided herein is a polypeptide complex or antigen-binding portion thereof, comprising a first antigen-binding moiety, a second antigen-binding moiety, and a third antigen-binding moiety. In some embodiments, the antigen-binding moieties are in a Fab format or other suitable formats as disclosed herein. In some embodiments, the first and the second antigen-binding moieties are chimeric Fabs that have exchanged the CH1 and CL constant regions for, e.g., a pair of T cell receptor (TCR) constant regions which are capable of forming a dimer via their interchain bonds and interactions. The interchain bonds between the pair of T cell receptor (TCR) constant regions can be native or engineered.In some embodiments, the polypeptide complex or antigen-binding portion thereof comprises a first antigen-binding moiety, a second antigen-binding moiety, and a third antigen-binding moiety, wherein:the first antigen-binding moiety comprises, from N-terminus to C-terminus, a first heavy chain variable domain (VH1) operably linked to a first T cell receptor (TCR) constant (C1) region (VH1-C1) in one polypeptide chain, and a first light chain variable domain (VL1) operably linked to a second TCR constant (C2) region (VL1-C2) in another polypeptide chain,the second antigen-binding moiety comprises, from N-terminus to C-terminus, a second heavy chain variable domain (VH2) operably linked to a C1 region (VH2-C1) in one polypeptide chain, and a second light chain variable domain (VL2) operably linked to a C2 region (VL2-C2) in another polypeptide chain,wherein:the C1 region comprises an engineered Cβ and the C2 region comprises an engineered Cα, or the C1 region comprises an engineered Cα and the C2 region comprises an engineered Cβ,the engineered Cβ and Cα are capable of forming a dimer via their interchain bonds and interactions,wherein the VH1-C1 of the first antigen-binding moiety and the VH2-C1 of the second antigen-binding moiety are in separate polypeptide chains, i.e., not in the same polypeptide chain.In some embodiments, the third antigen-binding moiety is an antigen-binding moiety selected from a variable domain, a variable region, a diabody, a Fab, a Fab', a F (ab') 2, an Fv fragment, a single chain Fv fragment (scFv) , a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2, a bispecific dsFv (dsFv-dsFv') , a disulfide stabilized diabody (ds diabody) , a multispecific antibody, a camelized single domain antibody, a single variable domain (i.e. VHH) , a nanobody, a domain antibody, and a bivalent domain antibody.In some embodiments, all three antigen-binding moieties are in Fab format. In some embodiments, the first and the second antigen-binding moieties are chimeric Fabs that have exchanged the CH1 and CL constant regions for, e.g., a pair of T cell receptor (TCR) constant regions which are capable of forming a dimer via their interchain bonds and interactions. In some embodiments, the polypeptide complex or antigen-binding portion thereof comprises a first antigen-binding moiety, a second antigen-binding moiety, and a third antigen-binding moiety, wherein:the first antigen-binding moiety comprises, from N-terminus to C-terminus, a first heavy chain variable domain (VH1) operably linked to a first T cell receptor (TCR) constant (C1) region (VH1-C1) in one polypeptide chain, and a first light chain variable domain (VL1) operably linked to a second TCR constant (C2) region (VL1-C2) in another polypeptide chain,the second antigen-binding moiety comprises, from N-terminus to C-terminus, a second heavy chain variable domain (VH2) operably linked to a C1 region (VH2-C1) in one polypeptide chain, and a second light chain variable domain (VL2) operably linked to a C2 region (VL2-C2) in another polypeptide chain,the third antigen-binding moiety comprises, from N-terminus to C-terminus, a third heavy chain variable domain (VH3) operably linked to a CH1 constant region (VH3-CH1) , and a third light chain variable domain (VL3) operably linked to a CL constant region (VL3-CL) ,wherein:the C1 region comprises an engineered Cβ and the C2 region comprises an engineered Cα, or the C1 region comprises an engineered Cα and the C2 region comprises an engineered Cβ,the engineered Cβ and Cα are capable of forming a dimer via their interchain bonds and interactions,wherein the VH1-C1 of the first antigen-binding moiety and the VH2-C1 of the second antigen-binding moiety are in separate polypeptide chains, i.e. not in the same polypeptide chain.In some embodiments, the polypeptide complex comprises a heavy chain that comprises an Fc domain.In some embodiments, the polypeptide complex comprises two heavy chains each comprising an Fc domain that holds the two heavy chains together,wherein the VH1-C1 of the first antigen-binding moiety is in a heavy chain and the VH2-C1 of the second antigen-binding moiety is in a light chain, or the VH1-C1 of the first antigen-binding moiety is in a light chain and the VH2-C1 of the second antigen-binding moiety is in a heavy chain. The “” heavy chain” and “light chain” in this context is illustrated in Figure 1. For example, the clause “the VH1-C1 of the first antigen-binding moiety is in a heavy chain” means that the “VH1-C1” is operably linked to a variable domain or a constant domain either at the N-terminus of the C-terminus of the “VH1-C1. ” The clause “the VH2-C1 of the second antigen-binding moiety is in a light chain” means that “the VH2-C1” is not operably linked to a variable domain or a constant domain.In some specific embodiments, the polypeptide complex comprises two heavy chains and three light chains, wherein from N terminus to C terminus, the first heavy chain (HC1) , the second heavy chain (HC2) , the first light chain (LC1) , the second light chain (LC2) and the third light chain (LC3) comprise domains operably linked into the following formats, respectively:(a) VH1-C1-VL2-C2-Fc, VH3-CH1-Fc, VL1-C2, VH2-C1, VL3-CL;(b) VL1-C2-VH2-C1-Fc, VH3-CH1-Fc, VH1-C1, VL2-C2, VL3-CL;(c) VH3-CH1-VH2-C1-Fc, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL;(d) VH3-CH1-VL2-C2-Fc, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL;(e) VH2-C1-VH3-CH1-Fc, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL;(f) VL2-C2-VH3-CH1-Fc, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL;(g) VH3-CH1-Fc-VL2-C2, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL; or(h) VH3-CH1-Fc-VH2-C1, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL.In some specific embodiments, the polypeptide complex comprises two heavy chains and four light chains, wherein from N terminus to C terminus, the first heavy chain (HC1) , the second heavy chain (HC2) , the first light chain (LC1) , the second light chain (LC2) , the third light chain (LC3) and the fourth light chain (LC4) comprise domains operably linked into the following formats, respectively:(j) VH3-CH1-VH2-C1-Fc, VL1-C2-VH2-C1-Fc, VH1-C1, VL2-C2, VL3-CL, VL2-C2;(k) VL2-C2-VH1-C1-Fc, VH3-CH1-VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL, VL1-C2; or(l) VH2-C1-Fc-VL1-C2, VH3-CH1-Fc-VL1-C2, VH1-C1, VL2-C2, VL3-CL, VH1-C1.In some other embodiments, the polypeptide complex comprises the first antigen-binding moiety, the second antigen-binding moiety and the third antigen-binding moiety which are operably linked with each other via one polypeptide chain, wherein the VH1-C1 of the first antigen-binding moiety and the VH2-C1 of the second antigen-binding moiety are in separate polypeptide chains, i.e. not in the same polypeptide chain (see, e.g., Figure 1A, formats i and m) . For example, the VH3-CH1 of the third antigen-binding moiety is operably linked to the VH1-C1 of the first antigen-binding moiety, and the VH1-C1 of the first antigen-binding moiety is operably linked to the VL2-C2 of the second antigen-binding moiety; or the VH3-CH1 of the third antigen-binding moiety is operably linked to the VL1-C2 of the first antigen-binding moiety, and the VL1-C2 of the first antigen-binding moiety is operably linked to the VH2-C1 of the second antigen-binding moiety.In some specific embodiments, the polypeptide complex comprises four chains, the second chain, the third chain and the fourth chain are shorter than and associated with the first chain, wherein from N terminus to C terminus, the first chain, the second chain, the third chain and the fourth chain comprise domains operably linked into the following formats, respectively:(i) VH3-CH1-VH1-C1-VL2-C2, VL3-CL, VL1-C2, VH2-C1; or(m) VH3-CH1-VL1-C2-VH2-C1, VL3-CL, VH1-C1, VL2-C2.In some embodiments, the first, second and three antigen-binding moieties have different antigen-binding specificities. For example, they may bind to three different antigens, or to three different epitopes on the same antigen, or to a first antigen and two epitopes on a second antigen.The C1 region of the first antigen-binding moiety may be same as or different from the C1 region of the second antigen-binding moiety. Similarly, the C2 region of the first antigen-binding moiety may be same as or different from the C2 region of the second antigen-binding moiety. In some embodiments, the C1 and C2 regions of the first antigen-binding moiety are at least 90%, 95%or 100%identical to the C1 and C2 regions of the second antigen-binding moiety, respectively.In some embodiments, the Cα and Cβ comprised in the polypeptide complex are engineered to comprise one or more non-native interchain disulfide bond (s) that improves the stability of the interface between Cα and Cβ.In some embodiments, the engineered Cβ comprises the amino acid sequence of SEQ ID NO: 34 or an amino acid sequence with at least 85%, 90%, or 95%identity to SEQ ID NO: 34, and the engineered Cα comprises the amino acid sequence of SEQ ID NO: 35 or an amino acid sequence with at least 85%, 90%, or 95%identity to SEQ ID NO: 35.As described above, operably linked is via a direct linkage or via a peptide linker, e.g. a peptide linker comprising 1-40 amino acids in length. In some embodiments, the peptide linker is an immunoglobulin partial or whole hinge region or a GS linker, for example (GS) n, (GGS) n, (GGGS) n, (GGGGS) n, (GGSG) n, (GGGSS) n, wherein n is an integer of 1-9.In some embodiments, the Fc region is a human IgG Fc, such as a human IgG1, IgG2, IgG3 or IgG4 Fc, or an Fc variant. In some embodiments, the Fc variant comprises one or more substitutions selected from “knob into hole” substitutions, F234A / L235A, S228P, M252Y / S254T / T256E and combinations thereof.In some embodiments, each antigen-binding moiety specifically binds to an antigen selected from an exogenous antigen, an endogenous antigen, an autoantigen, a neoantigen, a viral antigen, a tumor associated antigen, immune checkpoint molecules, tumor microenvironment targets, autoimmune and inflammatory diseases associated target.In some embodiments, one of the antigen-binding moieties specifically binds to a T-cell specific receptor molecule and / or a natural killer cell (NK cell) specific receptor molecule, and another antigen-binding moiety specifically binds to a tumor associated antigen. In some embodiments, the three antigen-binding moieties bind to a tumor associated antigen, a receptor that activates T cells, and a T-cell protein that stimulates T-cell activity against tumors, respectively.In some embodiments, the antigen-binding moiety as disclosed herein specifically binds to an antigen selected from PD-1, PD-L1, PD-L2, CTLA-4, LAG3, TIM-3, TIM4, 4-1BB, OX-40, OX-40L, GITR, A2aR, TIGIT, CD96, PVRIG, CD226, 5T4, VISTA, VSIG3, VSIG4, ICOS, CD28, CD3, CD4, CD8, CD45, CD44v6, CD27, CD47, SIRPAα, SLAMF7, CD24, Siglec10, Siglec15, Siglec8, VSIR, VSIG4, PSGL-1, C5AR1, BTN1A1, BTN3A1, CD70, RANKL, CSF1R, CSF2RB, TNFRSF1 / 1a / 1b, BDCA2, BTLA, C5aR, NKG2A, NKG2D, NKp30, NKp46, CD16a, CD56, CD166, FCGR3, CD2, Neuropilin-1, CCR8, CCR2, CCR4, CCR5, CCR6, CCR7, CCR8, GCGR, CXCR2, CXCR4, CXCR5, CALCRL, ETAR, GLP1R, CX3CR1, GPR1, GPR17, GPR20, GPR30, GPR34, GPR-65, GPCR78, GPRC5D, GPR84, LGR4, LGR5, VEGF, VEGFR, HER2, HER3, Trop2, pCAD, ERα, EGFR, de2-7 EGFR, EGFRvIII, PSMA, PSCA, PSA, TAG-72, SEZ6, SEZ6L, SEZ6L2, SEMA4D, DLL3, GD2, GPC3, KLB, KLRB1, KLRG1, GPC1, PCSK9, EpCAM, p-Cadherin, Caludin 6, Caludin 18.2, FGFR2b, FGFR3, FGFR4, MUC1, MUC13, MUC16, MUC17, MUCL3, FolRa, TfR, TF, TFR, TFPI, c-Met, NY-ESO-1, GUCY2C, LIV-1, Integrin αvβ6, Integrin α10β1, Intergrin α3, Integrin α5β4, Integrin αvβ3, Integrin αvβ8, ROR1, ROR2, PRLR, PTK7, B7-H3, Nectin-4, NetG1, Ax1, CD147, LRRC15, Napi2b, STEAP1, LY6G6D, LYPD1, MACRO, MerTK, MICA, MICB, MSLN, Mkars, G12D, CDH3, CDH6, CDH17, APLA2, CAIX, CD46, CD47, CLDN6, EphA3, Fucosyl-GM1, ITGA3, Kallikrein, MISRII, Podocalyxin, RON, ROBO1, PAUF, PLA2, PRLR, PTK7, TM4SF1, TMEFF2, TREAKR, TREM-1, TREM-2, uPARAP, TYRP1, KAAG1, RU2AS, CD146, CD63, Endoglin, Globo H, IGF-1R, TEM1, TEM8, TAX1BP3, ADAM-9, ENPP3, EphA2, EphA3, FcRH5, NaPi3b, TWEAK, DLK1, SORT1, SSTR2, STEAP1, CD25, CD39, GARP, LRRC33, LAIR1, LAMP3, LAP, LEPR, LILRB1, LILRB2, LILRB4, RAGE, FGL1, TPBG, PDGFRB, TGFBR2, CEACAM1, CEACAM5, CEACAM6, Carcinoembryonic antigen (CEA) , ICAM1, A33, CAMPATH-1 (CDw52) , Carboanhydrase IX (MN / CA IX) , CD248, PDPN, ITGB1, ITGAV, CD20, CD19, CD21, CD22, CLL, BCMA, DCLK1, DDR1, DLK1, DPEP3, DKK1, CD5, CD13, CD30, CD33, CD34, CD36, CD37, CD38, CD43, CD52, CD55, CD94, CD99, CD7, CD71, CD73, CD74, CD79a, CD79b, CD229, CD132, CD133, G250, CSF1R (CD115) , HLA-DR, HLA-G, HTRA1, TRA-1-60, IGFR, IL-2 receptor, MCSP (Melanoma-associated cell surface chondroitin sulphate proteoglycane) , ART1, ASGR1, B7H3, B7-H4, B7H6, CD124, c-Kit (CD117) , CD7, Clex12A, Clever-1, IL-13RA2, IL-11RA, IL-31RA, IL-4RA, IFNAR, ActRIIb, IL-7R, SLAMF7, Fms-like tyrosine kinase 3 (FLT-3, CD135) , GFRA1, BTLA, GloboH, CSF2RB, chondroitin sulfate proteoglycan 4 (CSPG4, melanoma-associated chondroitin sulfate proteoglycan) , ITGA4, Clec5a, Clec7a, Clec9a, Clec12a, CLEC14, CD205, CD206, CD200R1, CD228, CD229, CD40, CD40L, FcRn, TLR8, TLR9, TNFR2, LTBR, CD44, CD93, PDGF, PDGFR-alpha (CD140a) , PDGFR-beta (CD140b) , CD146, CD147, CRTH2, TNF-α, TGF-β, IL1RAcP, TSLP, DR5, ST2, fibroblast activating protein (FAP) , CDCP1, Derlin1, Tenascin, frizzled 1-10, the vascular antigens VEGFR2 (KDR / FLK1) , VEGFR3 (FLT4, CD309) , Endoglin, Tie2 and other TAAs, I / O checkpoints, tumor microenvironment targets, as well as autoimmune and inflammatory diseases associated targets.In some embodiments, at least one of the antigen-binding moieties binds to CD3. In some embodiments, the polypeptide complex or antigen-binding portion thereof comprises three antigen-binding moieties that bind to CD19, CD3 or CD20, respectively. In some embodiments, the first, second and third antigen-binding moieties are the CD19 binding moiety, the CD3 binding moiety and the CD20 binding moiety, respectively.Thus, the present disclosure provides multispecific antibodies or polypeptide complexes that bind CD3, CD19 and CD20 and multi-specific antigen-binding portion thereof. The CD3, CD19 and CD20 antigens may be derived from human, mouse or cynomolgus monkey. In some embodiments, the multi-specific antibody or antigen-binding fragment is a trispecific polypeptide complex ( “CD3 x CD19 x CD20 trispecific antibody” ) or trispecific antigen-binding portion thereof.In some embodiments, the polypeptide complex or antigen-binding portion thereof as disclosed herein comprises:a CD19 binding moiety comprising one, two or all three heavy chain complementarity determining regions (HCDRs) of the VH region as set forth in SEQ ID NO: 19, and one, two or all three light chain complementarity determining regions (LCDRs) of the VL region as set forth in SEQ ID NO: 20, respectively;a CD3 binding moiety comprising one, two or all three HCDRs of the VH region as set forth in SEQ ID NO: 21, and one, two or all three LCDRs of the VL region as set forth in SEQ ID NO: 22, respectively; anda CD20 binding moiety comprising one, two or all three HCDRs of the VH region as set forth in SEQ ID NO: 23, and one, two or all three LCDRs of the VL region as set forth in SEQ ID NO: 24, respectively.In some embodiments, the polypeptide complex or antigen-binding portion thereof as disclosed herein comprises:a CD19 binding moiety comprising a heavy chain complementarity determining region (HCDR) 1, a HCDR2 and a HCDR3 comprising the amino acid sequence of SEQ ID NOs: 1, 2 and 3, respectively, a light chain complementarity determining region (LCDR) 1, a LCDR2 and a LCDR3 comprising the amino acid sequence of SEQ ID NOs: 4, 5 and 6, respectively;a CD3 binding moiety comprising a HCDR1, a HCDR2 and a HCDR3 comprising the amino acid sequence of SEQ ID NO: 7, 8 and 9, respectively, a LCDR1, a LCDR2 and a LCDR3 comprising the amino acid sequence of SEQ ID NOs: 10, 11 and 12, respectively; anda CD20 binding moiety comprising a HCDR1, a HCDR2 and a HCDR3 comprising the amino acid sequence of SEQ ID NOs: 13, 14 and 15, respectively, a LCDR1, a LCDR2 and a LCDR3 comprising the amino acid sequence of SEQ ID NOs: 16, 17 and 18, respectively.In some embodiments, the CD19 binding moiety comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 19 or an amino acid sequence at least 85%, 90%or 95%identical to SEQ ID NO: 19, and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 20 or an amino acid sequence at least 85%, 90%or 95%identical to SEQ ID NO: 20. Preferably, the amino acid sequence at least 85%, 90%or 95%identical to SEQ ID NO: 19 or 20 have the same CDRs and only differ from SEQ ID NO: 19 or 20 in the framework regions.In some embodiments, the CD3 binding moiety comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 21 or an amino acid sequence at least 85%, 90%or 95%identical to SEQ ID NO: 21, and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 22 or an amino acid sequence at least 85%, 90%or 95%identical to SEQ ID NO: 22. Preferably, the amino acid sequence at least 85%, 90%or 95%identical to SEQ ID NO: 21 or 22 have the same CDRs and only differ from SEQ ID NO: 21 or 22 in the framework regions.In some embodiments, the CD20 binding moiety comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 23 or an amino acid sequence at least 85%, 90%or 95%identical to SEQ ID NO: 23, and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 24 or an amino acid sequence at least 85%, 90%or 95%identical to SEQ ID NO: 24. Preferably, the amino acid sequence at least 85%, 90%or 95%identical to SEQ ID NO: 23 or 24 have the same CDRs and only differ from SEQ ID NO: 23 or 24 in the framework regions.In some embodiments, the polypeptide complex or antigen-binding portion thereof as disclosed herein comprises two binding arms, wherein:(a) the first binding arm comprises the CD19 binding moiety operably linked to the CD3 binding moiety, and the second binding arm comprises the CD20 binding moiety;(b) the first binding arm comprises the CD19 binding moiety operably linked to the CD20 binding moiety, and the second binding arm comprises the CD3 binding moiety; or(c) the first binding arm comprises the CD20 binding moiety operably linked to the CD3 binding moiety, and the second binding arm comprises the CD19 binding moiety.In some embodiments, the polypeptide complex comprises a first and a second heavy chain that comprise SEQ ID NOs: 25 and 26 respectively, and a first, second and third light chain that comprise SEQ ID NOs: 27, 28 and 29 respectively.In some embodiments, the polypeptide complex is a chimeric antibody, a humanized antibody or a fully human antibody.In one aspect, provided herein is a nucleic acid molecule, comprising a nucleic acid sequence encoding the heavy chain (s) and / or the light chain (s) of the polypeptide complex or antigen-binding portion thereof as disclosed herein.In one aspect, provided herein is a vector comprising the nucleic acid molecule as disclosed herein.In one aspect, provided herein is a host cell comprising the nucleic acid molecule or the vector as disclosed herein.In one aspect, provided herein is a pharmaceutical composition comprising the polypeptide complex or antigen-binding portion thereof as disclosed herein and a pharmaceutically acceptable carrier.In one aspect, provided herein is a method for producing the polypeptide complex or antigen-binding portion thereof as disclosed herein, comprising the steps of:- culturing a host cell comprising a nucleic acid sequence (s) encoding the heavy chains and the light chains of the polypeptide complex or antigen-binding portion thereof under suitable conditions; and- isolating the polypeptide complex or antigen-binding portion thereof from the host cell.In one aspect, provided herein is a method of treating a condition in a subject in need thereof, comprising administrating to the subject a therapeutically effective amount of the polypeptide complex as disclosed herein, wherein the condition can be alleviated, eliminated, treated, or prevented when the first, second and / or third antigen / epitope are modulated. The condition includes but not limited to cancers, infectious diseases and immune diseases.In one aspect, provided herein is a method for modulating a CD19 and / or CD20 related immune response in a subject, comprising administering to the subject the polypeptide complex or antigen-binding portion thereof or the pharmaceutical composition as disclosed herein to the subject.In one aspect, provided herein is a method for inhibiting growth of tumor cells in a subject, comprising administering an effective amount of the polypeptide complex or antigen-binding portion thereof or the pharmaceutical composition as disclosed herein to the subject.In one aspect, provided herein is a method for preventing or treating cancer in a subject, comprising administering an effective amount of the polypeptide complex or antigen-binding portion thereof or the pharmaceutical composition as disclosed herein to the subject. Said cancer can be alleviated, eliminated, treated, or prevented when at least one of the antigens / epitopes are modulated. In some embodiments, said cancer may be a CD19 and / or CD20 positive cancer.In some embodiments, the cancer is selected from B cell lymphoma such as diffuse large B-cell lymphoma (DLBCL) , non-Hodgkin lymphoma, mantle cell lymphoma (MCL) , marginal zone lymphoma (MZL) , follicular lymphoma (FL) , chronic lymphocytic leukemia, Waldenstrom macroglobulinemia (WM) , B-cell chronic lymphocytic leukemia, non-T acute lymphoblastic leukemia, acute lymphoblastic leukemia (ALL) , and chronic lymphoid lymphoma.In some embodiments, the cancer is B-cell non-Hodgkin lymphoma (B-NHL) .In one aspect, provided herein is the polypeptide complex or antigen-binding portion thereof as disclosed herein for use as medicament. Further, provided herein is the polypeptide complex or antigen-binding portion thereof for use in diagnosing, treating or preventing a condition such as cancer. The condition (e.g. cancer) can be alleviated, eliminated, treated, or prevented when the antigen (s) , for example, one, two or three antigens / epitopes targeted by the polypeptide complex or antigen-binding portion thereof is / are modulated.In one aspect, provided herein is use of the polypeptide complex or antigen-binding portion thereof as disclosed herein in the manufacture of a medicament for treating or preventing a condition (e.g. cancer) , optionally the cancer is a CD19 and / or CD20 positive cancer, a HER2 / HER3 positive cancer, or a PD-1 / PD-L1 associated cancer.In one aspect, provided herein is a kit or device, wherein the kit or device comprises a container comprising the polypeptide complex or antigen-binding portion thereof as disclosed herein.The foregoing is a summary and thus contains, by necessity, simplifications, generalizations, and omissions of detail; consequently, those skilled in the art will appreciate that the summary is illustrative only and is not intended to be in any way limiting. This summary is not intended to identify key features or essential features of the claimed subject matter, nor is it intended to be used as an aid in determining the scope of the claimed subject matter.BRIEF DESCRIPTION OF THE FIGURESFigure 1A shows different formats (a, b, c, d, e, f, g, h, i, j, k, l, m) of exemplary trispecific antibodies as disclosed herein. The first, second and third antigen binding moieties are illustrated as Fab formats. The rectangular shape represents the Cα or Cβ domain (Cβ is darker in color than Cα) . Figure 1B shows an enlarged schematic representation of an exemplary trispecific antibody format comprising three antigen binding moieties that target CD19, CD20 and CD3. The CD19 binding moiety, the CD3 binding moiety and the CD20 binding moiety are exemplified in Fab formats, including chimeric Fabs comprising TCR constant domains instead of antibody constant domains fused with variable regions of an antibody. The rectangles indicate TCR constant domains, and the ovals indicate variable and constant domains of an antibody. Figure 1C shows more exemplary trispecific antibodies with different antigen binding specificities. T50, X51, U52, U53, W2, T3, W54, X55 are abbreviations of antigen binding moieties that bind to PD-1, PD-L1, EGFR, Trop2, CD20, CD3, Her 2 and Her 3, respectively. I18, PD-1, PD-L1 and EGFR binding (X51T50U52) ; I19, Her3, Trop2 and CD3 binding (U53X55T3) ; I19R, CD20, CD3 and EGFR binding (W2T3U52) ; I26, Her2, CD3 and Her3 binding (W54T3X55) ; I27, Trop2, PD-1 and Her3 binding (U53T50X55) ; I183, Trop2, PD-1 and PD-L1 binding (U53T50X51) ; I184, PD-L1, Trop2 and Her3 binding (X51U53X55) .Figures 2-3 show SDS-PAGE (Fig. 2) and analytic SEC result (Fig. 3) of purified W333021-U8T3W2. I27-61. uIgG4V9 antibody.Figures 4-8 show FACS binding result of the antibodies to Jurkat (Fig. 4) , WBP701-CHOK1-hpro1. B4 (Fig. 5) , WT1028-CHOK1-hPro1. FL. F7 (Fig. 6) , Raji (Fig. 7) , WBP701. cPro1. CHO-K1.C9 (Fig. 8, left panel) and WT1028-CHOK1-cPro1. FL. E4 (Fig. 8, right panel) cells. CD3 x CD20 (REGN1979) is the bispecific control antibody REGN1979. CD3 x CD19 (WuXi) is an internal bispecific control antibody. W333021 (mute CD19) is W333021-U0T3W2. I27-61.uIgG4V9; W333021 (mute CD20) is W333021-U8T3W0. I27-61. uIgG4V9. W333021 refers to W333021-U8T3W2. I27-61. uIgG4V9.Figure 9 shows antibody induced T lymphocytes-mediated killing on Raji and Nalm-6 cells.Figures 10-11 show antibody induced T cell activation on Raji cells (Fig. 10) and Nalm-6 cells (Fig. 11) , evaluated by the release of cytokines.Figures 12-14 show DSF (Fig. 12) , HIC-HPLC (Fig. 13) and DLS-kD (Fig. 14) results of the W333021-U8T3W2. I27-61. uIgG4V9 antibody.Figure 15 shows a concentration curve of W333021-U8T3W2. I27-61. uIgG4V9 antibody in rat plasma.Figure 16 shows a summary of tumor volume during treatment with different antibodies. Arrows indicate the dosing time. W333021 refers to W333021-U8T3W2. I27-61. uIgG4V9.Figure 17 shows body weight in control and W333021-U8T3W2. I27-61. uIgG4V9 antibody treated groups.Figure 18 shows the formats of W333021-cAb35 and W333021-cAb36 for verification of reduced mispairing.Figures 19-20 show the Mass spectrum result (Fig. 19) and SDS-PAGE (Fig. 20) of W333021-cAb35 and W333021-cAb36 formats.Figure 21 shows the characterization of W333021-X51T50U52. I18-1. uIgG4V322. Fig. 21A: SDS-PAGE and HPLC purity result; Fig. 21B: target binding result; Fig. 21C: thermal stability.Figure 22 shows the characterization of W333021-U53X55T3. I19-1. uIgG4V322. Fig. 22A: SDS-PAGE and HPLC purity result; Fig. 22B: target binding result; Fig. 22C: thermal stability.Figure 23 shows the characterization of W333021-W2T3U52. I19R-1. uIgG4V322. Fig. 23A: SDS-PAGE and HPLC purity result; Fig. 23B: target binding result; Fig. 23C: thermal stability.Figure 24 shows the characterization of W333021-W54T3X55. I26-1. uIgG4V322. Fig. 24A: SDS-PAGE and HPLC purity result; Fig. 24B: target binding result; Fig. 24C: thermal stability.Figure 25 shows the characterization of W333021-U53T50X55. I27-1. uIgG4V322. Fig. 25A: SDS-PAGE and HPLC purity result; Fig. 25B: target binding result; Fig. 25C: thermal stability.Figure 26 shows the characterization of W333021-U53T50X51. I183-1. uIgG4V322. Fig. 26A: SDS-PAGE and HPLC purity result; Fig. 26B: target binding result; Fig. 26C: thermal stability.Figure 27 shows the characterization of W333021-X51U53X55. I184-1. uIgG4V322. Fig. 27A: SDS-PAGE and HPLC purity result; Fig. 27B: target binding result; Fig. 27C: thermal stability.DETAILED DESCRIPTIONWhile the present invention may be embodied in many different forms, disclosed herein are specific illustrative embodiments thereof that exemplify the principles of the invention. It should be emphasized that the present invention is not limited to the specific embodiments illustrated. Moreover, any section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.Unless otherwise defined herein, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. More specifically, as used in this specification and the appended claims, the singular forms “a” , “an” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “aprotein” includes a plurality of proteins; reference to “a cell” includes mixtures of cells, and the like. In this application, the use of “or” means “and / or” unless stated otherwise. Furthermore, the use of the term “comprising, ” as well as other forms, such as “comprises" and “comprised, ” is not limiting. In addition, ranges provided in the specification and appended claims include both end points and all points between the end points.Generally, nomenclature used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those well-known and commonly used in the art. The methods and techniques of the present disclosure are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. See, e.g., Abbas et al., Cellular and Molecular Immunology, 6th ed., W.B. Saunders Company (2010) ; Sambrook J. &Russell D. Molecular Cloning: A Laboratory Manual, 3rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2000) ; Ausubel et al., Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, Wiley, John &Sons, Inc. (2002) ; Harlow and Lane Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N. Y. (1998) ; and Coligan et al., Short Protocols in Protein Science, Wiley, John &Sons, Inc. (2003) . The nomenclature used in connection with, and the laboratory procedures and techniques of, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well-known and commonly used in the art.DefinitionsIn order to better understand the disclosure, the definitions and explanations of the relevant terms are provided as follows.The terms “antibody” and “polypeptide complex” can be used interchangeably herein and encompass various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, humanized antibodies, fully human antibodies, chimeric antibodies, multi-specific antibodies and antibody fragments, so long as they exhibit the desired antigen-binding activity. Antibody generally comprises heavy (H) and light (L) polypeptide chains held together by covalent disulfide bonds and non-covalent interactions. Light chains of an antibody may be classified into κ and λ light chain. Heavy chains may be classified into μ, δ, γ, α and ε, which define isotypes of an antibody as IgG (e.g., IgG1, IgG2, IgG3 or IgG4 subtype) , IgA1, IgA2, IgD, IgE or IgM, respectively. For a classical antibody, each heavy chain comprises a heavy chain variable region (VH) and a heavy chain constant region (CH) , and each light chain comprises a light chain variable region (VL) and a light chain constant region (CL) . VH and VL regions can further be divided into hypervariable regions (called complementary determining regions (CDR) ) , which are interspaced by relatively conservative regions (called framework region (FR) ) . Each VH and VL consists of 3 CDRs and 4 FRs in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 from N-terminal to C-terminal. The variable region (VH and VL) of each heavy / light chain pair forms antigen binding sites, respectively. A heavy chain constant region comprises 3 domains (CH1, CH2 and CH3) . A light chain constant region comprises a CL domain. When constructing a multispecific (e.g. trispecific or bispecific) antibody, depending on the format, it is not always for the VH region to be in the heavy chain and the VL region to be in the light chain of the polypeptide complex. In some embodiments, a heavy chain of the polypeptide complex refers to the Fc comprising chain, a light chain of the polypeptide complex refers to the chain without a Fc domain which is much shorter than the heavy chain. In some embodiments, the heavy chain comprises a VH of the first antigen-binding moiety and a VL of the second antigen-binding moiety. In some embodiments, the heavy chain comprises a VL of the first antigen-binding moiety and a VH of the second antigen-binding moiety.The term “antigen-binding portion” or “antigen-binding fragment” of an antibody or polypeptide complex refers to polypeptides comprising fragments of a full-length antibody, which retain the ability of specifically binding to an antigen (s) that the full-length antibody specifically binds to, and / or compete with the full-length antibody for binding to the same antigen (s) . Generally, see Fundamental Immunology, Ch. 7 (Paul, W., ed., the second edition, Raven Press, N.Y. (1989) , incorporated herein by reference for all purposes. Antigen binding fragments of an antibody may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of an intact antibody. Under some conditions, antigen binding fragments include Fab, Fab', Fab'-SH, F (ab') 2, Fd, Fv, dAb and complementary determining region (CDR) fragments, single chain antibody (e.g. scFv) , chimeric antibody, diabody and such polypeptides that comprise at least part of antibody sufficient to confer the specific antigen binding ability on the polypeptides. Antigen binding fragments of an antibody may be obtained from a given antibody (e.g., the multi-specific anti-CD3 x CD19 x CD20 antibody provided herein) by conventional techniques known by a person skilled in the art (e.g., recombinant DNA technique or enzymatic or chemical cleavage methods) , and may be screened for specificity in the same manner by which intact antibodies are screened.The term “antigen-binding moiety” as used herein refers to an antibody fragment formed from a portion of an antibody comprising one or more CDRs, or any other antibody fragment that binds to an antigen but does not comprise an intact native antibody structure. Examples of antigen-binding moiety include, without limitation, a variable domain, a variable region, a diabody, a Fab, a Fab', a F (ab') 2, an Fv fragment, a single chain Fv fragment (scFv) , a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2, a bispecific dsFv (dsFv-dsFv') , a disulfide stabilized diabody (ds diabody) , a multispecific antibody, a camelized single domain antibody, a single variable domain (i.e. VHH) , a nanobody, a domain antibody, and a bivalent domain antibody. An antigen-binding moiety is capable of binding to the same antigen to which the parent antibody binds. More detailed formats of antigen-binding moiety are described in Spiess et al, (2015) Molecular Immunology 67: 95-106, and Brinkman et al., mAbs, 9 (2) , pp. 182–212 (2017) , which are incorporated herein by their entirety. The terms “CD3 binding moiety” and “anti-CD3 moiety” and similar terminology have the meaning herein. “Fab” with regard to an antibody refers to that portion of the antibody consisting of a single light chain (both variable and constant regions) associating to the variable region and first constant region of a single heavy chain by a disulfide bond. In certain embodiments, the constant regions of both the light chain and heavy chain of the Fab (referred to herein as chimeric Fab) are replaced with TCR constant regions Cα and Cβ or engineered variants thereof.