Anti-interleukin-6 receptor antibody and use thereof

Mutant antibodies with improved affinity and stability address the limitations of existing IL-6R inhibitors, providing enhanced therapeutic efficacy for IL-6R-associated diseases.

WO2025218552A1PCT designated stage Publication Date: 2025-10-23BEIJING VDJBIO
View PDF 5 Cites 0 Cited by

Patent Information

Application Number
PCT/CN2025/088140
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-04-15
Filing Date
2025-04-09
Publication Date
2025-10-23

AI Technical Summary

Technical Problem

Current IL-6R inhibitors, such as Tocilizumab, have limitations, necessitating the development of new antibodies with improved affinity, stability, and biological activity to target the IL-6 signaling pathway for various diseases.

Method used

Development of mutant antibodies or antigen binding fragments with specific HCDR and LCDR sequences, enhanced Fc region mutations for extended half-life, and thermal stability, and humanized antibodies with improved binding affinity and stability, suitable for use in pharmaceutical compositions.

Benefits of technology

The mutant antibodies exhibit higher biological activity, FcRn affinity, and enhanced stability, offering potential therapeutic benefits for a range of diseases including tumors and autoimmune disorders.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure PCTCN2025088140-FTAPPB-I100001
    Figure PCTCN2025088140-FTAPPB-I100001
  • Figure PCTCN2025088140-FTAPPB-I100002
    Figure PCTCN2025088140-FTAPPB-I100002
  • Figure PCTCN2025088140-FTAPPB-I100003
    Figure PCTCN2025088140-FTAPPB-I100003
Patent Text Reader

Abstract

Provided herein are an antibody or antigen binding fragment that specifically recognizes and / or binds to an anti-interleukin 6 receptor. The antibodies or antigen binding fragments provided by the present disclosure have biological activity, FcRn affinity and antibody stability, and have prospects for clinical application.
Need to check novelty before this filing date? Find Prior Art

Description

ANTI-INTERLEUKIN-6 RECEPTOR ANTIBODY AND USE THEREOFFIELD OF THE INVENTION

[0001] The present disclosure belongs to the field of antibody engineering, specifically relates to anti-interleukin 6 receptor antibodies or antigen binding fragments thereof and use thereof.BACKGROUND OF THE INVENTION

[0002] Human interleukin-6 (IL-6) is a 26 kDa glycoprotein whose encoding gene is found on chromosome 7. The functional diversity of IL-6 primarily lies in its interaction with multiple types of IL-6 receptors on the cell surface, followed by the transmission of a variety of biological signals to different tissues and cells through downstream signaling pathways.

[0003] Interleukin 6 receptor (IL-6R) plays an important role in immune regulation, hematopoiesis, inflammation and oncogenesis. Studies have shown that high expression of IL-6R has been found in a variety of human tumor cells including promyelocytic leukemia, astrocytoma, glioblastoma, multiple myeloma, prostate cancer, gastric cancer, and liver cancer cells. Therefore, IL-6 pathway inhibitors that target IL-6 or IL-6R and block the binding of IL-6 to IL-6R, thereby inhibiting IL-6 pathway signaling, have emerged as potential therapeutics for a variety of diseases.

[0004] Tocilizumab (TCZ) , the first humanized monoclonal antibody targeting the interleukin-6 receptor (IL-6R) , is an IgG1 antibody obtained by humanizing the mouse antibody PM1. Tocilizumab can be used as a therapeutic agent for IL-6 associated diseases and has been marketed under the trade names Actemra and RoActemra. However, there is still a need to develop new inhibitors targeting the IL-6R signaling pathway.SUMMARY OF THE INVENTION

[0005] The present disclosure is based on the modification of existing antibodies against IL-6R to obtain mutant antibodies or antigen binding fragments thereof with significantly improved affinity, stability and biological activity, and applications thereof.