“Fc” (short for fragment, crystallizable) with regard to an antibody refers to that portion of the antibody comprising the second (CH2) and third (CH3) constant regions of a first heavy chain bound to the second and third constant regions of a second heavy chain via disulfide bonding. Fc is a specific dimerization domain. The Fc region as used herein may also comprise part or whole of the hinge region. The Fc region of the antibody is responsible for various effector functions such as ADCC and CDC, but generally does not function in antigen binding. The capacity of antibodies to initiate and regulate effector functions through their Fc domain is a key component of their in vivo protective activity. Although the neutralizing activity of antibodies has been previously considered to be solely the outcome of Fab-antigen interactions, it has become apparent that their in vivo activity is highly dependent on interactions of the IgG Fc domain with its cognate receptors, Fcγ receptors (FcγRs) , expressed on the surface of effector leukocytes.The terms “operably link” and “operably linked” refer to a juxtaposition, with or without a spacer or linker, of two or more biological sequences of interest in such a way that they are in a relationship permitting them to function in an intended manner. When used with respect to polypeptides, it is intended to mean that the polypeptide sequences are linked in such a way that permits the linked product to have the intended biological function. For example, an antibody variable region may be operably linked to a constant region so as to provide for a stable product with antigen-binding activity. The term may also be used with respect to polynucleotides. For one instance, when a polynucleotide encoding a polypeptide is operably linked to a regulatory sequence (e.g., promoter, enhancer, silencer sequence, etc. ) , it is intended to mean that the polynucleotide sequences are linked in such a way that permits regulated expression of the polypeptide from the polynucleotide. The term operably linked, when used herein to describe domains linked to form a polypeptide, can be represented by a “-” , and can refer to a direct linkage between domains or linkage via a linker comprising 1-30 amino acids in length, such as a single amino acid or a series of (G4S) n linker, with n=1-5 (1, 2, 3, 4, or 5) .The term “chimeric antibody” , as used herein, refers to an antibody in which the variable region sequences are derived from one species and the constant region sequences are derived from another species, such as an antibody in which the variable region sequences are derived from mouse germline and the constant region sequences are derived from human germline.The term “humanized antibody” , as used herein, refers to antibodies in which CDR sequences derived from the germline of another mammalian species, such as a rat or mouse, have been grafted onto human framework sequences. Additional framework region modifications may be made within the human framework sequences. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc) , typically that of a human immunoglobulin.The term “human antibody” or “fully human antibody, ” as used herein, is intended to include antibodies having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.The term “CD3 x CD19 x CD20 antibody” or “anti-CD3 x CD19 x CD20 antibody” , as used herein, refers to a trispecific antibody that comprises three different antigen-binding moieties, binding specifically to the antigen CD3, CD19 and CD20, respectively.The term “cluster of differentiation 3” or “CD3” , as used herein, refers to the CD3 T-cell co-receptor which is a protein complex composed of four distinct chains, a CD3gamma chain, a CD3delta chain, and two CD3epsilon chains. The four chains associate with a molecule known as T-cell receptor (TCR) and the zeta-chain to generate activation signal in T lymphocytes. The TCR, zeta chain, and CD3 molecules compose the TCR complex, in which TCR as a subunit recognizes and binds to antigen, and CD3 as a subunit transfer and conveys the antigen stimulation to signaling pathway, and ultimately regulates T-cell activity. The CD3 protein is present in virtually all T cells. The CD3 antigen herein may refer to any native CD3 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats) , unless otherwise indicated, including, for example, CD3ε, CD3γ, CD3δ, and CD3ζ chains. The term encompasses “full-length” unprocessed CD3 (e.g., unprocessed or unmodified CD3E or CD3y) , as well as any form of CD3 that results from processing in the cell and naturally occurring variants of CD3, including, for example, splice variants or allelic variants.The term “cluster of differentiation 20” or “CD20” as used herein is also called human B-lymphocyte-restricted differentiation antigen (Bp35) . It is a hydrophobic transmembrane protein located on pre-B and mature B lymphocytes (Valentine et al. J. Biol. Chem. 264 (19) : 11282-11287 (1989) ; and Einfeld et al. EMBO J. 7 (3) : 711-717 (1988) ) . The antigen is also expressed on greater than 90%of B-cell non-Hodgkin's lymphomas (NHL) . CD20 regulates an early step (s) in the activation process for cell cycle initiation and differentiation and possibly functions as a calcium ion channel. The term encompasses “full-length” unprocessed CD20, as well as any form of CD20 that results from processing in the cell and naturally occurring variants of CD20, including, for example, splice variants or allelic variants.The term “cluster of differentiation 19” or “CD19” as used herein is a transmembrane protein that in humans is expressed in all B lineage cells. CD19 is a biomarker for normal and neoplastic B cells, as well as follicular dendritic cells. CD19 is critically involved in establishing intrinsic B cell signaling thresholds through modulating both B cell receptor-dependent and independent signaling. CD19 functions as the dominant signaling component of a multimolecular complex on the surface of mature B cells, alongside complement receptor CD21, and the tetraspanin membrane protein CD81 (TAPA-1) , as well as CD225. Due to its presence on all B cells, it is a biomarker for B lymphocyte development, lymphoma diagnosis and can be utilized as a target for leukemia immunotherapies.The term “Ka” , as used herein, is intended to refer to the association rate of a particular antibody-antigen interaction, whereas the term “Kd” as used herein, is intended to refer to the dissociation rate of a particular antibody-antigen interaction. The term “KD” as used herein, is intended to refer to the dissociation constant of a particular antibody-antigen interaction, which is obtained from the ratio of Kd to Ka (i.e., Kd / Ka) and is expressed as a molar concentration (M) . A preferred method for determining the KD of an antibody is by using surface plasmon resonance, preferably using a biosensor system such as asystem.The term “EC50” as used herein, which is also termed as “half maximal effective concentration” , refers to the concentration of a drug, antibody or toxicant which induces a response halfway between the baseline and maximum after a specified exposure time. In the context of the application, EC50 is expressed in the unit of “nM” or “M” .The term “isolated” as used herein refers to a state obtained from natural state by artificial means. If a certain “isolated” substance or component is present in nature, it is possible because its natural environment changes, or the substance is isolated from natural environment, or both. For example, a certain un-isolated polynucleotide or polypeptide naturally exists in a certain living animal body, and the same polynucleotide or polypeptide with a high purity isolated from such a natural state is called isolated polynucleotide or polypeptide. The term “isolated” excludes neither the mixed artificial or synthesized substance nor other impure substances that do not affect the activity of the isolated substance.The term “vector” as used herein refers to a nucleic acid vehicle which can have a polynucleotide inserted therein. When the vector allows for the expression of the protein encoded by the polynucleotide inserted therein, the vector is called an expression vector. The vector can have the carried genetic material elements expressed in a host cell by transformation, transduction, or transfection into the host cell. Vectors are well known by a person skilled in the art, including, but not limited to plasmids, phages, cosmids, artificial chromosome such as yeast artificial chromosome (YAC) , bacterial artificial chromosome (BAC) or P1-derived artificial chromosome (PAC) ; phage such as λ phage or M13 phage and animal virus. The animal viruses that can be used as vectors, include, but are not limited to, retrovirus (including lentivirus) , adenovirus, adeno-associated virus, herpes virus (such as herpes simplex virus) , pox virus, baculovirus, papillomavirus, papova virus (such as SV40) . A vector may comprise multiple elements for controlling expression, including, but not limited to, a promoter sequence, a transcription initiation sequence, an enhancer sequence, a selection element and a reporter gene. In addition, a vector may comprise origin of replication.The term “host cell” as used herein refers to a cellular system which can be engineered to generate proteins, protein fragments, or peptides of interest. Host cells include, without limitation, cultured cells, e.g., mammalian cultured cells derived from rodents (rats, mice, guinea pigs, or hamsters) such as CHO, BHK, NSO, SP2 / 0, YB2 / 0; or human tissues or hybridoma cells, yeast cells, and insect cells, and cells comprised within a transgenic animal or cultured tissue. The term encompasses not only the particular subject cell but also the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not be identical to the parent cell, but are still included within the scope of the term “host cell” .The term “identity” as used herein, refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences. “Percent identity” means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in alignments (if any) are preferably addressed by a particular mathematical model or computer program (i.e., an “algorithm” ) . Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in Computational Molecular Biology, (Lesk, A.M., ed. ) , 1988, New York: Oxford University Press; Biocomputing Informatics and Genome Projects, (Smith, D.W., ed. ) , 1993, New York: Academic Press; Computer Analysis of Sequence Data, Part I, (Griffin, A. M., and Griffin, H.G., eds. ) , 1994, New Jersey: Humana Press; von Heinje, G., 1987, Sequence Analysis in Molecular Biology, New York: Academic Press; Sequence Analysis Primer, (Gribskov, M. and Devereux, J., eds. ) , 1991, New York: M. Stockton Press; and Carillo et al, 1988, SIAMJ. Applied Math. 48: 1073.The term “immunogenicity” as used herein refers to ability of stimulating the formation of specific antibodies or sensitized lymphocytes in organisms. It not only refers to the property of an antigen to stimulate a specific immunocyte to activate, proliferate and differentiate so as to finally generate immunologic effector substance such as antibody and sensitized lymphocyte, but also refers to the specific immune response that antibody or sensitized T lymphocyte can be formed in immune system of an organism after stimulating the organism with an antigen. Immunogenicity is the most important property of an antigen. Whether an antigen can successfully induce the generation of an immune response in a host depends on three factors, properties of an antigen, reactivity of a host, and immunization means.The term “transfection” as used herein refers to the process by which nucleic acids are introduced into eukaryotic cells, particularly mammalian cells. Protocols and techniques for transfection include but not limited to lipid transfection and chemical and physical methods such as electroporation. A number of transfection techniques are well known in the art and are disclosed herein. See, e.g., Graham et al., 1973, Virology 52: 456; Sambrook et al., 2001, Molecular Cloning: A Laboratory Manual, supra; Davis et al., 1986, Basic Methods in Molecular Biology, Elsevier; Chu et al, 1981, Gene 13: 197. In a specific embodiment of the invention, human CD3 gene was transfected into CHO cells.The term “fluorescence-activated cell sorting” or “FACS” as used herein refers to a specialized type of flow cytometry. It provides a method for sorting a heterogeneous mixture of biological cells into two or more containers, one cell at a time, based upon the specific light scattering and fluorescent characteristics of each cell (FlowMetric. “Sorting Out Fluorescence Activated Cell Sorting” . Retrieved 2017-11-09. ) . Instruments for carrying out FACS are known to those of skill in the art and are commercially available to the public. Examples of such instruments include FACS Star Plus, FACScan and FACSort instruments from Becton Dickinson (Foster City, Calif. ) Epics C from Coulter Epics Division (Hialeah, Fla. ) and MoFlo from Cytomation (Colorado Springs, Colo. ) .The terms “subject” and “patient” are used interchangeably and include mammals such as humans and non-human primates, as well as rabbits, rats, mice, goats, pigs, and other mammalian species. The term does not necessarily indicate that the subject has been diagnosed with a particular disease, but typically refers to an individual under medical supervision.The term “prevent” , “prevention” or “preventing” as used herein, with reference to a certain disease condition in a mammal, refers to preventing or delaying the onset of the disease, or preventing the manifestation of clinical or subclinical symptoms thereof.The term “treatment” , “treating” or “treated” as used herein in the context of treating a condition, pertains generally to treatment and therapy, whether of a human or an animal, in which some desired therapeutic effect is achieved, for example, the inhibition of the progress of the condition, and includes a reduction in the rate of progress, a halt in the rate of progress, regression of the condition, amelioration of the condition, and cure of the condition. For cancer, “treating” may refer to dampen or slow the tumor or malignant cell growth, proliferation, or metastasis, or some combination thereof.The term “an effective amount” as used herein, pertains to that amount of an active compound, or a material, composition or dosage form comprising an active compound, which is effective for producing some desired therapeutic effect, commensurate with a reasonable benefit / risk ratio, when administered in accordance with a desired treatment regimen. For instance, the “an effective amount, ” when used in connection with treatment of a disease or condition, refers to an antibody or antigen-binding portion thereof in an amount or concentration effective to treat the said disease or condition.The term “pharmaceutically acceptable” as used herein means that the vehicle, diluent, excipient and / or salts thereof, are chemically and / or physically is compatible with other ingredients in the formulation, and the physiologically compatible with the recipient.As used herein, the term “apharmaceutically acceptable carrier and / or excipient” refers to a carrier and / or excipient pharmacologically and / or physiologically compatible with a subject and an active agent, which is well known in the art (see, e.g., Remington's Pharmaceutical Sciences. Edited by Gennaro AR, 19th ed. Pennsylvania: Mack Publishing Company, 1995) , and includes, but is not limited to pH adjuster, surfactant, adjuvant and ionic strength enhancer. For example, the pH adjuster includes, but is not limited to, phosphate buffer; the surfactant includes, but is not limited to, cationic, anionic, or non-ionic surfactant, e.g., Tween-80; the ionic strength enhancer includes, but is not limited to, sodium chloride.As used herein, the term “adjuvant” refers to a non-specific immunopotentiator, which can enhance immune response to an antigen or change the type of immune response in an organism when it is delivered together with the antigen to the organism or is delivered to the organism in advance. There are a variety of adjuvants, including, but not limited to, aluminum adjuvants (for example, aluminum hydroxide) , Freund’s adjuvants (for example, Freund’s complete adjuvant and Freund’s incomplete adjuvant) , coryne bacterium parvum, lipopolysaccharide, cytokines, and the like. Freund's adjuvant is the most commonly used adjuvant in animal experiments now. Aluminum hydroxide adjuvant is more commonly used in clinical trials.Polypeptide ComplexesIn one aspect, the present disclosure provides a polypeptide complex comprising at least three antigen-binding moieties with different antigen-binding specificities. The polypeptide complex may be any of the following: a multispecific antibody such as a trispecific antibody, a multivalent antibody such as a trivalent antibody and a tetravalent antibody, a monoclonal antibody, a polyclonal antibody, a humanized antibody, a chimeric antibody, a human antibody. Each antigen binding moiety may adopt any of the following formats: Fab, scFv and VHH. In some embodiments, all the three antigen-binding moieties are in Fab format. In some further embodiments, two of the three antigen-binding moieties comprise a pair of TCR constant regions in place of the native CH1 and CL regions. The introduction of the TCR constant regions has the benefit of ensuring cognate heavy-light chain pairing. The TCR constant alpha and beta domains preferentially associate with each other and are less prone to associate with CL or CH1, thereby formation of unwanted pairs such as Calpha-CH, Calpha-CL, Cbeta-CH, and Cbeta-CL are discouraged and significantly reduced. This renders more flexibility in assembling the antigen-binding moieties into different formats of the polypeptide complex with minimal or substantially no mispairing of the antigen-binding sequences.The term “valent” as used herein refers to the presence of a specified number of antigen binding sites in a given molecule. As such, the terms “bivalent” , “trivalent” , and “tetravalent” denote the presence of two binding site, three binding sites, and four binding sites, respectively, in an antigen-binding molecule. In some embodiments, the first antigen-binding moiety comprises a first heavy chain variable domain (VH1) operably linked to a first T cell receptor (TCR) constant (C1) region (VH1-C1) in one chain, and a first light chain variable domain (VL1) operably linked to a second TCR constant (C2) region (VL1-C2) in another chain; the second antigen-binding moiety comprises a second heavy chain variable domain (VH2) operably linked to a C1 region (VH2-C1) in one chain, and a second light chain variable domain (VL2) operably linked to a C2 region (VL2-C2) in another chain; and the third antigen-binding moiety comprises a third heavy chain variable domain (VH3) operably linked to a CH1 constant region (VH3-CH1) in one chain, and a third light chain variable domain (VL3) operably linked to a CL constant region (VL3-CL) in another chain. As can be readily appreciated by a person in the art, in the polypeptide complex, when VH1-C1 is in a heavy chain, its counterpart VL1-C2 should be in a light chain for their association into an antigen binding site, and similarly when VH1-C1 is in a light chain, VL1-C2 should be in a heavy chain. This is the same for the second antigen-binding moiety and the third antigen-binding moiety.On this basis, the inventors further adopt a unique strategy (designated as WuXiBody Cross herein) in assembling the three antigen-binding moieties, in which the C1 of the first antigen binding moiety and the C1 of the second antigen binding moiety should not be on the same polypeptide chain. Accordingly, the C2 of the first antigen binding moiety and the C2 of the second antigen binding moiety should not be on the same polypeptide chain. This would ensure VH1-C1 and VH2-C1 are not in the same polypeptide chain, and VL1-C2 and VL2-C2 are not in the same polypeptide chain. The advantage of such a design is that the mismatch between VL1-C2 of the first antigen binding moiety to VH2-C1 of the second binding moiety or between VL2-C2 of the second binding moiety to VH1-C1 of the first antigen binding moiety would be minimized in the polypeptide complex. For example, for polypeptide complex comprising two heavy chains (e.g., Fc-comprising) and associated light chains, when designing the components of each heavy chain and light chain, VH1-C1 and VH2-C1 should not both be present in a heavy chain (s) , or both be present in a light chain (s) . This includes the scenarios of VH1-C1 and VH2-C1 in the same heavy chain or in two separate heavy chains or in two separate light chains, all of which are excluded in the polypeptide complex as disclosed herein.Specifically, the assembling of the polypeptide complex adopts the following strategy: (1) when VH1-C1 of the first antigen-binding moiety is in a heavy chain of the polypeptide complex, VH2-C1 of the second antigen-binding moiety should not exist in any of the heavy chains to avoid potential association of a light chain comprising VL1-C2 to the VH2-C1 section in the heavy chain, or a light chain comprising VL2-C2 to the VH1-C1 section in the heavy chain; and (2) when VH1-C1 of the first antigen-binding moiety is in a light chain of the polypeptide complex, VH2-C1 of the second antigen-binding moiety should not exist in any of the light chains to avoid potential association of a light chain comprising VH2-C1 to the VL1-C2 section in the heavy chain, and a light chain comprising VH1-C1 to the VL2-C2 section in the heavy chain. The benefit of this strategy is that the occurrence of mismatching when assembling a multi-specific polypeptide complex is greatly reduced and it is designed to make sure that VH1-C1 is associated with VL1-C2, VH2-C1 is associated with VL2-C2 and VH3-CH1 is associated with VL3-CL.The strategy is also suitable for polypeptide complexes without two heavy chains and hence, without Fc region for holding together two heavy chains. In some embodiments, the polypeptide complex comprises a polypeptide chain comprising one chain of the first antigen-binding moiety, one chain of the second antigen-binding moiety and one chain of the third antigen-binding moiety operably linked with each other. The other chain of each antigen-binding moiety constitutes three shorter polypeptide chains. For example, the polypeptide complex comprises (a) a polypeptide chain comprising VH1-C1 of the first antigen-binding moiety, VL2-C2 of the second antigen-binding moiety and VH3-CH1 of the third antigen-binding moiety operably linked with each other; or (b) a polypeptide chain comprising VL1-C2 of the first antigen-binding moiety, VH2-C1 of the second antigen-binding moiety and VH3-CH1 of the third antigen-binding moiety operably linked with each other. In the longer polypeptide chain, the positions of the antigen-binding moieties from N to C terminal may be switched.The first antigen binding moiety may be derived from a first antibody, the second antigen binding moiety may be derived from a second antibody, and the third antigen binding moiety may be derived from a third antibody, each antibody has a different antigen binding specificity with other antibodies. The parental antibodies may be already developed and known to the public or developed de novo. By “derived from” , it is meant herein that the antigen-binding moiety comprises the CDR sequences or highly homologous CDR sequences of the parental antibody, and preferably, comprises the variable regions of the parental antibody. The antigen-binding moiety may also comprise variations in the CDR regions, framework regions and / or constant regions of the parental antibody while retaining the antigen-binding specificity. For example, compared to the original CDR sequences of parental antibody, one or two amino acids in the CDR or framework regions of the derived antigen-binding moiety may be modified to e.g. reduce the risk of glycosylation and deamidation.The first antigen binding moiety may comprise a first heavy chain variable domain (VH1) and a first light chain variable domain (VL1) derived from the first antibody. In some embodiments, the first antigen binding moiety is a Fab and comprises a first polypeptide comprising, from N-terminus to C-terminus, the VH1 operably linked to a first T cell receptor (TCR) constant region (C1) , and a second polypeptide comprising, from N-terminus to C-terminus, the VL1 operably linked to a second TCR constant region (C2) , wherein C1 and C2 are capable of forming a dimer, wherein C1 comprises an engineered CBeta and C2 comprises an engineered CAlpha, or C1 comprises an engineered CAlpha and C2 comprises an engineered CBeta. Preferably, C1 and C2 comprise at least one non-native interchain bond between them which is capable of stabilizing the dimer.Similarly, the second antigen binding moiety may comprise a second heavy chain variable domain (VH2) and a second light chain variable domain (VL2) derived from the second antibody. In some embodiments, the second antigen binding moiety is a Fab and comprises a first polypeptide comprising, from N-terminus to C-terminus, the VH2 operably linked to a first TCR constant region (C1) , and a second polypeptide comprising, from N-terminus to C-terminus, the VL2 operably linked to a second TCR constant region (C2) , wherein C1 and C2 are capable of forming a dimer, wherein C1 comprises an engineered CBeta and C2 comprises an engineered CAlpha, or C1 comprises an engineered CAlpha and C2 comprises an engineered CBeta. Preferably, C1 and C2 comprise at least one non-native interchain bond between them which is capable of stabilizing the dimer.The third antigen binding moiety may comprise a third heavy chain variable domain (VH3) and a third light chain variable domain (VL3) derived from the third antibody. In some embodiments, the third antigen binding moiety is a Fab and comprises a first polypeptide comprising the VH3 operably linked to a CH1 domain, and a third polypeptide comprising the VL3 operably linked to a CL domain. In some embodiments, the third antigen-binding moiety comprises, from N-terminus to C-terminus, a third heavy chain variable domain (VH3) operably linked to a CH1 constant region in one chain, and a third light chain variable domain (VL3) operably linked to a CL constant region in another chain.In some embodiments, the first, the second and the third antigen binding moieties are all in Fab format as exemplified in the polypeptide complexes herein, thus the antigen binding moiety may also be designated as an antigen binding Fab. The antigen-binding moiety may be operably linked to each other by linking one chain of an antigen binding Fab to one chain of another antigen binding Fab directly or indirectly via a linker. In some embodiments, the VH1 and C1 regions of the first antigen-binding moiety may be linked to the VL2 and C2 regions of the second antigen-binding moiety, or the VH3 and CH1 regions of the third antigen-binding moiety. In some other embodiments, the VL1 and C2 regions of the first antigen-binding moiety may be linked to the VH2 and C1 regions of the second antigen-binding moiety, or the VH3 and CH1 regions of the third antigen-binding moiety. In some other embodiments, the VH2 and C1 regions of the second antigen-binding moiety may be operably linked to the VH3 and CH1 regions of the third antigen-binding moiety.In some embodiments, the polypeptide complex comprises two binding arms that stems from the Fc region, wherein the first binding arm comprises the first antigen-binding moiety and the second antigen-binding moiety, and the second binding arm comprises the third antigen-binding moiety which is not covalently linked to either one of the first and second antigen binding moieties. In some embodiments, the first binding arm comprises the first antigen-binding moiety and the third antigen-binding moiety, and the second binding arm comprises the second antigen-binding moiety. In some embodiments, the first binding arm comprises the second antigen-binding moiety and the third antigen-binding moiety, and the second binding arm comprises the first antigen-binding moiety. Preferably, the two binding arms are both at the N terminal of the Fc region. In some embodiments, the polypeptide complex comprises three binding arms that stems from the Fc region, wherein the first binding arm comprises the first antigen-binding moiety, the second binding arm comprises the second antigen-binding moiety and the third binding arm comprises the third antigen-binding moiety. Preferably, two binding arms are at the N terminal of the Fc region and the other binding arm is at the C terminal of the Fc region.The pair of C1 and C2 domains comprised in the first, second and third antigen-binding moieties (if present) may be same or different between each other. For example, the C1 domain of the first antigen-binding moiety may be highly homologous to the C1 domains of the second and third antigen-binding moieties. The C2 domains of the first, second and third antigen-binding moieties may be same or different between each other. For example, the C2 domain of the first antigen-binding moiety may be highly homologous to the C2 domains of the second and third antigen-binding moieties.Depending on the multispecific format and / or numbering convenience, the numbering as disclosed herein, such as first, second, and third, could be different throughout the specification. For example, the first VH may be numbered as the second VH, and the first VL may be numbered as the second VL. As another example, the second antigen-binding moiety may be numbered as the first antigen-binding moiety, and the first antigen-binding moiety may be numbered as the second antigen-binding moiety.i. TCR constant domainThe polypeptide complexes provided herein comprise constant domains derived from a TCR. Native TCR consists of two polypeptide chains and has in general two types: one consists of alpha and beta chains (i.e. alpha / beta TCR) , and the other consists of gamma and delta chains (i.e. gamma / delta TCR) . These two types are structurally similar but have distinct locations and functions. About 95%human T cells have alpha / beta TCRs, whereas the rest 5%have gamma / delta TCRs. Each of the two TCR polypeptide chains comprises an immunoglobulin domain and a membrane proximal region. The immunoglobulin region comprises a variable region and a constant region, and is characterized by the presence of an immunoglobulin-type fold. Each TCR polypeptide chain has a cysteine residue (e.g., at C terminal of the constant domain or at N terminal of the membrane proximal region) which together can form a disulphide bond that tethers the two TCR chains together.TCR is a heterodimeric T cell surface protein that belongs to the immunoglobulin superfamily and is similar to a half antibody with a single heavy chain and a single light chain. A native TCR has an extracellular portion, a transmembrane portion, and an intracellular portion. The extracellular domain of a TCR has a membrane-proximal constant region and a membrane-distal variable region. The introduction of TCR constant regions to replace the commonly used CH1 and CL domains have been shown to increase the stability and expression level of the generated antibody. A detailed description of the utility of TCR constant regions in assembling two parental antibodies into a bispecific molecule with desired valency and functionality have been disclosed in WO2019 / 057122 and WO2022 / 156687, the full contents of which are herein incorporated by reference.In some embodiments, the first antigen binding moiety and the second antigen binding moiety are Fabs comprising a TCR beta chain constant region (Cβ) that replaces the CH1 domain and a TCR alpha chain constant region (Cα) that replaces the CL domain. The positions of Cβ and Cαmay also be exchanged, with Cβ replacing the CL domain and Cα replacing the CH1 domain. The replacement by TCR constant region (Cβ / Cα) results in a chimeric Fab that possesses a unique light-heavy chain interface orthogonal to that of a regular antibody Fab. The assembly of the chimeric and regular Fabs in different formats can create various multi-specific molecules with different structures and valences.The sequences of constant regions of wild type human TCR beta and alpha chain can be found in NCBI accession number A0A5B9 (www. uniprot. org / uniprot / A0A5B9) and NCBI accession number P01848 (www. uniprot. org / uniprot / P01848) . In some embodiments, the sequence of TCR Cbeta domain is based on the following wild type TCR sequence:In some embodiments, the sequence of TCR Calpha domain is based on the following wild type TCR sequence:In some specific embodiments, the pair of TCR constant regions comprises an engineered TCR Cbeta domain comprising one or more mutated sites, as shown below:In some specific embodiments, the pair of TCR constant regions comprises an engineered TCR Calpha domain comprising one or more mutated sites, as shown below:PDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTQVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSQKSDFACANAFQNSIIPEDTFFPS [PESS] (SEQ ID NO: 42, PESS may be removed) ; or PDIQNPDCAVYQLRDSKSSDKSVCLFTDFDSQTQVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSQKSDFACANAFQNSIIPECTFFPS (SEQ ID NO: 43) ; PDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTQVSQSKDSDVYITDKCVLDMRSMDFK SNSAVAWSQKSDFACANAFQNSIIPEDTFFCS (SEQ ID NO: 35) .Preferably, the pair of TCR constant regions for constructing the antibodies herein are derived from wild type TCR constant regions, and further comprises one or more substitutions, additions or deletions of one or more amino acids that improve the association of the two TCR constant regions. In some embodiments, the first and second antigen binding moieties may comprise an engineered TCR beta chain constant region with the sequence as shown in SEQ ID NO: 34 and an engineered TCR alpha chain constant region with the sequence as shown in SEQ ID NO: 35. In some embodiments, the antigen binding moiety may comprise a Cβ region having at least 90%sequence identity (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 34, 39 or 41 and a Cα region having at least 90%sequence identity (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 35, 40, 42 or 43.Multiple TCR constant region variants which can find use in constructing multi-specific antibody formats have been disclosed in WO2019057122 and WO2022156687. A detailed description of TCR constant domain variants that can be utilized for constructing the antibody formats herein can be found in WO2019057122, WO2019057124, WO2020057610 and WO2022156687, which are entirely incorporated herein by reference. For example, WO2019057122 describes that the engineered CBeta comprises a mutated cysteine residue that substitutes for an amino acid residue at a position selected from: S56C, S16C, F13C, V12C, E14C, L62C, D58C, S76C, and R78C, and / or the engineered CAlpha comprises a mutated cysteine residue that substitutes for an amino acid residue at a position selected from: T49C, Y11C, L13C, S16C, V23C, Y44C, T46C, L51C, and S62C; specifically, the engineered CBeta and the engineered CAlpha comprise a pair of mutated cysteine residues that substitute for a pair of amino acid residues selected from the group consisting of: S16C in CBeta and Y11C in CAlpha, F13C in CBeta and L13C in CAlpha, S16C in CBeta and L13C in CAlpha, V12C in CBeta and S16C in CAlpha, E14C in CBeta and S16C in CAlpha, F13C in CBeta and V23C in CAlpha, L62C in CBeta and Y44C in CAlpha, D58C in CBeta and T46C in CAlpha, S76C in CBeta and T46C in CAlpha, S56C in CBeta and T49C in CAlpha, S56C in CBeta and L51C in CAlpha, S56C in CBeta and S62C in CAlpha, and R78C in CBeta and S62C in CAlpha (see paragraphs