[0006] According to one aspect of the present disclosure, provided is an antibody or antigen binding fragment that specifically recognizes and / or binds to an anti-interleukin 6 receptor, wherein the antibody or antigen binding fragment comprises at least one light chain and at least one heavy chain, wherein the light chain comprises at least one light chain variable region, and the heavy chain comprises at least one heavy chain variable region;

[0007] the heavy chain variable region has an HCDR1 as shown in SEQ ID NO: 1, and / or an HCDR2 as represented by general formula (1) , and / or an HCDR3 as shown in SEQ ID NO: 3,

[0008] the light chain variable region has an LCDR1 as shown in SEQ ID NO: 4, and / or an LCDR2 as shown in SEQ ID NO: 5, and / or an LCDR3 as shown in SEQ ID NO: 6,

[0009] the general formula (1) has an amino acid sequence shown as FISYSGX1TTYNPSLKS, wherein X1 is selected from G, V, F, K, or R.

[0010] In some embodiments, the HCDR2 of the heavy chain variable region has an amino acid sequence as shown in any one of SEQ ID NOs: 7, 9, 16, 19 and 20.

[0011] In some embodiments, the heavy chain variable region comprises an amino acid sequence as shown in any one of SEQ ID NOs: 25, 27, 34, 37, and 38, or an amino acid sequence having at least 85%sequence identity thereto.

[0012] In some embodiments, the light chain variable region has an amino acid sequence as shown in SEQ ID NO: 60, or an amino acid sequence having at least 85%sequence identity thereto.

[0013] In some embodiments, the antibody has an Fc region that may have one or more mutations to extend a half-life of the antibody. In some embodiments, the Fc region of the antibody may have mutations at one or more of positions 252, 254, and 256. In some embodiments, the Fc region of the antibody has one or more of mutations M252Y, S254T, and T256E.

[0014] In some embodiments, the heavy chain comprises an amino acid sequence as shown in any one of SEQ ID NOs: 62~66, or an amino acid sequence having at least 85%sequence identity thereto. In some embodiments, the light chain comprises an amino acid sequence as shown in SEQ ID NO: 61, or an amino acid sequence having at least 85%sequence identity thereto.

[0015] In some embodiments, the antibody is a humanized antibody.

[0016] In some embodiments, the antibody is an IgA, IgD, IgE, IgG, or IgM antibody.

[0017] In some embodiments, the antibody is an IgG1, IgG2, IgG3, IgG4, IgA1, or IgA2 antibody.

[0018] In some embodiments, the antibody or antigen binding fragment has good thermal stability and freeze-thaw stability.

[0019] In some embodiments, the antibody or antigen binding fragment may have an isoelectric point in a range of 9.0~10.0.

[0020] According to another aspect of the present disclosure, provided is a nucleic acid molecule encoding the antibody or antigen binding fragment.

[0021] According to yet another aspect of the present disclosure, provided is an expression vector comprising the nucleic acid molecule.

[0022] According to yet another aspect of the present disclosure, provided is a host cell comprising the nucleic acid molecule of the second aspect.

[0023] In some embodiments, the host cell comprises a prokaryotic cell or a eukaryotic cell.

[0024] In some embodiments, the host cell comprises an E. coli, a plant cell, a mammalian cell, an insect cell, or a yeast cell.

[0025] In some embodiments, the mammalian host cell is a Chinese hamster ovary cell CHO and / or a human embryonic kidney epithelial cell HEK293.

[0026] According to yet another aspect of the present disclosure, provided is a kit for detecting an interleukin 6 receptor, comprising an antibody or antigen binding fragment of the present disclosure. In some embodiments, the kit can detect interleukin 6 receptor in vitro or in vivo.

[0027] According to yet another aspect of the present disclosure, provided is a pharmaceutical composition comprising the antibody or antigen binding fragment, the nucleic acid molecule, the expression vector, and / or the host cell, and a pharmaceutically acceptable auxiliary material.

[0028] In some embodiments, the pharmaceutically acceptable auxiliary material includes, but is not limited to, one or more of a carrier, an excipient, an adjuvant, a filler, a diluent, a disintegrant, a lubricant, a glidant, a binder, a solubilizer, a surfactant, an emulsifier, a preservative, an antioxidant, a flavor agent, a colorant, an osmolality regulator, and a support agent.

[0029] In some embodiments, the composition is tablets, capsules, solutions, granules, pills, pulvis, ointments, bolus, suspensions, powders, injections, suppositories, creams, sprays, or patches.

[0030] According to a sixth aspect of the present disclosure, provided is a use of an antibody or antigen binding fragment, or a nucleic acid molecule of the present disclosure in the preparation of a medicament for preventing and / or treating interleukin 6 receptor-associated diseases.

[0031] In some embodiments, provided is a method for preventing and / or treating an interleukin 6 receptor-associated disease comprising administering to a subject in need thereof a therapeutically effective amount of an antibody or antigen binding fragment, or a nucleic acid molecule of the present disclosure.

[0032] In some embodiments, the disease includes tumor, transplant rejection, autoimmune disease, infection, infection-related endotoxic shock, arthritis, inflammatory bowel disease, pelvic inflammatory disease, Alzheimer's disease, irritable bowel syndrome, ankylosing spondylitis, dermatomyositis, uveitis, Peyronie's disease, gallbladder disease, pilonidal disease, peritonitis, vasculitis, surgical adhesions, stroke, Lyme arthritis, meningoencephalitis, immune-mediated inflammatory diseases of the central and peripheral nervous system, pancreatitis, surgical trauma, graft-versus-host disease, cardiac disease, bone resorption, burns, myocardial infarction, Paget's disease, osteoporosis, septicemia, hepatic / pulmonary fibrosis, periodontitis, or hypochlorhydria. In some embodiments, the tumor comprises renal cell carcinoma, liver cancer, multiple myeloma, prostate cancer, bladder cancer, pancreatic cancer, B-cell malignancy, or nervous system cancer. In some embodiments, the arthritis comprises rheumatoid arthritis, psoriatic arthritis, or systemic juvenile idiopathic arthritis.

[0033] In some embodiments, the autoimmune disease comprises systemic lupus erythematosus, asthma, Crohn's disease, psoriasis, celiac disease, type I diabetes, multiple sclerosis, or ulcerative colitis.

[0034] According to yet another aspect of the present disclosure, provided is a method for treating a disease, comprising administering to a subject in need thereof the antibody or antigen binding fragment, the nucleic acid molecule, and / or the pharmaceutical composition.

[0035] According to yet another aspect of the present disclosure, provided is a use of the antibody or antigen binding fragment or the nucleic acid molecule in the preparation of a medicament for treating and / or preventing interleukin 6 receptor-associated diseases.

[0036] In some embodiments, the disease includes tumor, transplant rejection, autoimmune disease, infections, infection-related endotoxic shock, arthritis, inflammatory bowel disease, pelvic inflammatory disease, Alzheimer's disease, irritable bowel syndrome, ankylosing spondylitis, dermatomyositis, uveitis, Peyronie's disease, gallbladder disease, pilonidal disease, peritonitis, vasculitis, surgical adhesions, stroke, Lyme arthritis, meningoencephalitis, immune-mediated inflammatory diseases of the central and peripheral nervous system, pancreatitis, surgical trauma, graft-versus-host disease, cardiac disease, bone resorption, burns, myocardial infarction, Paget's disease, osteoporosis, septicemia, hepatic / pulmonary fibrosis, periodontitis, or hypochlorhydria.

[0037] In some embodiments, the tumor comprises renal cell carcinoma, liver cancer, multiple myeloma, prostate cancer, bladder cancer, pancreatic cancer, B-cell malignancy, or nervous system cancer. In some embodiments, the arthritis comprises rheumatoid arthritis, psoriatic arthritis, or systemic juvenile idiopathic arthritis.

[0038] In some embodiments, the autoimmune disease comprises systemic lupus erythematosus, asthma, Crohn's disease, psoriasis, celiac disease, type I diabetes, multiple sclerosis, or ulcerative colitis. Beneficial effects of the present invention:

[0039] Compared to 206mab, the antibodies or antigen binding fragments provided by the present disclosure have higher biological activity, higher FcRn affinity (particularly at pH 6.0 and pH 7.4) , and enhanced antibody stability (including thermal stability and freeze-thaw stability) . Thus, the antibodies or antigen binding fragments provided by the present disclosure have good prospects for clinical application.BRIEF DESCRIPTION OF THE DRAWINGS

[0040] Figure 1 illustrates the biological activity of 206mab as well as the mutants.

[0041] Figure 2 illustrates the relative binding activity of VDJ020, wherein Figure 2A illustrates detection of relative binding activity of 206mab and VDJ020-1 by ELISA method, Figure 2B illustrates detection of relative binding activity of 206mab and VDJ020-10, VDJ020-13 by ELISA method, and Figure 2C illustrates detection of relative binding activity of 206mab and VDJ020-3, VDJ020-14 by ELISA method.