[0032] and

[0033] ) , and also provides specific sequences of the engineered CBeta and CAlpha (see Table 20, SEQs: 32-48 of WO2019057122) . WO2022156687 provides more examples of the engineered CBeta and CAlpha domains, e.g. CAlpha and / or CBeta may comprise one or more mutated residues to form one or more non-native disulfide bonds, selected from: P8C on CAlpha, A9C on CAlpha, V10C on CAlpha, F26C on CAlpha, F29C on CAlpha, T33C on CAlpha, Q34C on CAlpha, V35C on CAlpha, S36C on CAlpha, S38C on CAlpha, K39C on CAlpha, F78C on CAlpha, N80C on CAlpha, S81C on CAlpha, I82C on CAlpha, P84C on CAlpha, D86C on CAlpha, T87C on CAlpha, F88C on CAlpha, F89C on CAlpha, P90C on CAlpha, and A18C on CBeta, and also provides specific sequences of the engineered CBeta and CAlpha domains (see Tables 1, 10, 14 and 18 of WO2022156687, especially the sequences of T8311-57, T8311-61, W329001-U4T4-78 and W329001-U4T4-79) . All of these engineered CBeta and CAlpha domains can be adopted by the antibodies herein.The two TCR constant regions in the moieties may be associated via interchain disulfide bonds. Preferably, the TCR constant regions may be engineered to comprise one or more cysteine amino acids to form one or more non-native disulfide bonds, so that the dimer formed by the two constant regions has a better stability, expression and heterodimerization.In certain embodiments, the engineered CAlpha and engineered CBeta comprise at least one mutation that improves the stability of CAlpha, the stability of CBeta, and / or the CAlpha-CBeta interfacial stability compared to the CAlpha and / or CBeta without such mutation. In some embodiments, the polypeptide complex disclosed with the at least one mutation has improved expression level, stability, and / or affinity to antigens compared to the polypeptide complex without such mutation.ii. Structures and FormatsThe three antigen-binding moieties as disclosed herein can be combined in different manners that can form a variety of structures. As described above, the concept of the polypeptide complex disclosed herein (designated as WuXiBody Cross) is that the C1 region of the first antigen-binding moiety and C1 region of the second antigen-binding moiety should not co-exist in the same heavy chain of the polypeptide complex, nor should they both exist in the heavy chains of the polypeptide complex. One of the C1 region of the first antigen-binding moiety and C1 region of the second antigen-binding moiety is present in the heavy chain, and the other is in a light chain. As defined herein, the heavy chain of the polypeptide complex comprises an Fc domain while the light chain of the polypeptide complex does not comprise an Fc domain and as exemplified herein is comprised by one chain of the antigen-binding Fab as disclosed herein. If the VH1-C1 portion of the first antigen-binding moiety is comprised in a heavy chain, the VH2-C1 portion of the second antigen-binding moiety should be in a light chain, whereas if the VH1-C1 portion of the first antigen-binding moiety is comprised in a light chain, the VH2-C1 portion of the second antigen-binding moiety should be in a heavy chain. The advantage of such design is that the mismatch between VL1-C2 to VH2-C1 or between VL2-C2 to VH1-C1 would be minimized in the polypeptide complex.In some embodiments, the first antigen-binding moiety may be operably linked to the second antigen-binding moiety in the polypeptide complex as one binding arm. In some embodiments, the first antigen-binding moiety comprises a VH1 domain operably linked to a C1 domain in one chain ( “VH1-C1” ) and a VL1 domain operably linked to a C2 domain in the other chain ( “VL1-C2” ) , and the second antigen-binding moiety comprises a VH2 domain operably linked to a C1 domain in one chain ( “VH2-C1” ) and a VL2 domain operably linked to a C2 domain in the other chain ( “VL2-C2” ) . The C1 domain and C2 domain may comprise engineered CAlpha and engineered CBeta, or vice versa. In some preferable embodiments, the C1-comprising chain of the first antigen-binding moiety is operably linked to the C2-comprising chain of the second antigen-binding moiety ( “VH1-C1-VL2-C2” ) , or the C2-comprising chain of the first antigen-binding moiety is operably linked to the C1-comprising chain of the second antigen-binding moiety ( “VL1-C2-VH2-C1” ) . In other words, the polypeptide comprising VH1 and C1 of the first antigen-binding moiety is operably linked to the polypeptide comprising the VL2 and C2 of the second antigen-binding moiety, or the polypeptide comprising VL1 and C2 of the first antigen-binding moiety is operably linked to the polypeptide comprising the VH2 and C1 of the second antigen-binding moiety. Avoiding the C1 of the first antigen-binding moiety on the same chain as the C1 of the second antigen-binding moiety is advantageous in facilitating a correct matching and association of the light chain to the heavy chain in the first antigen-binding moiety and the second antigen-binding moiety, respectively. For example, if C1 of the first antigen-binding moiety is on the same chain as the C1 of the second antigen-binding moiety, i.e. forming a VH1-C1-VH2-C1 polypeptide, the other chain VL1-C2 may associate with VH2-C1 and VL2-C2 may associate with VH1-C1, creating unstable and heterogeneous polypeptide complexes. In some embodiments, the polypeptide comprising VH1 and C1 of the first antigen-binding moiety is linked to the polypeptide comprising the VL2 and C2 of the second antigen-binding moiety, or the polypeptide comprising VL1 and C2 of the first antigen-binding moiety is linked to the polypeptide comprising the VH1 and C1 of the second antigen-binding moiety.Specifically, in the binding arm comprising the first antigen-binding moiety operably linked to the second antigen-binding moiety, the polypeptide complex may comprise, from N-terminus to C-terminus, domains operably linked into any of the following formats: VH1-C1-VL2-C2, VH1-C1-VH2-CH1, VL1-C2-VH2-C1, VL1-C2-VH2-CH1, VH1-CH1-VH2-C1, VH1-CH1-VL2-C2, VL2-C2-VH1-C1, VH2-CH1-VH1-C1, VH2-C1-VL1-C2, VH2-CH1-VL1-C2, VH2-C1-VH1-CH1, VL2-C2-VH1-CH1. “-” represents an operable linkage including a direct linkage or an indirect linkage via a peptide linker.In some embodiments, the polypeptide complex or antigen binding portion thereof comprises more than one first antigen binding moieties, more than one second antigen binding moieties or more than one third antigen binding moieties that are covalently linked or non-covalently associated together in one or more polypeptide chains. For example, the polypeptide complex or antigen binding fragment thereof may comprise: two first antigen binding moieties, one second antigen binding moiety and one third antigen binding moiety; one first antigen binding moiety, two second antigen binding moieties and one third antigen binding moiety; or one first antigen binding moiety, one second antigen binding moiety and two third antigen binding moieties. When there are more than one moiety targeting the same antigen, they can be same or different in sequence. Preferably, the more than one moiety targeting a same antigen have same amino acid sequences.In some embodiments, the polypeptide complex or antigen binding fragment thereof comprises one first antigen binding moiety, one second antigen binding moiety and one third antigen binding moiety. Similar to an ordinary IgG antibody, the polypeptide complex or antigen binding fragment thereof may comprise a first binding arm and a second binding arm that stem from the Fc region, with each arm binding to one or more antigen (s) . In some embodiments, the first binding arm comprises the first antigen binding moiety operably linked to the second antigen binding moiety and the second binding arm comprises the third antigen binding moiety alone. In some other embodiments, the first binding arm comprises the first antigen binding moiety operably linked to the third antigen binding moiety and the second binding arm comprises the second antigen binding moiety alone. Still in some other embodiments, the first binding arm comprises the second antigen binding moiety operably linked to the third antigen binding moiety and the second binding arm comprises the first antigen binding moiety alone.In embodiments where there are two first antigen binding moieties per molecule, the two first antigen binding moieties may be constructed on the same binding arm or on different binding arms. For example, the first binding arm comprises the third antigen binding moiety operably linked to the second antigen binding moiety and the second binding arm comprises the two first antigen binding moieties operably linked together; alternatively, the first binding arm comprises the first antigen binding moiety operably linked to the second antigen binding moiety and the second binding arm comprises the first antigen binding moiety operably linked to the third antigen binding moiety.In some embodiments, the polypeptide complex or the antigen-binding portion thereof comprises two heavy chains and three light chains, wherein each light chain corresponds to one chain of the first antigen binding moiety, the second antigen binding moiety or the third antigen binding moiety, and the three light chains associate with corresponding heavy chain to form the three antigen-binding moieties. Preferably, each moiety has different constant regions integrated into the heavy chain of the polypeptide complex and has different constant regions for the light chain of the polypeptide complex, so as to facilitate correct matching and association of the light chains and heavy chains. In some embodiments, the constant regions of the first antigen binding moiety, the second antigen binding moiety and the third antigen binding moiety in the heavy chain of the polypeptide complex are C1, C2 and CH1 respectively, or C2, C1 and CH1 respectively.In some embodiments, the multi-specific polypeptide complex comprises two heterologous heavy chains and 3 light chains associated non-covalently to form three antigen binding moieties targeting three different antigens, respectively.In some embodiments, the first antigen-binding moiety is operably linked to the second antigen-binding moiety in one binding arm and the third antigen-binding moiety is in the second binding arm.In some embodiments, the polypeptide complex comprises two heavy chains (HC1 and HC2) and three light chains (LC1, LC2, LC3) , wherein from N terminus to C terminus, HC1, HC2, LC1, LC2 and LC3 comprises domains operably linked as in the following formats, respectively (as exemplified in Figure 1, a and b) :(a) VH1-C1-VL2-C2-Fc, VH3-CH1-Fc, VL1-C2, VH2-C1, VL3-CL;(b) VL1-C2-VH2-C1-Fc, VH3-CH1-Fc, VH1-C1, VL2-C2, VL3-CL;(c) VL2-C2-VH1-C1-Fc, VH3-CH1-Fc, VH2-C1, VL1-C2, VL3-CL; or(d) VH2-C1-VL1-C2-Fc, VH3-CH1-Fc, VL2-C2, VH1-C1, VL3-CL.In some embodiments, the third antigen-binding moiety is operably linked to the first antigen-binding moiety in one binding arm, and the second antigen-binding moiety is in the second binding arm. In some other embodiments, the third antigen-binding moiety is operably linked to the second antigen-binding moiety in one binding arm, and the first antigen-binding moiety is in the second binding arm.The third antigen-binding moiety may be at the N terminal of the first or second antigen-binding moiety in the binding arm. In some embodiments, the polypeptide complex comprises two heavy chains (HC1 and HC2) and three light chains (LC1, LC2, LC3) , wherein from N terminus to C terminus, HC1, HC2, LC1, LC2 and LC3 comprises domains operably linked as in the following formats, respectively (as exemplified in Figure 1, c and d) :(a) VH3-CH1-VH2-C1-Fc, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL;(b) VH3-CH1-VL2-C2-Fc, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL;(c) VH3-CH1-VH1-C1-Fc, VL2-C2-Fc, VL1-C2, VH2-C1, VL3-CL; or(d) VH3-CH1-VL1-C2-Fc, VH2-C1-Fc, VH1-C1, VL2-C2, VL3-CL.The third antigen-binding moiety may be at the C terminal of the first or second antigen-binding moiety in the binding arm. In some embodiments, the polypeptide complex comprises two heavy chains (HC1 and HC2) and three light chains (LC1, LC2, LC3) , wherein from N terminus to C terminus, HC1, HC2, LC1, LC2 and LC3 comprises domains operably linked as in the following formats, respectively (as exemplified in Figure 1, e and f) :(a) VH2-C1-VH3-CH1-Fc, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL;(b) VL2-C2-VH3-CH1-Fc, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL;(c) VH1-C1-VH3-CH1-Fc, VL2-C2-Fc, VL1-C2, VH2-C1, VL3-CL; or(d) VL1-C2-VH3-CH1-Fc, VH2-C1-Fc, VH1-C1, VL2-C2, VL3-CL.In some embodiments, the polypeptide complex comprises three binding arms corresponding to three antigen-binding moieties, wherein two binding arms are on the N terminal of the Fc region and a third binding arm is on the C terminal of the Fc region.In some embodiments, the polypeptide complex comprises two heavy chains (HC1 and HC2) and three light chains (LC1, LC2, LC3) , wherein from N terminus to C terminus, HC1, HC2, LC1, LC2 and LC3 comprises domains operably linked as in the following formats, respectively (as exemplified in Figure 1, g and h) :(1) VH3-CH1-Fc-VL2-C2, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL;(2) VH3-CH1-Fc-VH2-C1, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL;(3) VH3-CH1-Fc-VL1-C2, VH2-C1-Fc, VH1-C1, VL2-C2, VL3-CL;(4) VH3-CH1-Fc-VH1-C1, VL2-C2-Fc, VL1-C2, VH2-C1, VL3-CL;(5) VL2-C2-Fc-VH3-CH1, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL;(6) VH2-C1-Fc-VH3-CH1, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL;(7) VL1-C2-Fc-VH3-CH1, VH2-C1-Fc, VH1-C1, VL2-C2, VL3-CL;(8) VH1-C1-Fc-VH3-CH1, VL2-C2-Fc, VL1-C2, VH2-C1, VL3-CL;(9) VH1-C1-Fc-VL2-C2, VH3-CH1-Fc, VL1-C2, VH2-C1, VL3-CL;(10) VL1-C2-Fc-VH2-C1, VH3-CH1-Fc, VH1-C1, VL2-C2, VL3-CL;(11) VH2-C1-Fc-VL1-C2, VH3-CH1-Fc, VH1-C1, VL2-C2, VL3-CL; or(12) VL2-C2-Fc-VH1-C1, VH3-CH1-Fc, VL1-C2, VH2-C1, VL3-CL.In some embodiments, the polypeptide complex comprises four antigen-binding moieties, e.g. with two copies of the first antigen-binding moiety, the second binding moiety or the third antigen-binding moiety. The four antigen-binding moieties may be all on the N terminal of the Fc region. Preferably, the two copies of an antigen-binding moiety are both operably linked to the N terminal of the Fc region.In some embodiments, the polypeptide complex comprises two heavy chains (HC1 and HC2) and four light chains (LC1, LC2, LC3, LC4) , wherein from N terminus to C terminus, HC1, HC2, LC1, LC2, LC3 and LC4 comprises domains operably linked as in the following formats, respectively (as exemplified in Figure 1, j and k) :(1) VH3-CH1-VL2-C2-Fc, VH1-C1-VL2-C2-Fc, VL1-C2, VH2-C1, VL3-CL;(2) VH3-CH1-VH2-C1-Fc, VL1-C2-VH2-C1-Fc, VH1-C1, VL2-C2, VL3-CL;(3) VH3-CH1-VH1-C1-Fc, VL2-C2-VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL;(4) VH3-CH1-VL1-C2-Fc, VH2-C1-VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL;(5) VL2-C2-VH3-CH1-Fc, VH1-C1-VH3-CH1-Fc, VL1-C2, VH2-C1, VL3-CL;(6) VH2-C1-VH3-CH1-Fc, VL1-C2-VH3-CH1-Fc, VH1-C1, VL2-C2, VL3-CL;(7) VH1-C1-VH3-CH1-Fc, VL2-C2-VH3-CH1-Fc, VL1-C2, VH2-C1, VL3-CL; or(8) VL1-C2-VH3-CH1-Fc, VH2-C1-VH3-CH1-Fc, VH1-C1, VL2-C2, VL3-CL.Alternatively, two antigen-binding moieties are on the N terminal of the Fc region and two antigen-binding moieties are on the C terminal of the Fc region. Preferably, the two copies of an antigen-binding moiety are both on the N terminal or C terminal of the Fc region.In some embodiments, the polypeptide complex comprises two heavy chains (HC1 and HC2) and four light chains (LC1, LC2, LC3, LC4) , wherein from N terminus to C terminus, HC1, HC2, LC1, LC2, LC3 and LC4 comprises domains operably linked as in the following formats, respectively (as exemplified in Figure 1, l) :(1) VH3-CH1-Fc-VL2-C2, VH1-C1-Fc-VL2-C2, VL1-C2, VH2-C1, VL3-CL;(2) VH3-CH1-Fc-VH2-C1, VL1-C2-Fc-VH2-C1, VH1-C1, VL2-C2, VL3-CL;(3) VH3-CH1-Fc-VH1-C1, VL2-C2-Fc-VH1-C1, VL1-C2, VH2-C1, VL3-CL;(4) VH3-CH1-Fc-VL1-C2, VH2-C1-Fc-VL1-C2, VH1-C1, VL2-C2, VL3-CL;(5) VL2-C2-Fc-VH3-CH1, VH1-C1-Fc-VH3-CH1, VL1-C2, VH2-C1, VL3-CL;(6) VH2-C1-Fc-VH3-CH1, VL1-C2-Fc-VH3-CH1, VH1-C1, VL2-C2, VL3-CL;(7) VH1-C1-Fc-VH3-CH1, VL2-C2-Fc-VH3-CH1, VL1-C2, VH2-C1, VL3-CL; or(8) VL1-C2-Fc-VH3-CH1, VH2-C1-Fc-VH3-CH1, VH1-C1, VL2-C2, VL3-CL.In some specific embodiments, the polypeptide complex comprises four chains, the second chain, the third chain and the fourth chain are shorter than and associated with the first chain, wherein from N terminus to C terminus, the first chain, the second chain, the third chain and the fourth chain comprise domains operably linked into the following formats, respectively (as exemplified in Figure 1, i and m) :(1) VH3-CH1-VH1-C1-VL2-C2, VL3-CL, VL1-C2, VH2-C1;(2) VH3-CH1-VL1-C2-VH2-C1, VL3-CL, VH1-C1, VL2-C2;(3) VH1-C1-VL2-C2-VH3-CH1, VL3-CL, VL1-C2, VH2-C1;(4) VL1-C2-VH2-C1-VH3-CH1, VL3-CL, VH1-C1, VL2-C2;(5) VL2-C2-VH3-CH1-VH1-C1, VL3-CL, VL1-C2, VH2-C1; or(6) VH2-C1-VH3-CH1-VL1-C2, VL3-CL, VH1-C1, VL2-C2.Among the VH1 / VL1, VH2 / VL2 and VH3 / VL3 pairs as described above, the positions of the VH and VL in a pair may be exchanged. Besides, VH1 may be exchanged with VH3 and VL1 correspondingly exchanged with VL3; VH1 may be exchanged with VH2 and VL1 correspondingly exchanged with VL2; VH2 may be exchanged with VH3 and VL2 correspondingly exchanged with VL3.In some embodiments, the antigen binding moiety is operably linked to the Fc region directly or via a peptide linker, such as an immunoglobulin whole or partial hinge region (indicated as “hinge” herein) , or a conventionally used artificial linker, such as a GS linker. The GS linker as used herein may be (GS) n, (GGS) n, (GGGS) n, (GGGGS) n, (GGSG) n, or (GGGSS) n, wherein n is an integer of 1-9.In some embodiments, two antigen binding moieties are operably linked via a GS linker in the heavy chain. The GS linker may be (GS) n, (GGS) n, (GGGS) n, (GGGGS) n, (GGSG) n, or (GGGSS) n, wherein n is an integer of 1-9.In some alternative embodiments, one or more of the antigen-binding moieties (e.g. the third antigen-binding moiety) of the polypeptide complex are in scFv format. scFv contains a VH domain from the parental antibody connected by a short linker to the VL domain of the parental antibody, adopting the VL-VH or VH-VL configuration, wherein “-” represents an operable linkage.iii. Antigenic specificitiesThe polypeptide complex as disclosed herein have three antigen-binding moieties with different antigenic specificities. The antigenic specificity can be directed to any suitable antigen or epitope, for example, one that is exogenous antigen, endogenous antigen, autoantigen, neoantigen, viral antigen or tumor antigen. An exogenous antigen enters a body by inhalation, ingestion or injection, and can be presented by the antigen-presenting cells (APCs) by endocytosis or phagocytosis and form MHC II complex. An endogenous antigen is generated within normal cells as a result of cell metabolism, intracellular viral or bacterial infection, which can form MHC I complex. An autoantigen (e.g. peptide, DNA or RNA, etc. ) is recognized by the immune system of a patient suffering from autoimmune diseases, whereas under normal condition, this antigen should not be the target of the immune system. A neoantigen is entirely absent from the normal body, and is generated because of a certain disease, such as tumor or cancer. In certain embodiments, the antigen is associated with a certain disease (e.g. tumor or cancer, autoimmune diseases, infectious and parasitic diseases, cardiovascular diseases, neuropathies, neuropsychiatric conditions, injuries, inflammations, coagulation disorder) . In certain embodiments, the antigen is associated with immune system (e.g. immunological cells such as B cell, T cell, NK cells, macrophages, etc. ) .In certain embodiments, one antigenic specificity is directed to an immune-related antigen or an epitope thereof. Examples of an immune-related antigen include a T-cell specific receptor molecule and / or a natural killer cell (NK cell) specific receptor molecule. The T-cell specific receptor molecule allows a T cell to bind to and, if additional signals are present, to be activated by and respond to an epitope / antigen presented by another cell called the antigen-presenting cell or APC. The T-cell specific receptor molecule can be TCR, CD3, CD28, CD134 (also termed OX40) , 4-1 BB, CD5, and CD95 (also known as the Fas receptor) . Examples of a NK cell specific receptor molecule include CD16, a low affinity Fc receptor and NKG2D, and CD2.In certain embodiments, one antigenic specificity is directed to a tumor-associated antigen or an epitope thereof. The term “tumor associated antigen” refers to an antigen that is or can be presented on a tumor cell surface and that is located on or within tumor cells. In some embodiments, the tumor associated antigens can be presented only by tumor cells and not by normal, i.e. non-tumor cells. In some other embodiments, the tumor associated antigens can be exclusively expressed on tumor cells or may represent a tumor specific mutation compared to non-tumor cells. In some other embodiments, the tumor associated antigens can be found in both tumor cells and non-tumor cells, but is overexpressed on tumor cells when compared to non-tumor cells or are accessible for antibody binding in tumor cells due to the less compact structure of the tumor tissue compared to non-tumor tissue. In some embodiments the tumor associated antigen is located on the vasculature of a tumor. Illustrative examples of a tumor associated surface antigen are described in PCT / CN2018 / 106766 (WO 2019 / 057122) and are incorporated herein by reference.In certain embodiments, one antigenic specificity is directed to an antigen or an epitope thereof, selected from the group consisting of: CD3, CD19, CD20, 4.1BB (CD137) , OX40 (CD134) , CD16, CD47, CD22, CD33, CD38, CD123, CD133, CEA, cdH3, EpCAM, epidermal growth factor receptor (EGFR) , EGFRvIII (amutant form of EGFR) , HER2, HER3, dLL3, BCMA, Sialyl-Lea, 5T4, ROR1, melanoma-associated chondroitin sulfate proteoglycan, mesothelin, folate receptor 1, VEGF receptor, EpCAM, HER2 / neu, HER3 / neu, G250, CEA, MAGE, proteoglycans, VEGF, FGFR, alphaVbeta3-integrin, HLA, HLA-DR, ASC, CD1, CD2, CD4, CD5, CD6, CD7, CD8, CD11, CD13, CD14, CD21, CD23, CD24, CD28, CD30, CD37, CD40, CD41, CD44, CD52, CD64, c-erb-2, CALLA, MHCII, CD44v3, CD44v6, p97, ganglioside GM1, GM2, GM3, GD1a, GD1b, GD2, GD3, GT1b, GT3, GQ1, NY-ESO-1, NFX2, SSX2, SSX4 Trp2, gp100, tyrosinase, Muc-1, telomerase, survivin, G250, p53, CA125 MUC, Wue antigen, Lewis Y antigen, HSP-27, HSP-70, HSP-72, HSP-90, Pgp, MCSP, EpHA2, cell surface targets GC182, GT468 or GT512, IL-17, IL-20, IL-13, and IL-4.The antibody variable domains can be derived from a parent antibody. A parent antibody can be any type of antibody, including for example, a fully human antibody, a humanized antibody, or an animal antibody (e.g. mouse, rat, rabbit, sheep, cow, dog, etc. ) . The parent antibody can be a monoclonal antibody or a polyclonal antibody.In certain embodiments, the parent antibody is a monoclonal antibody. A monoclonal antibody can be produced by various methods known in the art, for example, hybridoma technology, recombinant method, phage display, or any combination thereof. Exemplary methods of producing antibodies are described in PCT / CN2018 / 106766 (WO 2019 / 057122) and are incorporated herein by reference.The parent antibodies described herein can be further modified, for example, to graft the CDR sequences to a different framework or scaffold, to substitute one or more amino acid residues in one or more framework regions, to replace one or more residues in one or more CDR regions for affinity maturation, and so on. These can be accomplished by a person skilled in the art using conventional techniques.The parent antibody can also be a therapeutic antibody known in the art, for example those approved by FDA for therapeutic or diagnostic use, or those under clinical trial for treating a condition, or those in research and development. Polynucleotide sequences and protein sequences for the variable regions of known antibodies can be obtained from public databases such as, www. ncbi. nlm nih gov / entrez- / query. fcgi; www. atcc. org / phage / hdb. html; www. sciquest. com / ; www. abcam. com / ; www. antibodyresource. com / onlinecomp. html. Examples of therapeutic antibodies include, but are not limited to the therapeutic antibodies disclosed in PCT / CN2018 / 106766 (WO 2019 / 057122) and are incorporated herein by reference.The WuXiBody cross design as described herein is widely applicable for designing antibodies with different antigen binding specificities. To manifest the universality, the disclosure provides several polypeptide complexes that bind to three of the following antigens: CD3, CD19, CD20, PD-1, PD-L1, EGFR, Trop2, Her2 and Her3. More specifically, the disclosure provides a polypeptide complex that binds to CD3, CD19 and CD20, a polypeptide complex that binds to PD-1, PD-L1, EGFR, a polypeptide complex that binds to Trop2, Her3 and CD3, a polypeptide complex that binds to CD3, EGFR and CD20, a polypeptide complex that binds to CD3, HER2 and HER3, a polypeptide complex that binds to Trop2, Her3 and PD-1, a polypeptide complex that binds to Trop2, PD-L1 and PD-1, and a polypeptide complex that binds to Trop2, PD-L1 and HER3. All of these polypeptide complexes show good structural stability, thermal stability and antigen binding, with significantly reduced byproduct production.iv. CD3-binding moiety, CD19-binding moiety and CD20-binding moietyAs shown herein, a multispecific polypeptide complex or antibody that co-engages CD3 and a tumor antigen target (s) have been designed and used to redirect T cells to attack and lyse targeted tumor cells. In some embodiments, the polypeptide complex comprises a CD3 binding moiety, a CD19 binding moiety and a CD20 binding moiety which are combined into multi-specific antibodies that interact with CD3, CD19 and CD20. The engagement of CD3 affords efficient T cell stimulation, whereas the CD19 binding and CD20 binding moieties direct T cells to B cells, especially B malignancy cells, as well as to certain lymphomas and leukemias. While the CD3-targeting approach has shown considerable promise, a common side effect of such therapies is the associated production of cytokines, often leading to toxic cytokine release syndrome (CRS) . Because the CD3 binding of the antibody engages all T cells, the high cytokine-producing CD4 T cell subset is recruited. Moreover, the CD4 T cell subset includes regulatory T cells, whose recruitment and expansion can potentially lead to immune suppression and have a negative impact on long-term tumor suppression. One such possible way to reduce cytokine production and possibly reduce the activation of CD4 T cells is by reducing the affinity of the CD3 binding domain for CD3.CRS mitigation is preferred in the methods and uses in accordance with the disclosure. CRS may include excessive release of cytokines, for example of proinflammatory cytokines, e.g. IL-6, TNF-alpha or IL-8, that may result in adverse effects like fever, nausea, vomiting and chills. Thus, despite the unique anti-tumor activity of bispecific antibodies such as REGN1979, their immunological mode of action may trigger unwanted “side” effects, i.e. in the induction of unwanted inflammatory reactions. Hence, patients may be further subjected to a concomitant treatment, prophylaxis and / or premedication with e.g. analgesics, antipyretics, and / or anti inflammatory drugs to mitigate possible CRS symptoms.In some aspects, provided herein are polypeptide complexes and antigen-binding portions thereof that have a first specificity for CD3 (e.g., human, cynomolgus monkey and mouse CD3) , a second specificity for CD19 (e.g., human, cynomolgus monkey and mouse CD19) and a third specificity for CD20 (e.g., human, cynomolgus monkey and mouse CD20) . The polypeptide complexes preferably bind to CD3 with a moderate or even low affinity. Specifically, the CD3 x CD19 x CD20 trispecific polypeptide complexes are superior for inducing T-cell-specific cytotoxicity and cytokine production against CD19+ and / or CD20+ tumor cells compared to bispecific antibodies, and demonstrate significantly enhanced antitumor efficacy and the ability to overcome immune escape compared with the corresponding BsAbs alone or in combination. The novel approach herein provides unique insight into the structural optimization of T-cell-redirected multispecific antibodies using site-specific recombination and may be broadly applicable to heterogeneous and resistant tumor populations as well as solid tumors. The therapeutic advantage of the trispecific antibody over corresponding bispecific antibodies includes reduced toxic cytokine release and better tumor inhibition in xenograft tumor mouse models. Thus, the trispecific antibody not only showed the capacity to replace the bispecific antibodies, but also added value by enhancing the retargeting potency on tumor cells expressing both antigens.CD3-binding moietyCD3 is part of the T-cell receptor (TCR) which recognizes abnormal cells by binding antigens. The binding of CD3 by an antibody drives T-cell activation (without requiring antigen recognition by the TCR) , which leads to the killing of cancer cells and the production and release of toxic cytokine molecules. TCR includes antigen-recognition domains and delivers an activating signal to the T cell when an antigen binds to it. Engagement of CD3 by the antibody also generates an activating signal that activates T cells, bringing them into close proximity to cancer cells -irrespective of the T cell’s natural antigen specificity -and redirects their killing capabilities towards the cancer cells. Hence, CD3 targeting is an appealing strategy in designing multispecific antibodies.The CD3-TCR complex modulates T cell functions in both innate and adoptive immune response, as well as cellular and humoral immune functions. These include eliminating pathogenic organisms and controlling tumor growth by broad range of cytotoxic effects. Mouse monoclonal antibodies specific for human CD3, such as OKT3 (Kung et al., Science, 206: 347-9 (1979) ) , were the first generation CD3 antibodies developed for treatment. Although OKT3 has strong immunosuppressive potency, its clinical use was hampered by serious side effects linked to its immunogenic and mitogenic potentials (Chatenoud, Nature Reviews, 3: 123-132 (2003) ) . OKT3 induced an anti-globulin response, promoting its own rapid clearance and neutralization (Chatenoud et al., Eur. J. Immunol., 12: 979-82 (1982) ) . In addition, OKT3 induced T-cell proliferation and cytokine production in vitro, led to a large-scale release of cytokine in vivo (Hirsch et al., J. Immunol, 142: 737-43 (1989) ) . Such serious side effects limited the more widespread use of OKT3 in transplantation as well as the extension of its use to other clinical fields such as autoimmunity.The disclosure herein provides a CD3-binding moiety capable of binding CD3 (such as human, mouse or cyno CD3) , and a polypeptide complex or antigen-binding portion thereof comprising the CD3-binding moiety. The format of the CD3-binding moiety may be selected from Fab, Fab’, F (ab’) 2, scFv, VHH and diabody.In some embodiments, the CD3-binding moiety is derived from a parental anti-CD3 antibody. Specifically, the CD3-binding moiety as disclosed herein comprises:A) one or more heavy chain CDRs (HCDRs) selected from the group consisting of:(i) a HCDR1 comprising the amino acid sequence of SEQ ID NO: 7 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 7;(ii) a HCDR2 comprising the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 8; and(iii) a HCDR3 comprising the amino acid sequence of SEQ ID NO: 9 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 9;B) one or more light chain CDRs (LCDRs) selected from the group consisting of:(i) a LCDR1 comprising the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 10;(ii) a LCDR2 comprising the amino acid sequence of SEQ ID NO: 11 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 11; and(iii) a LCDR3 comprising the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 12; orC) one or more HCDRs of A) and one or more LCDRs of B) .In some embodiments, the substitution in the CDR is a conservative substitution. In some embodiments, the CD3-binding moiety comprises at least one, two, three, four, five, or six CDRs selected from: (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 7; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 8; (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 9; (d) LCDR1 comprising the amino acid sequence of SEQ ID NO: 10; (e) LCDR2 comprising the amino acid sequence of SEQ ID NO: 11; and (f) LCDR3 comprising the amino acid sequence of SEQ ID NO: 12. In some embodiments, the CD3-binding moiety comprises SEQ ID NOs: 7-9 in the heavy chain and SEQ ID NOs: 10-12 in the light chain.In some embodiments, the CD3-binding moiety has a heavy chain variable (VH) region comprising an amino acid sequence having at least 85%, at least 90%or at least 95%sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 21 and / or a light chain variable (VL) region comprising an amino acid sequence having at least 85%, at least 90%or at least 95%sequence identity (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 22. In some embodiments, the CD3-binding moiety has a VH region comprising the amino acid sequence of SEQ ID NO: 21 and a VL region comprising the amino acid sequence of SEQ ID NO: 22.In some embodiments, the CD3-binding moiety comprises at least one, at least two, or all three HCDRs of the VH region as set forth in SEQ ID NO: 21, and at least one, at least two, or all three LCDRs of the VL region as set forth in SEQ ID NO: 22.In some embodiments, the CD3-binding moiety comprises (a) a VH region comprising at least one, at least two, or all three HCDRs selected from HCDR1 comprising the amino acid sequence of SEQ ID NO: 7, HCDR2 comprising the amino acid sequence of SEQ ID NO: 8, and HCDR3 comprising the amino acid sequence selected of SEQ ID NO: 9; and (b) a VL region comprising at least one, at least two, or all three LCDR sequences selected from LCDR1 comprising the amino acid sequence of SEQ ID NO: 10, LCDR2 comprising the amino acid sequence of SEQ ID NO: 11, and LCDR3 comprising the amino acid sequence of SEQ ID NO: 12.Further, the CD3-binding moiety may comprise at least one, two, three or four of heavy chain framework regions (designated as FR-H1, FR-H2, FR-H3 and FR-H4) same as those of the VH region as set forth in SEQ ID NO: 21, and / or at least one, two, three, four of the light chain framework regions (designated as FR-L1, FR-L2, FR-L3 and FR-L4) same as those of the VL region as set forth in SEQ ID NO: 22.In some embodiments, the framework (FR) regions are derived from human germline, e.g. a human immunoglobulin. In some embodiments, the FR regions may include one or more individual FR residue modifications that improve antibody performance, such as stability, binding affinity, isomerization, immunogenicity, etc. For example, the FR regions may comprise a PTM-removal modification to avoid post-translational modification (PTM) . PTMs mainly include isomerization, deamination, glycosylation and oxidation in antibody discovery, all of them have a typical amino acid site, e.g. “DG” for isomerization, “NG” for deamination, “N*T / S” (*stand for other amino acid except P or D) for glycosylation and “M” or “C” for oxidation. Once the PTM sites are found in antibody sequence, especially in key regions like CDR3, PTM removal may be needed to avoid the potential risk of PTM modification while minimally affecting the binding compared to the parental antibody.Unless indicated otherwise, the CDRs of the antigen-binding moieties as disclosed herein are identified according to IMGT-Kabat definition / scheme. As familiar to a skilled person, variable regions and CDRs in an antibody sequence can be identified according to general rules that have been developed in the art or by aligning the sequences against a database of known variable regions. CDRs have been described by Kabat et al., J. Biol. Chem. 252: 6609-6616 (1977) ; Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of proteins of immunological interest” (1991) ; by Chothia et al., J. Mol. Biol. 196: 901-917 (1987) ; and MacCallum et al., J. Mol. Biol. 262: 732-745 (1996) , where the definitions include overlapping or subsets of amino acid residues when compared against each other. Methods for identifying these regions are also described in e.g., Kontermann and Dubel, eds., Antibody Engineering, Springer, New York, NY, 2001 and Dinarello et al., Current Protocols in Immunology, John Wiley and Sons Inc., Hoboken, NJ, 2000. Exemplary databases of antibody sequences are described in, and can be accessed through, the “Abysis” website at www. bioinf. org. uk / abs (maintained by A. C. Martin in the Department of Biochemistry &Molecular Biology University College London, London, England) and the VBASE2 website at www. vbase2. org, as described in Retter et al., Nucl. Acids Res., 33 (Database issue) : D671 -D674 (2005) . The Abysis database integrates sequence data from Kabat, IMGT and the Protein Data Bank (PDB) with structural data from the PDB. See Dr. Andrew C.R. Martin's book chapter Protein Sequence and Structure Analysis of Antibody Variable Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg, ISBN-13: 978-3540413547, also available on the website bioinforg. uk / abs) . The Abysis database website further includes general rules that have been developed for identifying CDRs which can be used in accordance with the teachings herein. As would be readily appreciated, application of any definition to refer to a CDR of the antibody as disclosed herein is intended to be within the scope of present application. Although CDRs indicated in Table A below are defined by the Kabat and IMGT numbering system, the Contact, Chothia, MacCallum, and other schemes known in the art could also be used to define the CDRs.The CD3-binding moiety as exemplified herein is in Fab format, but it is not restricted to a Fab format. The Fab format of the CD3-binding moiety comprises a first VH operably linked to an antibody heavy chain CH1 domain (VH1-CH1) , and a first VL operably linked to an antibody light chain constant (CL) domain (VL1-CL) . The CD3-binding moieties herein also encompass engineered or chimeric Fabs in which e.g. the CH1 and CL of the CD3-binding moieties are replaced by a pair of TCR constant regions, to distinguish between the CD3-binding Fabs and other antigen-binding Fabs.CD19-binding moietyHuman CD19 is a type I transmembrane protein belonging to the immunoglobulin superfamily (Carter et al., Curr Dir Autoimmun, 7: 4–32 (2004) ) . It is expressed on most B cells, but not detected on plasma cells, stem cells, or on normal myeloid lineage (Tedder, Nat Rev Rheumatol, 5 (10) : 572–577 (2009) ) . CD19 is critically involved in establishing intrinsic B cell signaling thresholds through modulating both B cell receptor (BCR) -dependent and independent signaling (Wang et al., Experimental Hematology &Oncology, 1: 36 (2012) ) . CD19 has broader expression than CD20. The pattern of CD19 expression is maintained in B-cell malignancies, covering all subtypes of B-cell lymphoma, from indolent to aggressive forms, as well as B-cell chronic lymphocytic leukemia and non-T acute lymphoblastic leukemia, and allows the targeting of tumor indications of early B cells, such as acute lymphoblastic leukemia (ALL) , which cannot be targeted by Rituximab. Several CD19 monoclonal antibodies have been explored for lymphoma therapy (U.S. Patent Application Publication No. 20140072587 A1, U.S. Patent No. 8,242,252 B2, and U.S. Patent No. 8,097,703 B2) .The disclosure herein provides a CD19-binding moiety capable of binding CD19 (such as human, mouse or cyno CD19) , and a polypeptide complex or antigen-binding portion thereof comprising the CD19-binding moiety. The format of the CD19-binding moiety may be selected from Fab, Fab’, F (ab’) 2, scFv, VHH and diabody.In some embodiments, the CD19-binding moiety is derived from a parental anti-CD19 antibody. The parental antibodies may be already developed and known to the public or developed de novo. There are a wide variety of known and useful anti-CD19 antibodies with varying binding affinity. The CD19-binding moiety may comprise same CDR sequences or highly homologous CDR sequences of the parental antibody, and preferably, comprises the variable regions of the parental antibody. The CD19-binding moiety may also comprise variations in the CDR regions, framework regions and / or constant regions of the parental antibody while retaining the antigen-binding specificity. For example, compared to the original CDR sequences of parental antibody, one or two amino acids in the CDR or framework regions of the derived antigen-binding moiety may be modified to e.g. reduce the risk of glycosylation and deamidation.Specifically, the CD19-binding moiety as disclosed herein comprises:A) one or more heavy chain CDRs (HCDRs) selected from the group consisting of:(i) a HCDR1 comprising the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 1;(ii) a HCDR2 comprising the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 2; and(iii) a HCDR3 comprising the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 3;B) one or more light chain CDRs (LCDRs) selected from the group consisting of:(i) a LCDR1 comprising the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 4;(ii) a LCDR2 comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 5; and(iii) a LCDR3 comprising the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 6; orC) one or more HCDRs of A) and one or more LCDRs of B) .In some embodiments, the substitution in the CDR is a conservative substitution. In some embodiments, the CD19-binding moiety comprises at least one, two, three, four, five, or six CDRs selected from: (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 1; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 2; (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 3; (d) LCDR1 comprising the amino acid sequence of SEQ ID NO: 4; (e) LCDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (f) LCDR3 comprising the amino acid sequence of SEQ ID NO: 6. In some embodiments, the CD19-binding moiety comprises SEQ ID NOs: 1-3 in the heavy chain and SEQ ID NOs: 4-6 in the light chain.In some embodiments, the CD19-binding moiety has a heavy chain variable (VH) region comprising an amino acid sequence having at least 85%, at least 90%or at least 95%sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 19 and / or a light chain variable (VL) region comprising an amino acid sequence having at least 85%, at least 90%or at least 95%sequence identity (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 20. In some embodiments, the CD19-binding moiety has a VH region comprising the amino acid sequence of SEQ ID NO: 19 and a VL region comprising the amino acid sequence of SEQ ID NO: 20.In some embodiments, the CD19-binding moiety comprises at least one, at least two, or all three HCDRs of the VH region as set forth in SEQ ID NO: 19, and at least one, at least two, or all three LCDRs of the VL region as set forth in SEQ ID NO: 20.In some embodiments, the CD19-binding moiety comprises (a) a VH region comprising at least one, at least two, or all three HCDRs selected from HCDR1 comprising the amino acid sequence of SEQ ID NO: 1, HCDR2 comprising the amino acid sequence of SEQ ID NO: 2, and HCDR3 comprising the amino acid sequence selected of SEQ ID NO: 3; and (b) a VL region comprising at least one, at least two, or all three LCDR sequences selected from LCDR1 comprising the amino acid sequence of SEQ ID NO: 4, LCDR2 comprising the amino acid sequence of SEQ ID NO: 5, and LCDR3 comprising the amino acid sequence of SEQ ID NO: 6.Further, the CD19-binding moiety may comprise at least one, two, three or four of heavy chain framework regions (designated as FR-H1, FR-H2, FR-H3 and FR-H4) same as those of the VH region as set forth in SEQ ID NO: 19, and / or at least one, two, three, four of the light chain framework regions (designated as FR-L1, FR-L2, FR-L3 and FR-L4) same as those of the VL region as set forth in SEQ ID NO: 20.The CD19-binding moiety as exemplified herein is in Fab format, but it is not restricted to a Fab format. The Fab format of the CD19-binding moiety comprises a first VH operably linked to an antibody heavy chain CH1 domain (VH1-CH1) , and a first VL operably linked to an antibody light chain constant (CL) domain (VL1-CL) . The CD19-binding moieties herein also encompass engineered Fabs in which e.g. the CH1 and CL of the CD19-binding moieties are replaced by a pair of TCR (T cell receptor) constant regions, to distinguish between the CD19-binding Fabs and other antigen-binding Fabs. Preferably, the pair of TCR constant regions for constructing the antibodies herein are derived from wild type TCR constant regions, but further comprises one or more substitutions, additions or deletions of one or more amino acids that improve the association of the two TCR constant regions. In some embodiments, the CD19-binding moiety may comprise an engineered TCR beta chain constant region and an engineered TCR alpha chain constant region. As illustrated in the present application, the CD19-binding moiety may comprise a Cβ region with the sequence as shown in SEQ ID NO: 34 and a Cα region with the sequence as shown in SEQ ID NO: 35. Multiple TCR constant region variants which can find use in constructing multi-specific antibody formats have been disclosed in PCT / CN2021 / 072601, the full content of which is incorporated herein by reference. Preferably, the TCR constant regions may be engineered to comprise one or more cysteine amino acids to form one or more non-native disulfide bonds, so that the dimer formed by the two constant regions has a better stability, expression and heterodimerization. In some embodiments, the CD19-binding moiety may comprise a Cβ region having at least 90%sequence identity (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 34 and a Cα region having at least 90%sequence identity (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 35.CD20-binding moietyHuman CD20 is an activated-glycosylated phosphoprotein expressed on the surface of B lymphocytes. Antibody therapy with Rituximab, a chimeric anti-CD20 monoclonal antibody approved by FDA in 1997, represents one of the most important progresses in the treatment of lymphoproliferative disorders in the last 30 years. Particularly, in combination with various chemotherapy / radiotherapy regimes, Rituximab has significantly improved all aspects of the survival statistics of B cell lymphoma and chronic lymphoid lymphoma (CLL) patients (Chu et al., Theranostics, 5 (8) : 834-46 (2015) ) .The disclosure herein provides a CD20-binding moiety capable of binding CD20 (such as human, mouse or cyno CD20) , and a polypeptide complex or antigen-binding portion thereof comprising the CD20-binding moiety. The format of the CD20-binding moiety may be selected from Fab, Fab’ , F (ab’ ) 2, scFv, VHH and diabody.In some embodiments, the CD20-binding moiety is derived from a parental anti-CD20 antibody. The parental antibodies may be already developed and known to the public or developed de novo. There are a wide variety of known and useful anti-CD20 antibodies with varying binding affinity. The CD20-binding moiety may comprise same CDR sequences or highly homologous CDR sequences of the parental antibody, and preferably, comprises the variable regions of the parental antibody. The CD20-binding moiety may also comprise variations in the CDR regions, framework regions and / or constant regions of the parental antibody while retaining the antigen-binding specificity. For example, compared to the original CDR sequences of parental antibody, one or two amino acids in the CDR or framework regions of the derived antigen-binding moiety may be modified to e.g. reduce the risk of glycosylation and deamidation.Specifically, the CD20-binding moiety as disclosed herein comprises:A) one or more heavy chain CDRs (HCDRs) selected from the group consisting of:(i) a HCDR1 comprising the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 13;(ii) a HCDR2 comprising the amino acid sequence of SEQ ID NO: 14 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 14; and(iii) a HCDR3 comprising the amino acid sequence of SEQ ID NO: 15 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 15;B) one or more light chain CDRs (LCDRs) selected from the group consisting of:(i) a LCDR1 comprising the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 16;(ii) a LCDR2 comprising the amino acid sequence of SEQ ID NO: 17 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 17; and(iii) a LCDR3 comprising the amino acid sequence of SEQ ID NO: 18 or an amino acid sequence with addition, deletion and / or substitution of no more than 1, 2 or 3 amino acids compared with SEQ ID NO: 18; orC) one or more HCDRs of A) and one or more LCDRs of B) .In some embodiments, the substitution in the CDR is a conservative substitution. In some embodiments, the CD20-binding moiety comprises at least one, two, three, four, five, or six CDRs selected from: (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 13; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 14; (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 15; (d) LCDR1 comprising the amino acid sequence of SEQ ID NO: 16; (e) LCDR2 comprising the amino acid sequence of SEQ ID NO: 17; and (f) LCDR3 comprising the amino acid sequence of SEQ ID NO: 18. In some embodiments, the CD20-binding moiety comprises SEQ ID NOs: 13-15 in the heavy chain and SEQ ID NOs: 16-18 in the light chain.In some embodiments, the CD20-binding moiety has a heavy chain variable (VH) region comprising an amino acid sequence having at least 85%, at least 90%or at least 95%sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 23 and / or a light chain variable (VL) region comprising an amino acid sequence having at least 85%, at least 90%or at least 95%sequence identity (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 24. In some embodiments, the CD20-binding moiety has a VH region comprising the amino acid sequence of SEQ ID NO: 23 and a VL region comprising the amino acid sequence of SEQ ID NO: 24.In some embodiments, the CD20-binding moiety comprises at least one, at least two, or all three HCDRs of the VH region as set forth in SEQ ID NO: 23, and at least one, at least two, or all three LCDRs of the VL region as set forth in SEQ ID NO: 24.In some embodiments, the CD20-binding moiety comprises (a) a VH region comprising at least one, at least two, or all three HCDRs selected from HCDR1 comprising the amino acid sequence of SEQ ID NO: 13, HCDR2 comprising the amino acid sequence of SEQ ID NO: 14, and HCDR3 comprising the amino acid sequence selected of SEQ ID NO: 15; and (b) a VL region comprising at least one, at least two, or all three LCDR sequences selected from LCDR1 comprising the amino acid sequence of SEQ ID NO: 16, LCDR2 comprising the amino acid sequence of SEQ ID NO: 17, and LCDR3 comprising the amino acid sequence of SEQ ID NO: 18.Further, the CD20-binding moiety may comprise at least one, two, three or four of heavy chain framework regions (designated as FR-H1, FR-H2, FR-H3 and FR-H4) same as those of the VH region as set forth in SEQ ID NO: 23, and / or at least one, two, three, four of the light chain framework regions (designated as FR-L1, FR-L2, FR-L3 and FR-L4) same as those of the VL region as set forth in SEQ ID NO: 24.The CD20-binding moiety as exemplified herein is in Fab format, but it is not restricted to a Fab format. The Fab format of the CD20-binding moiety comprises a first VH operably linked to an antibody heavy chain CH1 domain (VH1-CH1) , and a first VL operably linked to an antibody light chain constant (CL) domain (VL1-CL) . The CD20-binding moieties herein also encompass engineered Fabs in which e.g. the CH1 and CL of the CD20-binding moieties are replaced by a pair of TCR (T cell receptor) constant regions, to distinguish between the CD20-binding Fabs and other antigen-binding Fabs. Preferably, the pair of TCR constant regions for constructing the antibodies herein are derived from wild type TCR constant regions, but further comprises one or more substitutions, additions or deletions of one or more amino acids that improve the association of the two TCR constant regions. In some embodiments, the CD20-binding moiety may comprise an engineered TCR beta chain constant region and an engineered TCR alpha chain constant region. As illustrated in the present application, the CD20-binding moiety may comprise a Cβ region with the sequence as shown in SEQ ID NO: 34 and a Cα region with the sequence as shown in SEQ ID NO: 35. Preferably, the TCR constant regions may be engineered to comprise one or more cysteine amino acids to form one or more non-native disulfide bonds, so that the dimer formed by the two constant regions has a better stability, expression and heterodimerization. In some embodiments, the CD19-binding moiety may comprise a Cβ region having at least 90%sequence identity (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 34 and a Cα region having at least 90%sequence identity (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%sequence identity) to SEQ ID NO: 35.Preferably, an amino acid sequence at least 85%, at least 90%, or at least 95%identical to any of SEQ ID NOs: 19-24 has the same CDR sequences as those of SEQ ID NOs: 19-24, and the amino acid changes only take place in the framework regions. The percent identity between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4: 11-17 (1988) ) which has been incorporated into the ALIGN program (version 2.0) , using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percentage of identity between two amino acid sequences can be determined by the algorithm of Needleman and Wunsch (J. Mol. Biol. 48: 444-453 (1970) ) which has been incorporated into the GAP program in the GCG software package (available at http:  / / www. gcg. com) , using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.Additionally or alternatively, the protein sequences of the present disclosure can further be used as a “query sequence” to perform a search against public databases to, for example, identify related sequences. Such searches can be performed using the XBLAST program (version 2.0) of Altschul, et al. (1990) J. MoI. Biol. 215: 403-10. BLAST protein searches can be performed with the XBLAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to the antibody molecules of the present disclosure. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al, (1997) Nucleic Acids Res. 25 (17) : 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. See www. ncbi. nlm. nih. gov.The amino acid sequences of the heavy chain variable region and / or the light chain variable regions can be at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%, preferable, at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%or 99%, more preferably, at least 95%, 96%, 97%, 98%or 99%, identical to the respective sequences set forth above.In some further embodiments, the antibody or the antigen-binding portion thereof may contain conservative substitution or modification of amino acids in the variable regions of the heavy chain and / or light chain. It is understood in the art that certain conservative sequence modification can be made which do not remove antigen binding. See, e.g., Brummell et al. (1993) Biochem 32: 1180-8; de Wildt et al. (1997) Prot. Eng. 10: 835-41; Komissarov et al. (1997) J. Biol. Chem. 272: 26864-26870; Hall et al. (1992) J. Immunol. 149: 1605-12; Kelley and O’ Connell (1993) Biochem. 32: 6862-35; Adib-Conquy et al. (1998) Int. Immunol. 10: 341-6 and Beers et al. (2000) Clin. Can. Res. 6: 2835-43.As described above, the term “conservative substitution” refers to amino acid substitutions which would not disadvantageously affect or change the essential properties of a protein / polypeptide comprising the amino acid sequence. For example, a conservative substitution may be introduced by standard techniques known in the art such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions include substitutions wherein an amino acid residue is substituted with another amino acid residue having a similar side chain, for example, a residue physically or functionally similar (such as, having similar size, shape, charge, chemical property including the capability of forming covalent bond or hydrogen bond, etc. ) to the corresponding amino acid residue. The families of amino acid residues having similar side chains have been defined in the art. These families include amino acids having alkaline side chains (for example, lysine, arginine and histidine) , amino acids having acidic side chains (for example, aspartic acid and glutamic acid) , amino acids having uncharged polar side chains (for example, glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan) , amino acids having nonpolar side chains (for example, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine) , amino acids having β-branched side chains (such as threonine, valine, isoleucine) and amino acids having aromatic side chains (for example, tyrosine, phenylalanine, tryptophan, histidine) . Therefore, a corresponding amino acid residue is preferably substituted with another amino acid residue from the same side-chain family. Methods for identifying amino acid conservative substitutions are well known in the art (see, for example, Brummell et al., Biochem. 32: 1180-1187 (1993) ; Kobayashi et al., Protein Eng. 12 (10) : 879-884 (1999) ; and Burks et al., Proc. Natl. Acad. Sci. USA 94: 412-417 (1997) , which are incorporated herein by reference) .Structure and Format of the CD3×CD19×CD20 multispecific polypeptide complexIn some embodiments, the polypeptide complex or antigen binding fragment thereof comprises one or more CD19 binding moiety, one or more CD3 binding moiety and one or more CD20 binding moiety that are covalently linked or non-covalently associated together in one or more polypeptide chains. For example, the polypeptide complex or antigen binding fragment thereof may comprise: two CD19 binding moieties, one CD3 binding moiety and one CD20 binding moiety; one CD19 binding moiety, two CD3 binding moieties and one CD20 binding moiety; or one CD19 binding moiety, one CD3 binding moiety and two CD20 binding moieties. When there are more than one moiety targeting the same antigen, they can be same or different in sequence. Preferably, the more than one moiety targeting a certain antigen are the same.In some embodiments, the polypeptide complex or antigen binding fragment thereof comprises one CD19 binding moiety, one CD3 binding moiety and one CD20 binding moiety. Similar to an ordinary IgG antibody, the polypeptide complex or antigen binding fragment thereof comprises a first binding arm and a second binding arm that stem from the Fc region, with each arm binding to one or more antigen (s) . In some embodiments, the first binding arm comprises the CD19 binding moiety operably linked to the CD3 binding moiety and the second binding arm comprises the CD20 binding moiety. In some other embodiments, the first binding arm comprises the CD20 binding moiety operably linked to the CD3 binding moiety and the second binding arm comprises the CD19 binding moiety. Still in some other embodiments, the first binding arm comprises the CD19 binding moiety operably linked to the CD20 binding moiety and the second binding arm comprises the CD3 binding moiety.In embodiments where there are two CD19 binding moieties per molecule, the two CD19 binding moieties may be constructed on the same binding arm or on different binding arms. For example, the first binding arm comprises the CD20 binding moiety operably linked to the CD3 binding moiety and the second binding arm comprises the two CD19 binding moieties operably linked together; alternatively, the first binding arm comprises the CD20 binding moiety operably linked to the CD19 binding moiety and the second binding arm comprises the CD3 binding moiety operably linked to the CD19 binding moiety.In embodiments where there are two CD3 binding moieties per molecule, the two CD3 binding moieties may be constructed on the same binding arm or on different binding arms. For example, the first binding arm comprises the CD20 binding moiety operably linked to the CD19 binding moiety and the second binding arm comprises the two CD3 binding moieties operably linked together; alternatively, the first binding arm comprises the CD20 binding moiety operably linked to the CD3 binding moiety and the second binding arm comprises the CD19 binding moiety operably linked to the CD3 binding moiety.In embodiments where there are two CD20 binding moieties per molecule, the two CD20 binding moieties may be constructed on the same binding arm or on different binding arms. For example, the first binding arm comprises the CD3 binding moiety operably linked to the CD19 binding moiety and the second binding arm comprises the two CD20 binding moieties operably linked together; alternatively, the first binding arm comprises the CD20 binding moiety operably linked to the CD3 binding moiety and the second binding arm comprises the CD20 binding moiety operably linked to the CD19 binding moiety.In some embodiments, the multi-specific polypeptide complex comprises two heterologous heavy chains and 3 light chains associated non-covalently to form three antigen binding moieties targeting CD3, CD19 and CD20, respectively.In some embodiments, the polypeptide complex or the antigen-binding portion thereof comprises a CD19 binding moiety, a CD3 binding moiety and a CD20 binding moiety, and the polypeptide complex comprises two heavy chains (HC1 and HC2) and three light chains (LC1, LC2, LC3) , wherein from N terminus to C terminus, HC1, HC2, LC1, LC2 and LC3 comprises domains operably linked as in the following formats, respectively:(a) CD19VH-C1-CD3VL-C2-Fc, CD20VH-CH1-Fc, CD19VL-C2, CD3VH-C1, CD20VL-CL;(b) CD19VL-C2-CD3VH-C1-Fc, CD20VH-CH1-Fc, CD19VH-C1, CD3VL-C2, CD20VL-CL;(c) CD3VH-C1-CD19VL-C2-Fc, CD20VH-CH1-Fc, CD3VL-C2, CD19VH-C1, CD20VL-CL;(d) CD3VL-C2-CD19VH-C1-Fc, CD20VH-CH1-Fc, CD3VH-C1, CD19VL-C2, CD20VL-CL;(e) CD19VH-C1-CD20VL-C2-Fc, CD3VH-CH1-Fc, CD19VL-C2, CD20VH-C1, CD3VL-CL;(f) CD19VL-C2-CD20VH-C1-Fc, CD3VH-CH1-Fc, CD19VH-C1, CD20VL-C2, CD3VL-CL;(g) CD20VH-C1-CD19VL-C2-Fc, CD3VH-CH1-Fc, CD20VL-C2, CD19VH-C1, CD3VL-CL;(h) CD20VL-C2-CD19VH-C1-Fc, CD3VH-CH1-Fc, CD20VH-C1, CD19VL-C2, CD3VL-CL;(i) CD3VH-C1-CD20VL-C2-Fc, CD19VH-CH1-Fc, CD3VL-C2, CD20VH-C1, CD19VL-CL;(j) CD3VL-C2-CD20VH-C1-Fc, CD19VH-CH1-Fc, CD3VH-C1, CD20VL-C2, CD19VL-CL;(k) CD20VH-C1-CD3VL-C2-Fc, CD19VH-CH1-Fc, CD20VL-C2, CD3VH-C1, CD19VL-CL;and(l) CD20VL-C2-CD3VH-C1-Fc, CD19VH-CH1-Fc, CD20VH-C1, CD3VL-C2, CD19VL-CL;wherein CD19VH and CD19VL are the VH and VL regions of the CD19-binding moiety, CD3VH and CD3VL are the VH and VL regions of the CD3-binding moiety, CD20VH and CD20VL are the VH and VL regions of the CD20-binding moiety, and “-” represents a direct linkage or an indirect linkage via a peptide linker.The trispecific antibodies as disclosed herein are trivalent, comprising 3 Fabs each targeting CD3, CD19 and CD20, respectively. The trispecific antibodies bind CD19 and have a variable region comprising a VH having the sequence of SEQ ID NO: 19 and a VL having the sequence of SEQ ID NO: 20. In addition, the trispecific antibodies bind CD3 and have a variable region comprising a VH having the sequence of SEQ ID NO: 21 and a VL having the sequence of SEQ ID NO: 22. In addition, the trispecific antibodies bind CD20 and have a variable region comprising a variable heavy domain having the sequence of SEQ ID NO: 23 and a variable light domain having the sequence of SEQ ID NO: 24. Specifically, the polypeptide complex as disclosed herein comprises a first and a second heavy chain that comprise SEQ ID NOs: 25 and 26 respectively, and a first, second and third light chain that comprise SEQ ID NOs: 27, 28 and 29 respectively (W333021-U8T3W2. I27-61. uIgG4V9) .Fc regionThe Fc region (also referred to as “Fc domain” ) of the multispecific antibodies disclosed herein is preferably a human IgG Fc region. The IgG Fc region may be of any isotype, including, but not limited to, IgG1, IgG2, IgG3 or IgG4. In certain embodiments, the Fc region is of the IgG4 isotype. The IgG class is divided in four isotypes: IgG1, IgG2, IgG3 and IgG4 in humans.In the context of the present disclosure, the Fc region may comprise one or more amino acid changes (e.g., insertions, deletions or substitutions) as compared to wild-type Fc region. An Fc variant can possess at least about 80%homology with a native sequence Fc region, or at least about 90%homology therewith, for example, at least about 95%homology therewith. The disclosure encompasses polypeptide complexes comprising one or more modifications in the Fc region to obtain the desired functionality, e.g., a “knob into hole” structure to promote heterodimerization, or a modified Fc region to change the binding interaction between Fc and FcRn or FcγR.The term “knob into hole” , as used herein, refers to engineering the CH3 domain of antibody Fc region to create either a “knob” or a “hole” in each heavy chain to promote heterodimerization. A knob can be obtained by replacement of a small amino acid residue with a larger one in the first CH2 / CH3 polypeptide, and a hole can be obtained by replacement of a large residue with a smaller one. For details of the mutation sites for knobs into holes please see Spiess et al., 2015, supra and Brinkmann et al., 2017, supra; US patent application US2003078385A1. Generally, a “knob” is created by replacing T366 with a bulky residue W on one heavy chain, and the corresponding “hole” is made by triple mutations of T366S, L368A and Y407V on the other heavy chain, according to EU numbering as in Kabat et al. In some embodiments, a “hole” mutation is Y349C, T366S, L368A, and / or Y407V, and a “knob” mutation is S354C and / or T366W. In some embodiments, the heavy chain of the multispecific antibodies comprising the CD19 binding moiety and CD3 binding moiety has the “hole” structure, while the heavy chain comprising the CD20 binding moiety has the “knob” structure. Alternatively, the heavy chain of the multispecific antibodies comprising the CD19 binding moiety and CD3 binding moiety has the “knob” structure, while the heavy chain comprising the CD20 binding moiety has the “hole” structure.In certain embodiments, the first heavy chain of the polypeptide complex comprises a Fc region of IgG1 isotype that comprises S354C and T366W substitutions (knob) , and the second heavy chain of the polypeptide complex comprises a Fc region of IgG1 isotype that comprises Y349C, T366S, L368A and Y407V substitutions (hole) . In some other embodiments, the first heavy chain of the polypeptide complex comprises a Fc region of IgG4 isotype, wherein the Fc region comprises S354C and T366W substitutions (knob) , and the second heavy chain of the polypeptide complex comprises a Fc region of IgG4 isotype, wherein the Fc region comprises Y349C, T366S, L368A and Y407V substitutions (hole) .In addition, the Fc region may comprise one or more amino acid modification (e.g., Leu234Ala / Leu235Ala, i.e. LALA, or F234A / L235A, i.e. FALA) that alters the antibody-dependent cellular cytotoxicity (ADCC) or other effector functions. In certain embodiments, the Fc modification comprise a FALA mutation, i.e., mutations of F234A and L235A, according to EU numbering as in Kabat et al. LALA and FALA mutations are commonly used for disrupting antibody effector function, e.g., eliminate Fc binding to specific FcγRs, reduce ADCC activity mediated by PBMCs and monocytes. Additionally, it has been found that therapeutic potential may be enhanced by the introduction of YTE (M252Y / S254T / T256E) and LS (M428L / N434S) in the Fc regions, as a consequence of increased half-lives and prolonged duration of protection. The S228P mutation has also been found to prevent in vivo and in vitro IgG4 Fab-arm exchange as demonstrated using a combination of novel quantitative immunoassays and physiological matrix preparation (J Biol Chem 2015 Feb 27; 290 (9) : 5462-9) .The polypeptide complex as disclosed herein may comprise a Fc region having one of the following: a “knob into hole” structure, a S228P mutation, a FALA mutation, a LALA mutation and M252Y / S254T / T256E mutations.The “EU numbering system” or “EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region (e.g., the EU index reported in Kabat et al., supra) . The “EU numbering as in Kabat” or “EU index as in Kabat” refers to the residue numbering of the human IgG1 EU antibody. Unless stated otherwise herein, references to residue numbers in the constant domain of antibodies means residue numbering by the EU numbering system.LinkerThe heavy chains of the antigen-binding moieties are operably linked with each other, and the heavy chains of the antigen-binding moieties are operably linked to the Fc region. The term “operably linked” includes a direct linkage without any linker, and an indirect linkage using a linker such as a peptide linker. The peptide linker should have a length that is adequate to link two portions in such a way that they assume the correct conformation relative to one another so that they retain the desired activity.In one embodiment, the linker is from about 1 to 50 amino acids in length, preferably about 1 to 30 amino acids in length. In one embodiment, linkers of 1 to 20 amino acids in length may be used, with from about 5 to about 10 amino acids finding use in some embodiments. Useful linkers include glycine-serine polymers, including for example (GS) n, (GSGGS) n, (GGGGS) n, and (GGGS) n, where n is an integer of at least one (and generally from 3 to 4) , glycine-alanine polymers, alanine-serine polymers, and other flexible linkers. Alternatively, a variety of nonproteinaceous polymers, including but not limited to polyethylene glycol (PEG) , polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol, may find use as linkers.Linkers can be derived from immunoglobulins and other proteins such as Ig-like proteins (e.g. TCR, FcR, KIR) , hinge region-derived sequences, and other natural sequences from other proteins. Immunoglobin hinge region that links the Fab with the Fc region also belongs to a peptide linker.Properties of the polypeptide complexIn some embodiments, the polypeptide complex is capable of binding to CD3, CD19 and CD20. The binding of an antibody to antigen (s) can be assessed using one or more techniques well established in the art, for instance, ELISA or FACS, which measures binding of the antibody to antigen protein (s) solubilized in solution or expressed on cell surfaces, respectively. For example, an antibody can be tested by a flow cytometry assay in which the antibody is reacted with a cell line that expresses human CD3, CD19 and / or CD20, such as CHO cells that have been transfected to express CD3, CD19 or CD20 on their cell surface, or a CD3, CD19 and / or CD20 positive cell line, such as Jurkat (CD3 positive) and Raji (CD19 and CD20 positive) cells. Additionally or alternatively, the binding of the antibody, including the binding kinetics (e.g., KD value) can be tested in BIAcore binding assays.In some embodiments, the trispecific polypeptide complexes of the disclosure could bind to human CD3 expressing cells with a significantly lower affinity than anti-CD3 control antibodies (such as REGN1979) , as shown in MFI (mean fluorescence intensity) measured by FACS. Still, the CD3 binding of the trispecific polypeptide complexes is stronger than a negative control.In some embodiments, the trispecific polypeptide complexes of the disclosure could bind to human CD19 expressing cells with an affinity comparable to or better than anti-CD19 control antibodies (such as REGN1979) , as measured by FACS. In some embodiments, the trispecific polypeptide complexes of the disclosure could bind to human CD20 expressing cells with an affinity comparable to or better than anti-CD20 control antibodies (such as REGN1979) , as measured by FACS.In some embodiments, the trispecific polypeptide complexes of the disclosure could bind to human CD19 and CD20 expressing cells (e.g. Raji cells) with an affinity comparable to or better than control antibodies (such as REGN1979) , as measured by FACS.In some embodiments, the trispecific polypeptide complexes of the disclosure could induce a stronger or comparable T-cell mediated killing effect on CD19 and CD20 expressing tumor cells, such as Raji and Nalm-6 cells, compared to control antibodies (such as REGN1979) , as measured by FACS.In some embodiments, the trispecific polypeptide complexes of the disclosure could induce a milder T-cell mediated stimulation of cytokines than control antibodies (such as REGN1979) , thus less prone to lead to toxic cytokine release.Each antibody has a characteristic melting temperature, with a higher melting temperature indicating greater overall stability in vivo (Krishnamurthy R and Manning MC (2002) Curr Pharm Biotechnol 3: 361-71) . Generally, it is preferred that the Tm1 (the temperature of initial unfolding) be greater than 60 ℃, preferably greater than 65 ℃. The melting point of an antibody can be measured using differential scanning calorimetry (Chen et al (2003) Pharm Res 20: 1952-60; Ghirlando et al (1999) Immunol Lett 68: 47-52) or circular dichroism (Murray et al. (2002) J. Chromatogr Sci 40: 343-9) .In some preferred embodiments, the antibodies as disclosed herein have minimal or low aggregation effects, which can lead to the triggering of an unwanted immune response and / or altered or unfavorable pharmacokinetic properties. Aggregation can be measured by several techniques, including size-exclusion column (SEC) , high performance liquid chromatography (HPLC) , and light scattering.In summary, the polypeptide complexes as disclosed herein are characterized by particular functional features or properties and have one or more of the following properties:(a) a milder binding to CD3 and thus reduced T cell stimulation level and reduced risk of CRS, compared with positive control antibodies;(b) a comparable or better binding to CD19 and CD20, compared with positive control antibodies;(c) bind tumor cells that express both CD19 and CD20, mediating more potent killing, and significantly improved potency to CD19 and / or CD20 expressing tumor cells with lower cytokine release;(d) have no cross-activity to paralog proteins of CD3, CD19 and CD20;(e) show stronger or comparable T-cell mediated killing effect on CD19 and CD20 expressing tumor cells, could redirect T cell to effectively kill escaped tumor cells (either CD19-CD20+ or CD19+CD20-) , achieving broader coverage to tumors with lower CD20 (or CD19) expression;(f) have good antibody developability, including thermal stability, solubility, hydrophobicity and low aggregation propensity;(g) significantly improved efficacy in treating CD19 and / or CD20 expressing cancer, as demonstrated in in vivo mouse model; and(i) have acceptable pharmacokinetic profiles in rats.Preparation of the multispecific polypeptide complexes or antibodiesA variety of recombinant methods can be used to produce multi-specific antibodies and antibody fragments as described above. In general, multi-specific antibodies are made by including genes for each heavy and light chain into the host cells. There are a number of mechanisms that can be used to generate the heterodimers of the present invention. In addition, these mechanisms can be combined to ensure high heterodimerization. Thus, amino acid variants that lead to the production of heterodimers are referred to as "heterodimerization variants" . As known by those in the art, heterodimerization variants can include steric variants (e.g. the "knobs and holes" or "skew" variants described below and the "charge pairs" variants) as well as "pi variants" , which allows purification of homodimers away from heterodimers. As is generally described in WO2014 / 145806, hereby incorporated by reference in its entirety and specifically as below for the discussion of "heterodimerization variants" , useful mechanisms for heterodimerization include "knobs and holes" ( "KIH" ; sometimes herein as "skew" variants (see discussion in WO2014 / 145806) , "electrostatic steering" or "charge pairs" as described in WO2014 / 145806. DI variants as described in WO2014 / 145806, and general additional Fc variants as outlined in WO2014 / 145806.Another important mechanism is the usage of engineered TCR constant regions to replace CH1 and CL regions in the Fab. The TCR constant regions may be engineered to incorporate one or more cysteine amino acids to form one or more non-native disulfide bonds between C and C, so that the dimer formed by the two constant regions has a better stability, expression and heterodimerization.Nucleic acid molecules encoding antibodiesIn some aspects, the disclosure is directed to an isolated nucleic acid molecule, comprising a nucleic acid sequence encoding one or more chains of the polypeptide complexes or antigen-binding portion thereof.Nucleic acids of the present disclosure can be obtained using standard molecular biology techniques. For antibodies expressed by hybridomas (e.g., hybridomas prepared from transgenic mice carrying human immunoglobulin genes as described further below) , cDNAs encoding the light and heavy chains of the antibody made by the hybridoma can be obtained by standard PCR amplification or cDNA cloning techniques. For antibodies obtained from an immunoglobulin gene library (e.g., using phage display techniques) , a nucleic acid encoding such antibodies can be recovered from the gene library.The isolated nucleic acid encoding the VH region can be converted to a full-length heavy chain gene by operatively linking the VH-encoding nucleic acid to another DNA molecule encoding heavy chain constant regions (CH1, CH2 and CH3, or TCR beta constant region) . The sequences of human heavy chain constant region genes are known in the art (see e.g., Kabat et al. (1991) , supra) and DNA fragments encompassing these regions can be obtained by standard PCR amplification. The heavy chain constant region can be an IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD constant region, but more preferably is an IgG1 or IgG4 constant region.The isolated nucleic acid encoding the VL region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the VL-encoding DNA to another DNA molecule encoding the light chain constant region, CL, or TCR alpha constant region. The sequences of human light chain constant region genes are known in the art (see e.g., Kabat et al., supra) and DNA fragments encompassing these regions can be obtained by standard PCR amplification. In some embodiments, the light chain constant region can be a kappa or lambda constant region.Once DNA fragments encoding VH and VL segments are obtained, these DNA fragments can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full-length antibody chain genes, to Fab fragment genes or to a scFv gene. In these manipulations, a VL-or VH-encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as an antibody constant region or a flexible linker. The term “operatively linked” , as used in this context, is intended to mean that the two DNA fragments are joined such that the amino acid sequences encoded by the two DNA fragments remain in-frame.In some specific embodiments, the isolated nucleic acid molecule comprises one or more nucleic acid sequence (s) selected from the group consisting of:(A) a nucleic acid sequence that encodes the heavy chain sequence of the CD19-binding moiety and the light chain sequence of the CD3-binding moiety;(B) a nucleic acid sequence that encodes the heavy chain sequence of the CD20-binding moiety;(C) a nucleic acid sequence that encodes the light chain sequence of the CD19-binding moiety;(D) a nucleic acid sequence that encodes a heavy chain sequence of the CD3-binding moiety;(E) a nucleic acid sequence that encodes the light chain sequence of the CD20-binding moiety;(F) any combinations of (A) - (E) ; and(G) a nucleic acid sequence that hybridized under high stringency conditions to the complementary strand of the nucleic acid sequence of (A) - (F) .In some specific embodiments, the isolated nucleic acid molecule comprises a nucleic acid sequence encoding SEQ ID NO: 25. In some specific embodiments, the isolated nucleic acid molecule comprises a nucleic acid sequence encoding SEQ ID NO: 26. In some specific embodiments, the isolated nucleic acid molecule comprises a nucleic acid sequence encoding SEQ ID NO: 27. In some specific embodiments, the isolated nucleic acid molecule comprises a nucleic acid sequence encoding SEQ ID NO: 28. In some specific embodiments, the isolated nucleic acid molecule comprises a nucleic acid sequence encoding SEQ ID NO: 29.Exemplary high stringency conditions include hybridization at 45℃ in 5X SSPE and 45%formamide, and a final wash at 65℃ in 0.1 X SSC. It is understood in the art that conditions of equivalent stringency can be achieved through variation of temperature and buffer, or salt concentration as described Ausubel, et al. (Eds. ) , Protocols in Molecular Biology, John Wiley &Sons (1994) , pp. 6.0.3 to 6.4.10. Modifications in hybridization conditions can be empirically determined or precisely calculated based on the length and the percentage of guanosine / cytosine (GC) base pairing of the probe. The hybridization conditions can be calculated as described in Sambrook, et al, (Eds. ) , Molecular Cloning: A laboratory Manual. Cold Spring Harbor Laboratory Press: Cold Spring Harbor, New York (1989) , pp. 9.47 to 9.51.Vectors and Host cellsThe nucleic acid molecules that encodes the polypeptide complexes can be inserted into a vector for further cloning (amplification of the DNA) or for expression, using recombinant techniques known in the art. In some embodiments, the antibody may be produced by homologous recombination known in the art. DNA encoding the monoclonal antibody is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy chain of the antibody) . Many vectors are available. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter (e.g., SV40, CMV, EF-1α) , and a transcription termination sequence. The selectable marker gene facilitates selection of host cells into which the vector has been introduced (see, e.g., U.S. Pat. Nos. 4,399,216; 4,634,665 and 5,179,017) . For example, typically the selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced. Selectable marker genes may include the dihydrofolate reductase (DHFR) gene (for use in dhfr-host cells with methotrexate selection / amplification) and the neo gene (for G418 selection) .In some embodiments, the vector system includes mammalian, bacterial, yeast systems, etc, and comprises plasmids such as, but not limited to, pALTER, pBAD, pcDNA, pCal, pL, pET, pGEMEX, pGEX, pCI, pCMV, pEGFP, pEGFT, pSV2, pFUSE, pVITRO, pVIVO, pMAL, pMONO, pSELECT, pUNO, pDUO, Psg5L, pBABE, pWPXL, pBI, p15TV-L, pPro18, pTD, pRS420, pLexA, pACT2.2 etc, and other laboratorial and commercially available vectors. Suitable vectors may include, plasmid, or viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses) . In one embodiment of the disclosure, the vector may be pET, for instance, pETbac containing genes of hexa-histidine-and c-Myc-tag.Vectors comprising the nucleic acid sequence encoding the polypeptide complexes can be introduced to a host cell for cloning or gene expression. Thus, the present disclosure also relates to a recombinant eukaryotic or prokaryotic host cell which produces a polypeptide complex of the present disclosure, such as a transfectoma.Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells, such as mammalian cells. Mammalian host cells for expressing the antibodies of the present disclosure include Chinese Hamster Ovary (CHO cells) (including dhfr CHO cells, described in Urlaub and Chasin, (1980) Proc. Natl. Acad. ScL USA 77: 4216-4220, used with a DHFR selectable marker, e.g., as described in R. J. Kaufman and P. A. Sharp (1982) J. MoI. Biol. 159: 601-621) , COS cells and SP2 cells. In particular, for use with NSO myeloma cells, another expression system is the GS gene expression system disclosed in WO 87 / 04462, WO 89 / 01036 and EP 338, 841. Also included are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651) ; human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36: 59 (1977) ) ; baby hamster kidney cells (BHK, ATCC CCL 10) ; Chinese hamster ovary cells / -DHFR (CHO, Urlaub et al., 1980, Proc. Natl. Acad. Sci. USA 77: 4216) ; mouse sertoli cells (TM4, Mather, 1980, Biol. Reprod. 23: 243-251) ; monkey kidney cells (CV1 ATCC CCL 70) ; African green monkey kidney cells (VERO-76, ATCC CRL-1587) ; human cervical carcinoma cells (HELA, ATCC CCL 2) ; canine kidney cells (MDCK, ATCC CCL 34) ; buffalo rat liver cells (BRL 3A, ATCC CRL 1442) ; human lung cells (W138, ATCC CCL 75) ; human liver cells (Hep G2, HB 8065) ; mouse mammary tumor (MMT 060562, ATCC CCL51) ; TRI cells (Mather et al., 1982, Annals N. Y. Acad. Sci. 383: 44-68) ; MRC 5 cells; FS4 cells; mouse myeloma cells, such as NSO (e.g. RCB0213, 1992, Bio / Technology 10: 169) and SP2 / 0 cells (e.g. SP2 / 0-Ag14 cells, ATCC CRL 1581) ; rat myeloma cells, such as YB2 / 0 cells (e.g. YB2 / 3HL. P2. G11.16Ag. 20 cells, ATCC CRL 1662) ; PER. C6 cells; and a human hepatoma line (Hep G2) . CHO cells are one of the cell lines that can be used herein, with CHO-K1, DUK-B11, CHO-DP12, CHO-DG44 (Somatic Cell and Molecular Genetics 12: 555 (1986) ) , and Lec13 being exemplary host cell lines. In the case of CHO-K1, DUK-B11, DG44 or CHO-DP12 host cells, these may be altered such that they are deficient in their ability to fucosylate proteins expressed therein.Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis, Pseudomonas such as P. aeruginosa, and Streptomyces.In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for trispecific antibody-encoding vectors. Saccharomyces cerevisiae, or common baker’s yeast, is the most commonly used among lower eukaryotic host microorganisms. However, a number of other genera, species, and strains are commonly available and useful herein, such as Schizosaccharomyces pombe; Kluyveromyces hosts such as, e.g., K. lactis, K. fragilis (ATCC 12, 424) , K. bulgaricus (ATCC 16, 045) , K. wickeramii (ATCC 24, 178) , K. waltii (ATCC 56, 500) , K. drosophilarum (ATCC 36, 906) , K. thermotolerans, and K. marxianus; yarrowia (EP 402, 226) ; Pichia pastoris (EP 183, 070) ; Candida; Trichoderma reesia (EP 244, 234) ; Neurosporacrassa; Schwanniomyces such as Schwanniomycesoccidentalis; and filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium, and Aspergillus hosts such as A. nidulans and A. niger.Other suitable host cells for the expression of the trispecific polypeptide complexes provided here are derived from multicellular organisms. Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodopterafrugiperda (caterpillar) , Aedes aegypti (mosquito) , Aedesalbopictus (mosquito) , Drosophila melanogaster (fruiffly) , and Bombyx mori have been identified. A variety of viral strains for transfection are publicly available, e.g., the L-1 variant of Autographacalifornica NPV and the Bm-5 strain of Bombyx mori NPV, and such viruses may be used as the virus herein according to the present disclosure, particularly for transfection of Spodopterafrugiperda cells. Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco can also be utilized as hosts.Host cells are transformed with the above-described expression or cloning vectors for antibody production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.The host cells used to produce the polypeptide complexes provided herein may be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma) , Minimal Essential Medium (MEM) , (Sigma) , RPMI-1640 (Sigma) , and Dulbecco's Modified Eagle's Medium (DMEM) , Sigma) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz. 58: 44 (1979) , Barnes et al., Anal. Biochem. 102: 255 (1980) , U.S. Pat. No. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO 90 / 03430; WO 87 / 00195; or U.S. Pat. Re. 30, 985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and / or other growth factors (such as insulin, transferrin, or epidermal growth factor) , salts (such as sodium chloride, calcium, magnesium, and phosphate) , buffers (such as HEPES) , nucleotides (such as adenosine and thymidine) , antibiotics (such as GENTAMYCINTM drug) , trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range) , and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.When using recombinant techniques, the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio / Technology 10: 163-167 (1992) describe a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5) , EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 min. Cell debris can be removed by centrifugation. Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.The antibody prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, DEAE-cellulose ion exchange chromatography, ammonium sulfate precipitation, salting out, and affinity chromatography, with affinity chromatography being the preferred purification technique.Following any preliminary purification step (s) , the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g., from about 0-0.25M salt) .Pharmaceutical CompositionsIn some aspects, the disclosure is directed to a pharmaceutical composition comprising a polypeptide complex or antigen-binding portion thereof as disclosed herein and a pharmaceutically acceptable carrier. In some aspects, the present disclosure provides a pharmaceutical composition comprising a nucleic acid (DNA or RNA) encoding the polypeptide complex as disclosed herein and a pharmaceutically acceptable carrier. In some aspects, the present disclosure provides a pharmaceutical composition comprising a cell expressing the polypeptide complex as disclosed herein and a pharmaceutically acceptable carrier.Components of the compositionsThe pharmaceutical composition may optionally contain one or more additional pharmaceutically active ingredients, such as another antibody or a drug. The pharmaceutical compositions of the disclosure also can be administered in a combination therapy with, for example, another immune-stimulatory agent, anti-cancer agent, an antiviral agent, or a vaccine. A pharmaceutically acceptable carrier can include, for example, a pharmaceutically acceptable liquid, gel or solid carriers, an aqueous medium, a non-aqueous medium, an anti-microbial agent, isotonic agents, buffers, antioxidants, anesthetics, suspending / dispersing agent, a chelating agent, a diluent, adjuvant, excipient or a nontoxic auxiliary substance, other known in the art various combinations of components or more.Suitable components may include, for example, antioxidants, fillers, binders, disintegrating agents, buffers, preservatives, lubricants, flavorings, thickening agents, coloring agents, emulsifiers or stabilizers such as sugars and cyclodextrin. Suitable anti-oxidants may include, for example, methionine, ascorbic acid, EDTA, sodium thiosulfate, platinum, catalase, citric acid, cysteine, mercapto glycerol, thioglycolic acid, mercapto sorbitol, butyl methyl anisole, butylated hydroxy toluene and / or propyl gallate. Oxidation reduction may prevent or reduce a decrease in binding affinity, thereby enhancing antibody stability and extended shelf life. Thus, in some embodiments, the present disclosure provides a composition comprising one or more antibodies or antigen binding fragment thereof and one or more anti-oxidants such as methionine. The present disclosure further provides a variety of methods, wherein an antibody or antigen binding fragment thereof is mixed with one or more anti-oxidants, such as methionine, so that the antibody or antigen binding fragment thereof can be prevented from oxidation, to extend their shelf life and / or increased activity.To further illustrate, pharmaceutical acceptable carriers may include, for example, aqueous vehicles such as sodium chloride injection, Ringer's injection, isotonic dextrose injection, sterile water injection, or dextrose and lactated Ringer's injection, nonaqueous vehicles such as fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil, or peanut oil, antimicrobial agents at bacteriostatic or fungistatic concentrations, isotonic agents such as sodium chloride or dextrose, buffers such as phosphate or citrate buffers, antioxidants such as sodium bisulfate, local anesthetics such as procaine hydrochloride, suspending and dispersing agents such as sodium carboxymethylcelluose, hydroxypropyl methylcellulose, or polyvinylpyrrolidone, emulsifying agents such as Polysorbate 80 (TWEEN-80) , sequestering or chelating agents such as EDTA (ethylenediaminetetraacetic acid) or EGTA (ethylene glycol tetraacetic acid) , ethyl alcohol, polyethylene glycol, propylene glycol, sodium hydroxide, hydrochloric acid, citric acid, or lactic acid. Antimicrobial agents utilized as carriers may be added to pharmaceutical compositions in multiple-dose containers that include phenols or cresols, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimerosal, benzalkonium chloride and benzethonium chloride. Suitable excipients may include, for example, water, saline, dextrose, glycerol, or ethanol. Suitable non-toxic auxiliary substances may include, for example, wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancers, or agents such as sodium acetate, sorbitan monolaurate, triethanolamine oleate, or cyclodextrin.Administration, Formulation and DosageThe pharmaceutical composition of the disclosure may be administered in vivo, to a subject in need thereof, by various routes, including, but not limited to, oral, intravenous, intra-arterial, subcutaneous, parenteral, intranasal, intramuscular, intracranial, intracardiac, intraventricular, intratracheal, buccal, rectal, intraperitoneal, intradermal, topical, transdermal, and intrathecal, or otherwise by implantation or inhalation. The subject compositions may be formulated into preparations in solid, semi-solid, liquid, or gaseous forms; including, but not limited to, tablets, capsules, powders, granules, ointments, solutions, suppositories, enemas, injections, inhalants, and aerosols. The appropriate formulation and route of administration may be selected according to the intended application and therapeutic regimen.Suitable formulations for enteral administration include hard or soft gelatin capsules, pills, tablets, including coated tablets, elixirs, suspensions, syrups or inhalations and controlled release forms thereof.Formulations suitable for parenteral administration (e.g., by injection) , include aqueous or non-aqueous, isotonic, pyrogen-free, sterile liquids (e.g., solutions, suspensions) , in which the active ingredient is dissolved, suspended, or otherwise provided (e.g., in a liposome or other microparticulate) . Such liquids may additional contain other pharmaceutically acceptable ingredients, such as anti-oxidants, buffers, preservatives, stabilizers, bacteriostats, suspending agents, thickening agents, and solutes which render the formulation isotonic with the blood (or other relevant bodily fluid) of the intended recipient. Examples of excipients include, for example, water, alcohols, polyols, glycerol, vegetable oils, and the like. Examples of suitable isotonic carriers for use in such formulations include Sodium Chloride Injection, Ringer's Solution, or Lactated Ringer's Injection. Similarly, the particular dosage regimen, including dose, timing and repetition, will depend on the particular individual and that individual's medical history, as well as empirical considerations such as pharmacokinetics (e.g., half-life, clearance rate, etc. ) .Frequency of administration may be determined and adjusted over the course of therapy, and is based on reducing the number of proliferative or tumorigenic cells, maintaining the reduction of such neoplastic cells, reducing the proliferation of neoplastic cells, or delaying the development of metastasis. In some embodiments, the dosage administered may be adjusted or attenuated to manage potential side effects and / or toxicity. Alternatively, sustained continuous release formulations of a subject therapeutic composition may be appropriate.It will be appreciated by one of skill in the art that appropriate dosages can vary from patient to patient. Determining the optimal dosage will generally involve the balancing of the level of therapeutic benefit against any risk or deleterious side effects. The selected dosage level will depend on a variety of factors including, but not limited to, the activity of the particular compound, the route of administration, the time of administration, the rate of excretion of the compound, the duration of the treatment, other drugs, compounds, and / or materials used in combination, the severity of the condition, and the species, sex, age, weight, condition, general health, and prior medical history of the patient. The amount of compound and route of administration will ultimately be at the discretion of the physician, veterinarian, or clinician, although generally the dosage will be selected to achieve local concentrations at the site of action that achieve the desired effect without causing substantial harmful or deleterious side-effects.Dosages and regimens may also be determined empirically for the disclosed therapeutic compositions in individuals who have been given one or more administration (s) . For example, individuals may be given incremental dosages of a therapeutic composition produced as described herein. In selected embodiments, the dosage may be gradually increased or reduced or attenuated based respectively on empirically determined or observed side effects or toxicity. To assess efficacy of the selected composition, a marker of the specific disease, disorder or condition can be followed as described previously. For cancer, these include direct measurements of tumor size via palpation or visual observation, indirect measurement of tumor size by x-ray or other imaging techniques; an improvement as assessed by direct tumor biopsy and microscopic examination of the tumor sample; the measurement of an indirect tumor marker (e.g., PSA for prostate cancer) or a tumorigenic antigen identified according to the methods described herein, a decrease in pain or paralysis; improved speech, vision, breathing or other disability associated with the tumor; increased appetite; or an increase in quality of life as measured by accepted tests or prolongation of survival.Compatible formulations for parenteral administration (e.g., intravenous injection) may comprise the antibody or antigen-binding portion thereof as disclosed herein in concentrations of from about 10 μg / ml to about 100 mg / ml. It will be apparent to one of skill in the art that the dosage of the antibody or antigen-binding portion thereof as disclosed herein may vary depending on the individual, the type of neoplastic condition, the stage of neoplastic condition, whether the neoplastic condition has begun to metastasize to other location in the individual, the past and concurrent treatments being used, and the dosage of therapeutic agents used in combination with the antibody as disclosed herein.Applications of the DisclosureThe antibodies, antibody compositions, nucleic acids encoding the antibodies and methods of the present disclosure have numerous in vitro and in vivo diagnostic and therapeutic utilities. Depending on the targeted antigens, the antibodies herein can be used for treatment of various antigen related disorders, e.g. cancers. In some embodiments, the use of the antibodies involve the diagnosis and treatment of CD19 and / or CD20 related disorders, such as B cell lymphomas. For example, these molecules can be administered to cells in culture, in vitro or ex vivo, or to human subjects, to treat, prevent and to diagnose a variety of disorders. Hence, the method in accordance with the invention further comprises the treatment of B-NHL, wherein said B-NHL is selected from the group consisting of diffuse large B-cell lymphoma (DLBCL) , high-grade B-cell lymphoma (HGBCL) , primary mediastinal large B-cell lymphoma (PMBCL) , mantle cell lymphoma (MCL) , follicular lymphoma (FL) , marginal-zone lymphoma (MZL) and small lymphocytic lymphoma (SLL) .Non-Hodgkin Lymphoma's (NHLs) represent a disease entity characterized by malignant transformation of the cells from lymphoid tissue. NHLs of B-cell origin ( “B-NHL” or “B-cell NHL” ) as defined herein constitute a diverse set of neoplasms within the larger context of NHL. These are diagnosed, and distinction of B-NHL subtypes determined, using standard classification criteria by a pathologist (based on tissue biopsy) , including morphologic features by histology, surface markers (immunohistochemistry / flow cytometry) , chromosomal abnormalities / translocations (karyotyping, fluorescence in situ hybridization (FISH) ) , and molecular (gene mutation) findings. B-NHLs are diagnosed and classified based on WHO classification, which is included herein by reference (Swerdlow SH, Campo E, Harris NL, et al. WHO Classification of Tumours of Haematopoietic and Lymphoid Tissues (Revised ed. 4th) ) .Briefly, B-NHLs are typically divided into indolent (slow-growing) and aggressive subtypes. Aggressive B-NHLs have high Ki67 expression, whereas indolent B-NHLs have relatively low Ki67 expression. Aggressive B-NHL includes: Diffuse large B-cell lymphoma (DLBCL) , high-grade B-cell lymphoma (HGBCL) , primary mediastinal large B-cell lymphoma (PMBCL) , mantle cell lymphoma (MCL) . Indolent B-NHL includes follicular lymphoma (FL) , marginal-zone lymphoma (MZL) and small lymphocytic lymphoma (SLL) . Diffuse large B-cell lymphoma (DLBCL) is the most common type of NHL accounting for approximately 30%to 40%of all NHL diagnoses, followed by FL (20%to 25%of all NHL diagnoses) . The majority of the B-cell lymphomas express B-cell markers, such as CD19, CD20, CD22, and CD79b.In some embodiments, the cancer is selected from a class of mature B-Cell cancers excluding Hodgkin's Lymphoma but including germinal-center B-cell-like (GCB) DLBCL, activated B-cell-like (ABC) DLBCL, follicular lymphoma (FL) , mantle cell lymphoma (MCL) , acute myeloid leukemia (AML) , chronic lymphoid leukemia (CLL) , marginal zone lymphoma (MZL) , small lymphocytic leukemia (SLL) , lymphoplasmacytic lymphoma (LL) , Waldenstrom macroglobulinemia (WM) , central nervous system lymphoma (CNSL) , Burkitt's lymphoma (BL) , B-cell prolymphocytic leukemia, Splenic marginal zone lymphoma, Hairy cell leukemia, Splenic lymphoma / leukemia, unclassifiable, Splenic diffuse red pulp small B-cell lymphoma, Hairy cell leukemia variant, Waldenstrom macroglobulinemia, Heavy chain diseases, a Heavy chain disease, γ Heavy chain disease, μ Heavy chain disease, Plasma cell myeloma, Solitary plasmacytoma of bone, Extraosseous plasmacytoma, Extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue (MALT lymphoma) , Nodal marginal zone lymphoma, Pediatric nodal marginal zone lymphoma, Pediatric follicular lymphoma, Primary cutaneous follicle centre lymphoma, T-cell / histiocyte rich large B-cell lymphoma, Primary DLBCL of the CNS, Primary cutaneous DLBCL, leg type, EBV-positive DLBCL of the elderly, DLBCL associated with chronic inflammation, Lymphomatoid granulomatosis, Primary mediastinal (thymic) large B-cell lymphoma, Intravascular large B-cell lymphoma, ALK-positive large B-cell lymphoma, Plasmablastic lymphoma, Large B-cell lymphoma arising in HHV8-associated multicentric Castleman disease, Primary effusion lymphoma: B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma and Burkitt lymphoma, and B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma and classical Hodgkin lymphoma.Other examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include, but not limited to, squamous cell cancer (e.g., epithelial squamous cell cancer) , lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum , hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer and gastrointestinal stromal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, melanoma, superficial spreading melanoma, lentigo maligna melanoma, acral lentiginous melanomas, nodular melanomas, multiple myeloma and B-cell lymphoma (including low grade / follicular non-Hodgkin's lymphoma (NHL) ; small lymphocytic (SL) NHL; intermediate grade / follicular NHL; intermediate grade diffuse NHL; high grade immunoblastic NH L; high grade lymphoblastic NH L;high grade small non-cleaved cell NHL; bulky disease NHL; mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's Macroglobulinemia) ; chronic lymphocytic leukemia (CLL) ; acute lymphoblastic leukemia (ALL) ; hairy cell leukemia; chronic myeloblastic leukemia; and post-transplant lymphoproliferative disorder (PTLD) , as well as abnormal vascular proliferation associated with phakomatoses, edema (such as that associated with brain tumors) , Meigs' syndrome, brain, as well as head and neck cancer, and associated metastases.Stimulation of an immune responseIn some aspects, the disclosure also provides a method of enhancing (for example, stimulating) an immune response in a subject comprising administering an antibody or an antigen binding portion thereof of the disclosure to the subject such that an immune response in the subject is enhanced. For example, the subject is a mammal. In a specific embodiment, the subject is a human.The term “enhancing an immune response” or its grammatical variations, means stimulating, evoking, increasing, improving, or augmenting any response of a mammal’s immune system. The immune response may be a cellular response (i.e. cell-mediated, such as cytotoxic T lymphocyte mediated) or a humoral response (i.e. antibody mediated response) , and may be a primary or secondary immune response. The enhancement of immune response can be assessed using a number of in vitro or in vivo measurements known to those skilled in the art, including, but not limited to, cytotoxic T lymphocyte assays, release of cytokines (for example IL-2 production or IFN-γ production) , regression of tumors, survival of tumor bearing animals, antibody production, immune cell proliferation, expression of cell surface markers, and cytotoxicity. Typically, methods of the disclosure enhance the immune response by a mammal when compared to the immune response by an untreated mammal or a mammal not treated using the methods as disclosed herein. In one embodiment, the antibody or an antigen binding portion thereof is used to enhance the immune response of a human to a vaccine.The antibody or the antigen-binding portion thereof may be used alone as a monotherapy, or may be used in combination with chemical therapies, radiotherapies and immune cell therapies.Combined use with chemotherapiesThe antibody or the antigen-binding portion thereof may be used in combination with (prior to, simultaneously with or following administration of the antibody as disclosed herein) an anti-cancer agent, a cytotoxic agent or chemotherapeutic agent.The term “anti-cancer agent” or “anti-proliferative agent” means any agent that can be used to treat a cell proliferative disorder such as cancer, and includes, but is not limited to, cytotoxic agents, cytostatic agents, anti-angiogenic agents, debulking agents, chemotherapeutic agents, radiotherapy and radiotherapeutic agents, targeted anti-cancer agents, BRMs, therapeutic antibodies, cancer vaccines, cytokines, hormone therapies, radiation therapy and anti-metastatic agents and immunotherapeutic agents. It will be appreciated that, in selected embodiments as discussed above, such anti-cancer agents may comprise conjugates and may be associated with the disclosed antibodies prior to administration. More specifically, in certain embodiments selected anti-cancer agents will be linked to the unpaired cysteines of the engineered antibodies to provide engineered conjugates as set forth herein. Accordingly, such engineered conjugates are expressly contemplated as being within the scope of the present disclosure. In other embodiments, the disclosed anti-cancer agents will be given in combination with site-specific conjugates comprising a different therapeutic agent as set forth above.As used herein the term “cytotoxic agent” means a substance that is toxic to the cells and decreases or inhibits the function of cells and / or causes destruction of cells. In certain embodiments, the substance is a naturally occurring molecule derived from a living organism. Examples of cytotoxic agents include, but are not limited to, small molecule toxins or enzymatically active toxins of bacteria (e.g., Diptheria toxin, Pseudomonas endotoxin and exotoxin, Staphylococcal enterotoxin A) , fungal (e.g., α-sarcin, restrictocin) , plants (e.g., abrin, ricin, modeccin, viscumin, pokeweed anti-viral protein, saporin, gelonin, momoridin, trichosanthin, barley toxin, Aleurites fordii proteins, dianthin proteins, Phytolacca mericana proteins (PAPI, PAPII, and PAP-S) , Momordica charantia inhibitor, curcin, crotin, saponaria officinalis inhibitor, gelonin, mitegellin, restrictocin, phenomycin, neomycin, and the tricothecenes) or animals, (e.g., cytotoxic RNases, such as extracellular pancreatic RNases; DNase I, including fragments and / or variants thereof) .For the purposes of the present disclosure a “chemotherapeutic agent” comprises a chemical compound that non-specifically decreases or inhibits the growth, proliferation, and / or survival of cancer cells (e.g., cytotoxic or cytostatic agents) . Such chemical agents are often directed to intracellular processes necessary for cell growth or division, and are thus particularly effective against cancerous cells, which generally grow and divide rapidly. For example, vincristine depolymerizes microtubules, and thus inhibits cells from entering mitosis. In general, chemotherapeutic agents can include any chemical agent that inhibits, or is designed to inhibit, a cancerous cell or a cell likely to become cancerous or generate tumorigenic progeny (e.g., TIC) . Such agents are often administered, and are often most effective, in combination, e.g., in regimens such as CHOP or FOLFIRI.Examples of anti-cancer agents that may be used in combination with the site-specific constructs of the present disclosure (either as a component of a site specific conjugate or in an unconjugated state) include, but are not limited to, alkylating agents, alkyl sulfonates, aziridines, ethylenimines and methylamelamines, acetogenins, a camptothecin, bryostatin, callystatin, CC-1065, cryptophycins, dolastatin, duocarmycin, eleutherobin, pancratistatin, a sarcodictyin, spongistatin, nitrogen mustards, antibiotics, enediyne antibiotics, dynemicin, bisphosphonates, esperamicin, chromoprotein enediyne antiobiotic chromophores, aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites, erlotinib, vemurafenib, crizotinib, sorafenib, ibrutinib, enzalutamide, folic acid analogues, purine analogs, androgens, anti-adrenals, folic acid replenisher such as frolinic acid, aceglatone, aldophosphamide glycoside, aminolevulinic acid, eniluracil, amsacrine, bestrabucil, bisantrene, edatraxate, defofamine, demecolcine, diaziquone, elfornithine, elliptinium acetate, an epothilone, etoglucid, gallium nitrate, hydroxyurea, lentinan, lonidainine, maytansinoids, mitoguazone, mitoxantrone, mopidanmol, nitraerine, pentostatin, phenamet, pirarubicin, losoxantrone, podophyllinic acid, 2-ethylhydrazide, procarbazine, polysaccharide complex (JHS Natural Products, Eugene, OR) , razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2, 2', 2"-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine) ; urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ( “Ara-C” ) ; cyclophosphamide; thiotepa; taxoids, chloranbucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs, vinblastine; platinum; etoposide (VP-16) ; ifosfamide; mitoxantrone; vincristine; vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (Camptosar, CPT-11) , topoisomerase inhibitor RFS 2000; difluorometlhylornithine; retinoids; capecitabine; combretastatin; leucovorin; oxaliplatin; inhibitors of PKC-alpha, Raf, H-Ras, EGFR and VEGF-Athat reduce cell proliferation and pharmaceutically acceptable salts, acids or derivatives of any of the above. Also included in this definition are anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators, aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, and anti-androgens; as well as troxacitabine (a1, 3-dioxolane nucleoside cytosine analog) ; antisense oligonucleotides, ribozymes such as a VEGF expression inhibitor and a MSLN expression inhibitor; vaccines, rIL-2; topoisomerase 1 inhibitor; rmRH; Vinorelbine and Esperamicins and pharmaceutically acceptable salts, acids or derivatives of any of the above.For example, the most common chemotherapy combination for the first treatment of aggressive NHL is called CHOP and contains 4 medications: cyclophosphamide, doxorubicin, vincristine, and prednisone. Adding an anti-CD20 monoclonal antibody, such as rituximab, has been shown to be an improvement over CHOP alone, also referred to as R-CHOP. Induction with R-CHOP is standard of care in 1st line treatment of DLBCL, as well as being one of more available 1st standard of care treatments in FL. In DLBCL, 2nd line treatments include intensive salvage treatment (rituximab / dexamethasone / high-dose cytarabine / cisplatin [R-DHAP] , rituximab / ifosfamide / carboplatin / etoposide [R-ICE] , or rituximab / gemcitabine / dexamethasone / cisplatin [R-GDP] ) followed by, if chemosensitive, high-dose chemotherapy with autologous hematopoietic stem cell transplantation (HDT-ASCT) . For DLBCL patients not being eligible to intensive salvage treatment and HDT-ASCT due to age or comorbidities, 2nd line treatments include rituximab / gemcitabine / oxaliplatin (R-GemOx) and rituximab / bendamustine (RB) . There are no clear standard of care for DLBCL late-line relapse, but interventions include allogeneic hematopoietic stem cell transplantation, lenalidomide, ibrutinib, and chimeric antigen receptor T (CAR-T) cell therapy (Chavez et al., Best Pract Res Clin Haematol, 2018 Jun; 31 (2) : 135-146) .Combined use with cellular therapiesIn some embodiments, the polypeptide complexes as disclosed herein are used in combination with a cellular immunotherapy, also known as adoptive cell therapy. As is generally known, cellular immunotherapy is a form of treatment that uses the cells of human body’s immune system to eliminate cancer. Some of these approaches involve directly isolating our own immune cells and simply expanding their numbers (e.g. performed by activating and expanding the immune cells of patient outside of the body and infused into the patient) , whereas others involve genetically engineering immune cells (via gene therapy) to enhance their cancer-fighting capabilities. Cellular immunotherapies can be deployed in different ways, including but not limited to Tumor-Infiltrating Lymphocyte (TIL) therapy, Engineered T Cell Receptor (TCR-T) therapy, Chimeric Antigen Receptor (CAR) T Cell therapy, CAR NK Cell therapy, Natural Killer (NK) Cell therapy.Combined use with radiotherapiesThe present disclosure also provides for the combination of the antibody or the antigen-binding portion thereof with radiotherapy (i.e., any mechanism for inducing DNA damage locally within tumor cells such as gamma-irradiation, X-rays, UV-irradiation, microwaves, electronic emissions and the like) . Combination therapy using the directed delivery of radioisotopes to tumor cells is also contemplated, and the disclosed antibodies may be used in connection with a targeted anti-cancer agent or other targeting means. Typically, radiation therapy is administered in pulses over a period of time from about 1 to about 2 weeks. The radiation therapy may be administered to subjects having head and neck cancer for about 6 to 7 weeks. Optionally, the radiation therapy may be administered as a single dose or as multiple, sequential doses.Pharmaceutical packs and kitsPharmaceutical packs and kits comprising one or more containers, comprising one or more doses of the antibody or the antigen-binding portion thereof are also provided. In certain embodiments, a unit dosage is provided wherein the unit dosage contains a predetermined amount of a composition comprising, for example, the antibody or the antigen-binding portion thereof, with or without one or more additional agents. For other embodiments, such a unit dosage is supplied in single-use prefilled syringe for injection. In still other embodiments, the composition contained in the unit dosage may comprise saline, sucrose, or the like; a buffer, such as phosphate, or the like; and / or be formulated within a stable and effective pH range. Alternatively, in certain embodiments, the composition may be provided as a lyophilized powder that may be reconstituted upon addition of an appropriate liquid, for example, sterile water or saline solution. In certain preferred embodiments, the composition comprises one or more substances that inhibit protein aggregation, including, but not limited to, sucrose and arginine. Any label on, or associated with, the container (s) indicates that the enclosed composition is used for treating the neoplastic disease condition of choice.The present disclosure also provides kits for producing single-dose or multi-dose administration units of the polypeptide complex and, optionally, one or more anti-cancer agents. For example, in addition to the antibody or the antigen-binding portion thereof of the disclosure such kits may contain any one or more of a range of anti-cancer agents such as chemotherapeutic or radiotherapeutic drugs; anti-angiogenic agents; anti-metastatic agents; targeted anti-cancer agents; cytotoxic agents; and / or other anti-cancer agents. The kits may also comprise a second / third container means for containing a sterile, pharmaceutically acceptable buffer or other diluents such as bacteriostatic water for injection (BWFI) , phosphate-buffered saline (PBS) , Ringer's solution and dextrose solution.When the components of the kit are provided in one or more liquid solutions, the liquid solution is preferably an aqueous solution, with a sterile aqueous or saline solution being particularly preferred. However, the components of the kit may be provided as dried powder (s) . When reagents or components are provided as a dry powder, the powder can be reconstituted by the addition of a suitable solvent. It is envisioned that the solvent may also be provided in another container.As indicated briefly above the kits may also contain a means by which to administer the antibody or the antigen-binding portion thereof and any optional components to a patient, e.g., one or more needles, I. V. bags or syringes, or even an eye dropper, pipette, or other such like apparatus, from which the formulation may be injected or introduced into the animal or applied to a diseased area of the body. The kits of the present disclosure will also typically include a means for containing the vials, or such like, and other component in close confinement for commercial sale, such as, e.g., injection or blow-molded plastic containers into which the desired vials and other apparatus are placed and retained.Sequence Listing SummaryAppended to the instant application is a sequence listing comprising a number of amino acid sequences. The following Tables A-E provide the CDR, variable region and heavy / light chain sequences of the representative tri-specific antibody named as W333021-U8T3W2. I27-61.uIgG4V9, and control antibodies W333021-U0T3W2. I27-61. uIgG4V9 and W333021-U8T3W0. I27-61. uIgG4V9 and CD3xCD19 (WuXi) used herein. U8, T3 and W2 refer to the CD19 binding moiety, the CD3 binding moiety and the CD20 binding moiety, respectively. U0 and W0 are unrelated sequences (neither CD19 nor CD20 binding) that replace the U8 or W2 moiety for use as a control. “I27” refers to the assembly format of the polypeptide complex as shown in Figure 1. “uIgG4V9” refers to modified IgG4 Fc. “CD19VH” and “CD19VL” refer to the VH and VL regions of the CD19-binding moiety, “CD20VH” and “CD20VL” refer to the VH and VL regions of the CD20-binding moiety, “CD3VH” and “CD3VL” refer to the VH and VL regions of the CD3-binding moiety.Table A: Sequences of W333021-U8T3W2. I27-61. uIgG4V9Table B: Sequences of W333021-U0T3W2. I27-61. uIgG4V9Table C: Sequences of W333021-U8T3W0. I27-61. uIgG4V9Table D: Sequences of CD3xCD19 (WuXi)Table E: Sequences of the constant regions and linkersEXAMPLESThe present disclosure, thus generally described, will be understood more readily by reference to the following Examples, which are provided by way of illustration and are not intended to be limiting of the present disclosure. The Examples are not intended to represent that the experiments below are all or the only experiments performed.Example 1: Preparation of antibodies and cell lines1.1 Preparation of benchmark antibodies (BMKs) and control antibodiesAnti CD20xCD3 antibody REGN1979 was used as one benchmark antibody. DNA sequences encoding the REGN1979 antibody were synthesized in Sangon Biotech (Shanghai, China) , and then subcloned into modified pcDNA3.4 expression vectors. Heavy chain and light chain expression plasmids were co-transfected into Expi293 cells using Expi293 expression system kit (Invitrogen-A14525) according to the manufacturer’s instructions. Five days after transfection, the supernatant was collected and used for protein purification using Protein A column (GE Healthcare-17543801) and further size exclusion chromatography (Cytiva-28990944) or ion exchange. Antibody concentration was measured by Nano Drop. The obtained proteins were evaluated by SDS-PAGE and HPLC-SEC, and then stored at -80 ℃. Anti CD3xCD19 bispecific antibody, named as “CD3xCD19 (WuXi) ” , was also used as another benchmark antibody. Sequences of CD3xCD19 (WuXi) are provided in Table D.Two negative control antibodies were generated and designated as W333021-U0T3W2. I27 and W333021-U8T3W0. I27 herein. The two control antibodies were constructed in the structure format as shown in Figure 1, except the CD19-binding moiety or the CD20-binding moiety was replaced by a moiety targeting irrelevant antigens. Details of the two control antibodies are provided in section 1.3 below.1.2 Cell Pool / Line GenerationEngineered cell lines stably expressing human CD19 and CD20 were constructed and designated as WBP701-CHOK1-hpro1. B4 and WT1028-CHOK1-hPro1. FL. F7 cells, respectively. Engineered cell lines stably expressing cynomolgus CD19 and CD20 were constructed and designated as WBP701. cPro1. CHO-K1. C9 and WT1028-CHOK1-cPro1. FL. E4 cells, respectively.1.3 Generation of Trispecific AntibodiesA trispecific antibody W333021-U8T3W2. I27-61. uIgG4V9 was constructed based on the optimized format as shown in Figure 1, wherein the antibody comprises a CD19 binding Fab and a CD3 binding Fab combined in one arm (left arm) , and a CD20 binding Fab in the other arm (right arm) . The CD19 binding Fab and CD3 binding Fab comprise CAlpha (Cα) and CBeta (Cβ) domains, in place of CL and CH1, operably linked to VL and VH regions respectively. The CD20 binding Fab comprises antibody CL and CH1 domains operably linked to VL and VH regions respectively. W333021-U8T3W2. I27-61. uIgG4V9 comprises two heavy chains and thee light chains comprising domains operably linked as in the following formats: heavy chain 1 (HC1) , CD19VH-Cβ-CD3VL-Cα-Fc; HC2, CD20VH-CH1-Fc; light chain 1 (LC1) , CD19VL-Cα; LC2, CD3VH-Cβ; LC3, CD20VL-CL.Two control antibodies W333021-U0T3W2. I27-61. uIgG4V9 and W333021-U8T3W0. I27-61. uIgG4V9 having the same structure format as W333021-U8T3W2. I27-61. uIgG4V9 are also generated. W333021-U0T3W2. I27-61. uIgG4V9 is different from W333021-U8T3W2. I27-61. uIgG4V9 antibody by replacing CD19 binding VH and VL regions (CD19VH and CD19VL) with control sequences, thus W333021-U0T3W2. I27-61. uIgG4V9 can also be designated as “W333021 (mute CD19) ” . Similarly, W333021-U8T3W0. I27-61. uIgG4V9 replaces the CD20 binding VH and VL regions (CD20VH and CD20VL) with control sequences, and can also be designated as “W333021 (mute CD20) ” . The sequences of the three antibodies are shown in above Tables A-D.Briefly, CAlpha and CBeta genes were synthesized by Genewiz Inc. Different light chain and heavy chain were constructed according to molecular construction protocol. Light chains were inserted into a linearized vector containing CAlpha, CBeta or CL, respectively. Heavy chains were inserted into a linearized vector containing human IgG4 Fc region (with knob into hole and FALA mutations) . All the sequences were cloned into modified pcDNA3.4 expression vectors.Heavy chain and light chain expression plasmids were co-transfected into Expi293 cells using Expi293 expression system kit (Invitrogen-A14525) according to the manufacturer’s instructions. Five days after transfection, the supernatant was collected and used for protein purification using Protein A column (GE Healthcare-17543801) and further size exclusion chromatography (Cytiva-28990944) or ion exchange. Antibody concentration was measured by Nano Drop. The purity of protein was evaluated by SDS-PAGE and HPLC-SEC. Antibodies were obtained after expression and purification, and then stored at -80 ℃.Example 2: In vitro characterization of W333021-U8T3W2. I27-61. uIgG4V92.1 SDS-PAGE and SEC-HPLCAntibodies was evaluated by SDS-PAGE and SEC-HPLC. The molecule weight, yield, purity and other information were shown in Table 1 and Figures 2 and 3.Table 1. Purification results of W333021 and control antibodies2.2 FACS binding to human CD3, CD19 or CD20 expressing cellsBinding of CD3xCD19xCD20 trispecific antibodies to human CD3 protein expressed on cells was determined by flow cytometry analysis. In brief, human CD3-expressing Jurkat (ATCC, #TIB-152) cells were harvested and diluted to 1×106 cells / mL in 1%BSA (Bovogen, #BSAS)  / 1XPBS (Gibco, #70011-044) . 1×105 cells / well (100μL) were added to each well of a 96-well U-plate (Corning, #3799) and centrifuged at 1500rpm (Eppendorf, #5810R) for 5 minutes before removing the supernatant. Antibodies serially diluted in 1%BSA  / 1XPBS were added at 100μL / well to the pelleted cells and incubated at 4℃ for 1 hour. A non-related hIgG4 antibody was used as an isotype control. Cells were washed two times with 180μL / well of 1%BSA  / 1XPBS by centrifugation at 1500rpm for 5 minutes at 4℃. Pelleted cells were resuspended in 100μL / well Alexa Fluor647 conjugated goat anti-human IgG Fc antibody (Jackson, #109-605-098) 1: 500 diluted in 1%BSA  / 1XPBS for 30 minutes at 4℃ in the dark. Cells were then washed two times as described above. After the final wash, cells were resuspended in 100μL 1%BSA  / 1XPBS and fluorescence values were measured with a FACS Canto II cytometer (BD Biosciences) . The amount of cell surface bound anti-CD3XCD19XCD20 trispecific antibody was assessed by measuring the mean fluorescence intensity (MFI) . The FACS raw data were analyzed by FlowJo software, wells containing no antibody or secondary antibody only were used to establish background fluorescence. Binding EC50 values were obtained by the four-parameter non-linear regression analysis using GraphPad Prism software.Binding of antibodies to human CD19 protein expressed on cells was determined by the same procedure as described above except using human CD19-expressing WBP701-CHOK1-hpro1. B4 cells. Further, binding of antibodies to human CD20 protein expressed on cells was determined by the same procedure except using human CD20-expressing WT1028-CHOK1-hPro1. FL. F7 cells.The binding results of antibodies are shown in Figures 4-6. For CD3 binding, the Max MFI of W333021 was significantly lower than REGN1979, which would be advantageous in providing a moderate T cell activation to avoid a toxic cytokine release. For CD19 binding, the Max MFI of W333021 was significantly higher than the control CD3xCD19 (WuXi) antibody. For CD20 binding, the binding of W333021 was comparable with REGN1979.2.3 FACS binding to human CD19 and CD20 expressing cellsBinding of CD3xCD19xCD20 trispecific antibodies to human CD19&CD20 protein expressed on cells was determined by flow cytometry analysis. In brief, human CD19&CD20-expressing Raji (ATCC, #CCL-86) cells were harvested and diluted to 1×106 cells / mL in 1%BSA / 1XPBS. 1×105 cells / well (100μL) were added to each well of a 96-well U-plate and centrifuged at 1500rpm (Eppendorf, #5810R) for 5 minutes before removing the supernatant. Antibodies serially diluted in 1%BSA  / 1XPBS were added at 100μL / well to the pelleted cells and incubated at 4℃ for 1 hour. A non-related hIgG4 antibody was used as an isotype control. Cells were washed two times with 180μL / well of 1%BSA  / 1XPBS by centrifugation at 1500rpm for 5 minutes at 4℃. Pelleted cells were resuspended in 100μL / well Alexa Fluor647 conjugated goat anti-human IgG Fc antibody 1: 500 diluted in 1%BSA  / 1XPBS for 30 minutes at 4℃ in the dark. Cells were then washed two times as described above. After the final wash, cells were resuspended in 100μL 1%BSA  / 1XPBS and fluorescence values were measured with a FACS Canto II cytometer (BD Biosciences) . The amount of cell surface bound anti-CD3XCD19XCD20 trispecific antibody was assessed by measuring the mean fluorescence intensity (MFI) . The FACS raw data were analyzed by FlowJo software, wells containing no antibody or secondary antibody only were used to establish background fluorescence. Binding EC50 values were obtained by the four-parameter non-linear regression analysis using GraphPad Prism software.The binding results of antibodies are shown in Figure 7. The left panel shows the binding of W333021 to Raji cells was comparable with REGN1979, but significantly higher than the control CD3xCD19 (WuXi) antibody. The right panel shows trispecific W333021 is improved in binding to Raji cells than two control antibodies W333021 (mute CD19) and W333021 (CD20) , which have the same structural format as W333021 but replaced VH and VL in the CD19 binding moiety or in the CD20 binding moiety and lost the CD19 or CD20 binding ability, respectively.2.4 FACS binding to cynomolgus CD19 or CD20 expressing cellsBinding of CD3xCD19xCD20 trispecific antibodies to cynomolgus CD19 protein expressed on cells was determined by flow cytometry analysis. In brief, cynomolgus CD19-expressing WBP701. cPro1. CHO-K1. C9 cells were harvested and diluted to 1×106 cells / mL in 1%BSA  / 1XPBS. 1×105 cells / well (100μL) were added to each well of a 96-well U-plate (Corning, #3799) and centrifuged at 1500rpm (Eppendorf, #5810R) for 5 minutes before removing the supernatant. Antibodies serially diluted in 1%BSA  / 1XPBS were added at 100μL / well to the pelleted cells and incubated at 4℃ for 1 hour. A non-related human IgG4 antibody was used as an isotype control. Cells were washed two times with 180μL / well of 1%BSA  / 1XPBS by centrifugation at 1500rpm for 5 minutes at 4℃. Pelleted cells were resuspended in 100μL / well Alexa Fluor647 conjugated goat anti-human IgG Fc antibody 1: 500 diluted in 1%BSA  / 1XPBS for 30 minutes at 4℃ in the dark. Cells were then washed two times as described above. After the final wash, cells were resuspended in 100μL 1%BSA  / 1XPBS and fluorescence values were measured with a FACS Canto II cytometer (BD Biosciences) . The amount of cell surface bound anti-CD3XCD19XCD20 trispecific antibody was assessed by measuring the mean fluorescence intensity (MFI) . The FACS raw data were analyzed by FlowJo software, wells containing no antibody or secondary antibody only were used to establish background fluorescence. Binding EC50 values were obtained by the four-parameter non-linear regression analysis using GraphPad Prism software.Binding of antibodies to cynomolgus CD20 protein expressed on cells was determined by the same procedure as described above except using cynomolgus CD20-expressing WT1028-CHOK1-cPro1. FL. E4 cells.The binding results of antibodies are shown in Figure 8. The binding of W333021 to cyno CD19 and cyno CD20 was significantly better than the isotype control.2.5 T cell-mediated killing assayThe effects of the CD3XCD19XCD20 trispecific antibodies to induce T lymphocytes-mediated tumor cell lysis were determined by FACS analysis. Freshly isolated PBMCs were collected in complete media (Phenol red free RPMI1640 supplemented with 10%FBS) as effector cells. CD19&CD20-expressing target cells, Raji (ATCC, #CCL-86) and Nalm-6 (ATCC, #CRL-3273) cells (1x106 cells / mL) were labeled with 20 nM Far-Red (Invitrogen, #C34572) for 30 minutes at 37℃ in DPBS respectively and washed twice with assay buffer (Phenol red free RPMI 1640 culture medium + 10%FBS) . 50μL (2x104 / well) of these Far-Red labeled target cells were mixed with 50μL PBMCs effector cells (PBMC / Raji or PBMC / Nalm-6 ratio 10: 1) in complete media, and 50μL serially diluted trispecific antibodies or hIgG4 isotype control were added. After overnight incubation (~18-24 hours) at 37℃, Propidium Iodide (PI) (Invitrogen, #P3566) was added to the wells, and the plates were incubated for an extra 15 minutes at room temperature before FACS analysis measuring Far-red and PI fluorescence values with a FACS Canto II cytometer (BD Biosciences) . Percent cytotoxicity was calculated using the equation: Cytotoxicity%= Far Red+PI+ /  (Far Red+PI+ + Far Red+PI-) *100%.The EC50 values of T cell-mediated target cell killing were calculated by four-parameter non-linear regression analysis using GraphPad Prism software.The results are shown in Figure 9 and Tables 2-3. The killing effect of W333021 on Raji cells was better than REGN1979 and CD3xCD19 (WuXi) antibody in EC50 value, and on Nalm-6 cells was better than REGN1979 and CD3xCD19 (WuXi) in both max cytotoxicity and EC50.Table 2. T cell-mediated killing on Raji cells by antibodiesTable 3. T cell-mediated killing on Nalm-6 cells by antibodies2.6 T cell activation assayThe effects of the CD3XCD19XCD20 trispecific antibodies to induce T lymphocytes activation were determined by IFN-γ and TNF-α cytokine release. Freshly isolated PBMCs were collected and diluted to 4×106 / mL in Phenol red free RPMI1640 (Gibco, #11835-30) supplemented with 10%FBS (Hyclone, #SV30087.03) . Raji (ATCC, #CCL-86) or Nalm-6 (ATCC, #CRL-3273) were diluted to 4×105 / mL in Phenol red free RPMI1640 supplemented with 10%FBS. Then 50μL target cells and 50μL PBMCs were mixed together and 50μL antibodies serially diluted in Phenol red free RPMI1640 supplemented with 10%FBS were added. A non-related hIgG4 antibody was used as an isotype control. After incubation at 37℃ for 18-24 hours, cells were centrifuged at 1500rpm for 5 minutes and 120μL supernatants were collected and three-fold diluted for cytokine detection.IFN-γ cytokine release was detected by ELISA. IFN gamma Antibody (2G1) (Pierce, #M700A) was diluted to 1μg / mL with Carbonate-bicarbonate buffer (20 mM Na2CO3, 180 mM NaHCO3, pH9.2) and added 50μL / well to ELISA plates (Nunc MaxiSorp, ThermoFisher, #442404) . After incubation overnight at 4℃, the wells were washed with 300μL per well of PBS / 0.5‰Tween-20 (v / v) . The wells were then blocked for one hour with 200μL per well of Casein (Thermo Scientific, #37528) and washed three times with 300μL per well of PBS / 0.5‰Tween-20 (v / v) . Supernatants were then added 50μL / well and incubated at room temperature for 2h. Standards (PEROTECH, #300-02) serially 2-fold diluted from 100ng / mL in 50%Casein (Thermo Scientific, #37528) were added 50μL / well and used for concentration conversion. All wells were washed three time with 300μL per well of PBS / 0.5‰Tween-20 (v / v) and 0.5μg / mL IFN gamma Antibody, Biotin (Pierce, #M701B) were added 50μL / well. Wells were then incubated at room temperature for 1h. After washing three times with 300μL per well of PBS / 0.5‰Tween-20 (v / v) , Streptavidin-HRP (Jackson, #016-030-084) at 1: 20000 dilution were added 50μL / well and incubate at room temperature for 1h, followed by six washes as described above. For the detection, 50μL Tetramethylbenzidine (TMB) Substrate solution (Sigma, #860336) was added to all wells for 10 minutes before stopping the reaction with 50μL 2M HCl. OD450-540 value was then obtained by M5e microplate reader. The standards analyzed by the four-parameter non-linear regression analysis usingM5e were used for the conversion from OD450-540 to concentration of samples. The contents of IFN-γ release EC50 values were then obtained by the four-parameter non-linear regression analysis using GraphPad Prism software.TNF-α cytokine release was detected by Human TNF ELISA Set (BD Pharmingen, #55212) . Capture antibody was diluted with Carbonate-bicarbonate buffer (20 mM Na2CO3, 180 mM NaHCO3, pH9.2) at 1: 250 dilution and added 50μL / well to ELISA plates (Nunc MaxiSorp, ThermoFisher, #442404) . After incubation overnight at 4℃, the wells were washed with 300μL per well of PBS / 0.5‰Tween-20 (v / v) . The wells were then blocked for one hour with 200μL per well of DPBS (Corning, #21-031-CVC) containing 10%FBS and washed three times with 300μL per well of PBS / 0.5‰Tween-20 (v / v) . Supernatants were then added 50μL / well and incubated at room temperature for 2h. Standards serially 2-fold diluted from 10ng / mL in DPBS (Corning, #21-031-CVC) containing 10%FBS were added 50μL / well and used for concentration conversion. All wells were washed three time with 300μL per well of PBS / 0.5‰Tween-20 (v / v) and working detector (Detection Ab at 1: 250 dilution + SAv-HRP at 1: 250 dilution) were added 50μL / well. Wells were then incubated at room temperature for 1h. After washing six times with 300μL per well of PBS / 0.5‰Tween-20 (v / v) , 50μL Tetramethylbenzidine (TMB) Substrate solution (Sigma, #860336) was added to all wells for 10 minutes before stopping the reaction with 50μL 2M HCl. OD450-540 was then obtained byM5e microplate reader. The standards analyzed by the four-parameter non-linear regression analysis usingM5e were used for the conversion from OD450-540 to concentration of samples. The contents of TNF-α release EC50 values were then obtained by the four-parameter non-linear regression analysis using GraphPad Prism software.The results are shown in Figures 10-11. The cytokine release by W333021 on Raji and Nalm-6 cells was significantly milder than REGN1979, thus less prone to lead to toxic cytokine release.2.7 Non-specific binding (ELISA / FACS)In ELISA assay, 96-well high binding plates (Nunc-Immuno Plate, Thermo Scientific) was coated with 2 μg / mL his-tagged antigen per well and blocked with 2%BSA-PBS. Antibodies (10 μg / ml) was incubated in the antigen-coated well, and the binding of antibodies to the immobilized antigens on the plate was measured using Goat Anti-Human IgG-Fc-HPR cross-absorbed antibody. The HRP signal was detected by adding TMB peroxidase substrate and the reaction was stopped after 12 minutes using 2M HCl.In FACS assay, cells were transferred into 96-well U-bottom plates (BD) at a density of 1x105 cells / well and centrifuged before removing the supernatant. Antibodies (10 ug / ml) were added to re-suspend cells and incubated for 1 hour. The secondary antibody, PE-conjugated Goat Anti-Human IgG Fc fragment was diluted at 5 μg / ml, then added to re-suspend cells and incubated for 30 min. Additional washing steps were performed twice followed by centrifugation. Finally, the cells were re-suspended in BSA-1xPBS and fluorescence intensity was measured by flow cytometry (BD Canto II) and analyzed by FlowJo.The binding results by ELISA were shown in Table 4 and the binding results by FACS were shown in Table 5. W333021 can’ t bind to all irrelevant antigens and cells.Table 4. Non-specific binding Results by ELISATable 5. Non-specific binding Results by FACS2.8 Thermal stability (DSF)Tm (melting temperature) of each antibody was investigated using7 Flex Real-Time PCR system. 19 μL of antibody solution was mixed with 1 μL of 80 X SYPRO Orange solution (Invitrogen) and transferred to the 96 well plate. The plate was sealed with the Optical Adhesive Film and centrifugated at 3,000 rpm for 5 min to remove any air bubbles. The plate was heated from 26 ℃ to 95 ℃ at a rate of 0.9 ℃ / min, and the resulting fluorescence data was collected. The negative derivatives of the fluorescence changes with respect to different temperatures were calculated, and the maximal value was defined as melting temperature Tm. If a protein has multiple unfolding transitions, the first two Tm were reported, named as Tm1 and Tm2. Data collection and Tm calculation were conducted automatically by theReal Time PCR software (v1.3) .Thermal stability of W333021 was shown as below. The Tm1 of W333021 reached 62.6℃ and the Tm2 reached 70.8℃, exhibiting good thermal stability.Table 6. Thermal stability results measured by DSF2.9 Hydrophobicity interaction chromatography HPLC (HIC-HPLC)Hydrophobicity property of antibody was detected by HPLC 1260 Infinity II system (Agilent TechnologicsTM) with TSKgel butyl-NPR column (Tosoh-0042168) . 25 μL sample was injected into the column, and separated with a flow rate of 1 ml / min for 61 min. The running buffer is 20 mM sodium phosphate, pH7.0 (Buffer A) and 20 mM sodium phosphate, 1.5 M (NH4) 2SO4, pH7.0 (Buffer D) . The running gradient was 0%to 100%Buffer D from 3 to 53 min. The peak retention was detected with UV light of the wavelength at 280 nm and 230 nm. The retention time was analyzed with HIC-HPLC analysis method to integrate all peak areas from 20 min to 50 min. The operation and analysis software is the OpenLab CDS Workstation (v2.3.0.443) .HIC-HPLC results of W333021 were shown as below. The retention time was 29.23 min, showing normal hydrophobicity.Table 7. HIC-HPLC results of lead2.10 Diffusion interaction parameter (kD) measurement by DLS (DLS-kD)kD measurement was investigated using DynaPro Plate Reader III (Wyatt DynaproTM) . Samples were first filtered with 0.02 μm filter and concentrated to over 20 mg / mL. Sample was diluted with PBS buffer to a final concentration at 2.5, 5, 10, 15, and 20 mg / mL. 7.5 μL sample solution was then added to 1536 well microplate. The plate was sealed with the ClearSeal Film, and centrifugated at 3,000 rpm for 5 min to let the sample down to the bottom of the well. Each sample is tested in duplicate wells. Put the plate into the corresponding position and data collection was performed by the DYNAMICS operation software (v7.8.1.3) . 5 acquisitions were collected for each protein sample while each acquisition time was 5 s. For each measurement, the diffusion coefficient was determined and plotted against protein concentration. kD values were calculated automatically by the software.The mAb with high kD value and monodisperse size probably has low aggregation propensity. The kD result of W333021 was around -10mL / g, indicating a low aggregation propensity.Table 8. The kD results of the lead measured by DLSExample 3: In vivo characterization of W333021-U8T3W2. I27-61. uIgG4V93.1 Rodent PK / PDThe concentrations of the W333021 in all blood samples collected from CD (SD) IGS Rats were determined by ELISA. The CD3 epsilon / CD3e protein was diluted in coating buffer and coated on a 384-well ELISA plate (30 μL per well) overnight at 4℃. Then, the plate was washed with PBST and blocked with 2%BSA (90 μL per well) for 1 hour at RT. Subsequently, the serially diluted standard, QC and blood samples (30 μL per well) were added to the plate and incubated for 1 hour at RT. Blood samples, standards and QC samples were all diluted at least 100 times with 2%BSA. After washing the plate 3 times with PBST, the goat anti-human IgG-Fc-biotin antibody was added and incubated at RT for 1h. After washing 3 times, the plate was incubated with Streptavidin-HRP at RT for 30 min. After washing 3 times, TMB substrate was used for color development, and the reaction was stopped after approximating 3 minutes through the addition of 2 M HCl. The absorbance of each well was read at 450 nm and 540 nm using the microplate spectrophotometer. The standard curves were generated using the four-parameter logistic fitting program of SoftMax Pro software. The OD values of the samples were substituted into the standard curve to obtain the antibody concentration in plasma. The antibody concentration was subjected to a non-compartmental pharmacokinetic analysis by using the Phoenix WinNonlin software (version 8.1, Pharsight, Mountain View, CA) . The linear / log trapezoidal rule was applied to the PK parameter calculation, and the data was represented by mean ± SD.The results were shown in Figure 15 and Table 9. “*” indicates the standard deviation (SD) of the mean; n = 3 / 3 represents that all three rats survived on day 21.Table 9. Pharmacokinetic parameters of W333021*3.2 Rodent efficacyThe Raji tumor cells were maintained in vitro as a monolayer culture in RPMI-1640 medium supplemented with 10%fetal bovine serum, 100 U / ml penicillin and 100 μg / ml streptomycin at 37℃ in an atmosphere of 5%CO2 in air. The tumor cells were routinely subcultured twice weekly. The cells growing in an exponential growth phase were harvested and counted for tumor inoculation.Each NCG mouse was co-inoculated subcutaneously at the right flank with Raji tumor cells (2 x 106) and human PBMC* (3 x 106) in 0.1 mL PBS mixed with Matrigel (Corning, 354230) (50 matrigel: 50 PBS) for tumor development. The animals were randomly grouped on day 4 after tumor inoculation when the average tumor volume reached 54 mm3, then treatment started for the efficacy study. Each group contained 8 mice. The test and control articles were administered to the tumor-bearing mice according to predetermined regimen. G1 was the vehicle control group.The tumor size was used for calculations of T / C values. T / C (%) of relative tumor proliferation rate was calculated using the formula: T / C (%) = (Ti-T0)  /  (Vi-V0) × 100%. The relative tumor growth inhibition was calculated by formula: TGITV (%) = [1 - (Ti-T0)  /  (Vi-V0) ] × 100%. Ti refers to the mean tumor volume of treatment group measured at each indicated time points following treatment; T0 refer to the tumor volume of treatment group when grouping; Vi refer to the mean tumor volume of vehicle control group measured at each indicated time points following treatment; V0 refer to the tumor volume of vehicle control group when grouping. If T / C > 40%, there is no efficacy; if T / C =< 40%and p value < 0.05, there is tumor inhibition. The results were shown in Figures 16-17 and Table 10 below.Table 10. Anti-tumor result of antibodies14 days after grouping, the mean tumor size of vehicle control reached 555 mm3 on day 14. Treatment with CD3xCD19 (WuXi) and CD3xCD20 (REGN1979) at dosage of 0.15 mg / kg did not produce antitumor activity, their mean tumor size were 547 mm3 (T / C=98.94%, TGI=1.06%, p>0.05) and 466 mm3 (T / C=82.47%, TGI=17.53%, p>0.05) . Treatment with W333021 at dosage of 0.15 mg / kg and 2.0 mg / kg produced significant antitumor activity, their mean tumor size were 87 mm3 (T / C=6.11%, TGI=93.89%, p<0.01) and 15 mm3 (T / C=-8.39%, TGI=108.39%, p<0.01) , respectively.Therefore, treatment with high and low dosing level of W333021 produced significant efficacy in PBMC-Raji tumor bearing mice (T / C=6.11%and -8.39%; TGI=93.89%and 108.39%; p<0.01, respectively) .Example 4: Verification of mispairing reduction in W333021 antibody formatsTo verify the W333021 cross formats of Figure 1 would lead to significantly reduced mispairing byproducts, two formats with and without the cross design were compared (Figure 18) . W333021-cAb35 has no cross design. W333021-cAb35: moiety 1 consists of a first Fab (VL1-Cαpairing with VH1-Cβ) , moiety 2 consists of a second Fab (VL2-Cα pairing with VH2-Cβ) , and the assembly of moiety 2 is same as moiety 1, i.e. VH1-Cβ is linked to VH2-Cβ in one polypeptide chain. W333021-cAb36: the construction of moiety 1 is same as W333021-cAb35, except that moiety 2 contains VL2-Cα only and VH1-Cβ is linked to VL2-Cα in one polypeptide chain. We want to verify whether VL1-Cα can bind to VL2-Cα after the replacement of VH2-Cβ by VL2-Cαin the heavy chain.According to the results of Mass (Figure 19) , as for W333021-cAb35, VL1-Cα (moiety 1-LC1) can bind to VH2-Cβ (moiety 2) (for example leading to HC1+HC2+LC1*2+LC3) , and VL2-Cα (moiety 2-LC2) can bind to VH1-Cβ (moiety 1) as well (for example leading to HC1+HC2+LC2*2+LC3) . We found that the mispairing apparently happened.According to the results of SDS-PAGE (Figure 20) and mass (Figure 19) , as for W333021-cAb36 with the theoretical mass of 170kD, the molecules of HC1+HC2+LC1*2+LC3 (around 200kD) and HC1+LC1*2 (around 125kD) were not generated.Therefore, avoiding VH1-Cβ of the first antigen-binding moiety 1 and VH2-Cβ of the second antigen-binding moiety in the same polypeptide chain, e.g. by exchanging VH2-Cβ with VL2-Cα, can avoid or reduce the mispairing among light chain.Example 5: Universality verificationTo verify that the W333021 format is applicable to various antigen-binding moieties, we constructed seven tri-specific polypeptide complexes that bind to different target antigens (Figure 1C) . These polypeptide complexes comprise three or four antigen-binding moieties which are derived from parental antibodies that have already been developed. The linker of the seven polypeptide complexes are same as those in the counterpart of W333021-U8T3W2. I27-61. uIgG4V9, and the Fc region “IgG4V322” refers to IgG4 Fc with F234A / L235A mutation (EU numbering) .Table 11. Target binding information of the seven polypeptide complexesFurther, we tested the purity, thermal stability and antigen binding of the seven antibodies. The results are summarized in the tables below and Figures 20-27.Table 12. Characterization of the seven polypeptide complexesTable 13. Binding Ratio (Multispecific / Parental mAb) with EC50 value (Monovalent / Mono control antibody Bi / Bi control antibody)Note:1. There was no anti-PD-1 antibody with monovalence as a comparison.2. The binding of CD3 has decreased, and it is possible that the spatial hindrance has a greater impact on it.It can be seen that the constructed polypeptide complexes basically retain the antigen-binding ability of parental antibodies.Those skilled in the art will further appreciate that the present disclosure may be embodied in other specific forms without departing from the spirit or central attributes thereof. In that the foregoing description of the present disclosure discloses only exemplary embodiments thereof, it is to be understood that other variations are contemplated as being within the scope of the present disclosure. Accordingly, the present invention is not limited to the particular embodiments that have been described in detail herein. Rather, reference should be made to the appended claims as indicative of the scope and content of the invention.ReferencesCarter RH, Barrington RA: Signaling by the CD19 / CD21 complex on B cells. Curr Dir Autoimmun 2004, 7: 4–32.Tedder, T. CD19: a promising B cell target for rheumatoid arthritis. Nat Rev Rheumatol 2009, 5, 572–577.Wang K, Wei G, Liu D. CD19: a biomarker for B cell development, lymphoma diagnosis and therapy. Exp Hematol Oncol. 2012 Nov 29; 1 (1) : 36.Chu TW, Zhang R, Yang J, Chao MP, Shami PJ, J. A Two-Step Pretargeted Nanotherapy for CD20 Crosslinking May Achieve Superior Anti-Lymphoma Efficacy to Rituximab. Theranostics 2015; 5 (8) : 834-846.Kung P, Goldstein G, Reinherz EL, Schlossman SF. Monoclonal antibodies defining distinctive human T cell surface antigens. Science. 1979 Oct 19; 206 (4416) : 347-9.Chatenoud L. CD3-specific antibody-induced active tolerance: from bench to bedside. Nat Rev Immunol. 2003 Feb; 3 (2) : 123-32.Chatenoud L, Baudrihaye MF, Kreis H, Goldstein G, Schindler J, Bach JF. Human in vivo antigenic modulation induced by the anti-T cell OKT3 monoclonal antibody. Eur J Immunol. 1982 Nov; 12 (11) : 979-82.Hirsch R, Gress RE, Pluznik DH, Eckhaus M, Bluestone JA. Effects of in vivo administration of anti-CD3 monoclonal antibody on T cell function in mice. II. In vivo activation of T cells. J Immunol. 1989 Feb 1; 142 (3) : 737-43.

Claims

1.A polypeptide complex or antigen-binding portion thereof, comprising a first antigen-binding moiety, a second antigen-binding moiety, and a third antigen-binding moiety, wherein:the first antigen-binding moiety comprises, from N-terminus to C-terminus, a first heavy chain variable domain (VH1) operably linked to a first T cell receptor (TCR) constant (C1) region (VH1-C1) in one polypeptide chain, and a first light chain variable domain (VL1) operably linked to a second TCR constant (C2) region (VL1-C2) in another polypeptide chain,the second antigen-binding moiety comprises, from N-terminus to C-terminus, a second heavy chain variable domain (VH2) operably linked to a C1 region (VH2-C1) in one polypeptide chain, and a second light chain variable domain (VL2) operably linked to a C2 region (VL2-C2) in another polypeptide chain,the third antigen-binding moiety comprises, from N-terminus to C-terminus, a third heavy chain variable domain (VH3) operably linked to a CH1 constant region (VH3-CH1) , and a third light chain variable domain (VL3) operably linked to a CL constant region (VL3-CL) , wherein:the C1 region comprises an engineered Cβ and the C2 region comprises an engineered Cα, or the C1 region comprises an engineered Cα and the C2 region comprises an engineered Cβ,the engineered Cβ and Cα are capable of forming a dimer via their interchain bonds and interactions,wherein the VH1-C1 of the first antigen-binding moiety and the VH2-C1 of the second antigen-binding moiety are in separate polypeptide chains.2.The polypeptide complex or antigen-binding portion thereof of claim 1, comprising two heavy chains each comprising a Fc domain that holds the two heavy chains together, wherein the VH1-C1 of the first antigen-binding moiety is in a heavy chain and the VH2-C1 of the second antigen-binding moiety is in a light chain, or the VH1-C1 of the first antigen-binding moiety is in a light chain and the VH2-C1 of the second antigen-binding moiety is in a heavy chain.3.The polypeptide complex or antigen-binding portion thereof of claim 2, wherein:the VH1-C1 of the first antigen-binding moiety and the VL2-C2 of the second antigen-binding moiety are in the same heavy chain, and the VL1-C2 of the first antigen-binding moiety and the VH2-C1 of the second antigen-binding moiety are in two separate light chains;the VH1-C1 of the first antigen-binding moiety and the VL2-C2 of the second antigen-binding moiety are in two separate heavy chains, and the VL1-C2 of the first antigen-binding moiety and the VH2-C1 of the second antigen-binding moiety are in two separate light chains;the VH1-C1 of the first antigen-binding moiety and the VL2-C2 of the second antigen-binding moiety are in two separate light chains, and the VL1-C2 of the first antigen-binding moiety and the VH2-C1 of the second antigen-binding moiety are in the same heavy chain; orthe VH1-C1 of the first antigen-binding moiety and the VL2-C2 of the second antigen-binding moiety are in two separate light chains, and the VL1-C2 of the first antigen-binding moiety and the VH2-C1 of the second antigen-binding moiety are in two separate heavy chains.4.The polypeptide complex or antigen-binding portion thereof of claim 1, wherein:the VH1-C1 of the first antigen-binding moiety, the VL2-C2 of the second antigen-binding moiety and the VH3-CH1 of the third antigen-binding moiety are operably linked in a first polypeptide chain, and the VL1-C2 of the first antigen-binding moiety, the VH2-C1 of the second antigen-binding moiety and the VL3-CL of the third antigen-binding moiety are in three separate chains respectively; orthe VL1-C2 of the first antigen-binding moiety, the VH2-C1 of the second antigen-binding moiety and the VH3-CH1 of the third antigen-binding moiety are operably linked in a first polypeptide chain, and the VH1-C1 of the first antigen-binding moiety, the VL2-C2 of the second antigen-binding moiety and the VL3-CL of the third antigen-binding moiety are in three separate chains respectively;optionally, the first polypeptide chain further comprises a Fc domain.5.The polypeptide complex or antigen-binding portion thereof of claim 1, wherein the first, second and three antigen-binding moieties have different antigen-binding specificities.6.The polypeptide complex or antigen-binding portion thereof of any of claims 1-5, wherein the C1 and C2 regions of the first antigen-binding moiety are at least 90%, 95%or 100%identical to the C1 and C2 regions of the second antigen-binding moiety, respectively.7.The polypeptide complex or antigen-binding portion thereof of any of claims 1-6, wherein the Cα and Cβ are engineered to comprise one or more non-native interchain disulfide bond (s) that improves the stability of the interface between Cα and Cβ.8.The polypeptide complex or antigen-binding portion thereof of claim 7, wherein the engineered Cβ comprises the amino acid sequence of SEQ ID NO: 34 or an amino acid sequence with at least 85%, 90%, or 95%identity to SEQ ID NO: 34, and the engineered Cα comprises the amino acid sequence of SEQ ID NO: 35 or an amino acid sequence with at least 85%, 90%, or 95%identity to SEQ ID NO: 35.9.The polypeptide complex or antigen-binding portion thereof of any of claims 1-3 and 5-8, wherein the polypeptide complex comprises two heavy chains and three light chains, wherein from N terminus to C terminus, the first heavy chain (HC1) , the second heavy chain (HC2) , the first light chain (LC1) , the second light chain (LC2) and the third light chain (LC3) comprise domains operably linked into the following formats, respectively:(a) VH1-C1-VL2-C2-Fc, VH3-CH1-Fc, VL1-C2, VH2-C1, VL3-CL;(b) VL1-C2-VH2-C1-Fc, VH3-CH1-Fc, VH1-C1, VL2-C2, VL3-CL;(c) VH3-CH1-VH2-C1-Fc, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL;(d) VH3-CH1-VL2-C2-Fc, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL;(e) VH2-C1-VH3-CH1-Fc, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL;(f) VL2-C2-VH3-CH1-Fc, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL;(g) VH3-CH1-Fc-VL2-C2, VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL; or(h) VH3-CH1-Fc-VH2-C1, VL1-C2-Fc, VH1-C1, VL2-C2, VL3-CL.10.The polypeptide complex or antigen-binding portion thereof of any of claims 1-3 and 5-8, wherein the polypeptide complex is comprises two heavy chains and four light chains, wherein from N terminus to C terminus, the first heavy chain (HC1) , the second heavy chain (HC2) , the first light chain (LC1) , the second light chain (LC2) , the third light chain (LC3) and the fourth light chain (LC4) comprise domains operably linked into the following formats, respectively:(j) VH3-CH1-VH2-C1-Fc, VL1-C2-VH2-C1-Fc, VH1-C1, VL2-C2, VL3-CL, VL2-C2;(k) VL2-C2-VH1-C1-Fc, VH3-CH1-VH1-C1-Fc, VL1-C2, VH2-C1, VL3-CL, VL1-C2; or(l) VH2-C1-Fc-VL1-C2, VH3-CH1-Fc-VL1-C2, VH1-C1, VL2-C2, VL3-CL, VH1-C1.11.The polypeptide complex or antigen-binding portion thereof of any of claims 4 and 5-8, wherein the polypeptide complex comprises four chains, wherein the first chain, the second chain, the third chain and the fourth chain comprise domains operably linked into the following formats, respectively:(a) VH3-CH1-VH1-C1-VL2-C2, VL3-CL, VL1-C2, VH2-C1; or(b) VH3-CH1-VL1-C2-VH2-C1, VL3-CL, VH1-C1, VL2-C2,optionally, the first chain further comprises a Fc domain.12.The polypeptide complex or antigen-binding portion thereof of any of claims 2-4 and 9-11, wherein the Fc domain is a human IgG Fc domain, such as a human IgG1, IgG2, IgG3 or IgG4 Fc domain, or a Fc variant domain.13.The polypeptide complex or antigen-binding portion thereof of claim 12, wherein the Fc variant domains of the two heavy chains comprise one or more substitutions selected from:(a) “knob into hole” substitutions, wherein the “hole” substitution comprises Y349C, T366S, L368A, and / or Y407V, and the “knob” substitution comprises S354C and / or T366W;(b) F234A / L235A, S228P, M252Y / S254T / T256E; and(c) combinations of any of (a) and (b) .14.The polypeptide complex or antigen-binding portion thereof of any of claims 1-13, wherein operably linked is via a direct linkage or via a peptide linker comprising 1-40 amino acids in length.15.The polypeptide complex or antigen-binding portion thereof of claim 14, wherein the peptide linker is a partial or whole hinge region of an immunoglobulin or a GS linker, for example (GS) n, (GGS) n, (GGGS) n, (GGGGS) n, (GGSG) n, (GGGSS) n, wherein n is an integer of 1-9.16.The polypeptide complex or antigen-binding portion thereof of any of the preceding claims, wherein each antigen-binding moiety specifically binds to an antigen selected from an exogenous antigen, an endogenous antigen, an autoantigen, a neoantigen, a viral antigen, a tumor associated antigen, immune checkpoint molecules, tumor microenvironment targets, autoimmune and inflammatory diseases associated target.17.The polypeptide complex or antigen-binding portion thereof of claim 16, wherein one of the antigen-binding moieties specifically binds to a T-cell specific receptor molecule and / or a natural killer cell (NK cell) specific receptor molecule, and another antigen-binding moiety specifically binds to a tumor associated antigen.18.The polypeptide complex or antigen-binding portion thereof of any of the preceding claims, wherein the polypeptide complex is a chimeric antibody, a humanized antibody or a fully human antibody.19.A nucleic acid molecule, comprising a nucleic acid sequence encoding one or more polypeptide chain (s) of the polypeptide complex or antigen-binding portion thereof of any of claims 1-18.20.A vector comprising the nucleic acid molecule of claim 19.21.A host cell comprising the nucleic acid molecule of claim 19 or the vector of claim 20.22.A pharmaceutical composition comprising the polypeptide complex or antigen-binding portion thereof of any of claims 1-18 and a pharmaceutically acceptable carrier.23.A method for producing the polypeptide complex or antigen-binding portion thereof of any of claims 1-18, comprising the steps of:- culturing the host cell of claim 21; and- isolating the polypeptide complex or antigen-binding portion thereof from the host cell.24.A method for preventing or treating cancer in a subject, comprising administering an effective amount of the polypeptide complex or antigen-binding portion thereof of any of claims 1-18 or the pharmaceutical composition of claim 22 to the subject.25.The method of claim 24, wherein the cancer can be alleviated, eliminated, treated, or prevented when the antigen (s) targeted by the polypeptide complex or antigen-binding portion thereof is modulated.26.The polypeptide complex or antigen-binding portion thereof of any of claims 1-18 for use in diagnosing, treating or preventing cancer.27.Use of the polypeptide complex or antigen-binding portion thereof of any of claims 1-18 in the manufacture of a medicament for treating or preventing a cancer.28.A kit, wherein the kit comprises a container comprising the polypeptide complex or antigen-binding portion thereof of any of claims 1-18.

Citation Information

Patent Citations

  • Novel bispecific polypeptide complexes

    CN111133003A

  • Trispecific binding molecules against cancers and uses thereof

    CN112204052A

  • Fab-based trispecific antibodies

    WO2019199916A1

  • Multispecific FGF21 receptor agonists and their uses

    WO2022235628A1

  • CD3 / BCMA / CD38 trispecific antibodies

    WO2023213998A1