[0042] Figure 3 illustrates the biological activity of VDJ020, wherein Figure 3A illustrates the results of the biological activity of 206mab and VDJ020-1 using 293-IL6 RES reporter gene assay, Figure 3B illustrates the biological activity of 206mab and VDJ020-3, VDJ020-14 using 293-IL6 RES reporter gene assay, and Figure 3C illustrates the biological activity of 206mab and VDJ020-10, VDJ020-13 using 293-IL6 RES reporter gene assay.

[0043] Figure 4 illustrates the DSC thermal stability analysis of VDJ020 antibody.

[0044] Figure 5 illustrates the biological activity of VDJ020 antibody determined by different methods, wherein Figure 5A illustrates the biological activity of VDJ020 antibody determined by a reporter gene assay, and Figure 5B illustrates the biological activity of VDJ020 antibody determined by the proliferation inhibition assay.DETAILED DESCRIPTION OF THE INVENTION

[0045] Interleukin-6 (IL-6) is a multifunctional cytokine discovered in the 1980s and was previously known as hepatocyte stimulating factor, B-cell stimulating factor 2, cytotoxic T-cell differentiation factor, B-cell differentiation factor, hybridoma / plasmacytoma growth factor, monocyte granulocyte inducer type 2, and thrombopoietin. Interleukin-6 (IL-6) is produced by various types of cells such as T-cells, B-cells, monocytes, fibroblasts, osteoblasts, keratin-forming cells, endothelial cells, mesangial cells and some tumor cells. IL-6 comprises four α-helical domains with a motif of four cysteine residues which are necessary for its tertiary structure. IL-6 transmits different biological signals to various tissues and cells by interacting with different IL-6 receptors on the cell surface and then via downstream signaling pathways.

[0046] Interleukin-6 (IL-6) binds to two receptors, one is the specific receptor IL-6R (a 80kDa type I transmembrane protein) , and the other is gp130, which is a common receptor subunit for members of the IL-6 cytokine family. The gp130 can be expressed in all cells, but the expression of the IL-6 receptor (IL-6R) is more restricted and is found mainly in hepatocytes, neutrophils, monocytes and CD4+ T cells. The dimerization of the interleukin IL-6 receptor gp130 initiates cellular events including activation of the JAK-STAT3 pathway and ras-mediated MAP kinase signaling.

[0047] Studies have shown that IL-6R is highly expressed in various tumor cells, including promyelocytic leukemia, astrocytoma, glioblastoma, multiple myeloma, prostate cancer, gastric cancer, liver cancer cells and the like. Therefore, inhibitors targeting IL-6 or IL-6R block the binding of IL-6 to IL-6R, thereby inhibiting IL-6 pathway signaling, and such IL-6 pathway inhibitors open a new course as potential therapeutics for a variety of diseases.

[0048] The present disclosure is based on the inventor's existing anti-human interleukin 6 receptor (IL-6R) monoclonal antibody 206mab (CN109563155A, incorporated herein by reference in its entirety) . Through mutation and screening, monoclonal antibodies with significantly improved affinity, stability and biological activity have been identified.

[0049] The sequences involved in the monoclonal antibodies of anti-human interleukin 6 receptor (IL-6R) of the present disclosure are as shown in Tables 1 and 2.

[0050] Table 1. Sequences of CDR regions of 206mab and 206mab-H mutants

[0051] Table 2. Amino acid sequence of the variable region of 206mab-H

[0052] Definition

[0053] Unless otherwise defined, all technical and scientific terms used herein have the same meanings as commonly used in the field to which the present invention belongs. For the purpose of interpreting this specification, the following definitions will be applied and, and where singular terms are used, they shall also encompass plural forms, and vice versa, as appropriate.

[0054] The singular form "a" and "an" as used herein include plural reference unless the context clearly indicates otherwise.

[0055] The term "about" as used herein is understood by those of ordinary skill in the art and can vary within a certain range depending on its context. If the use of this term is not otherwise clear to those of ordinary skill in the art based on the context in which it is used, "about" shall mean up to ±10%of a specified value

[0056] The terms "polypeptide" , "oligopeptide" , "peptide" and "protein" are used interchangeably herein and refer to polymers of amino acids of any length. The polymers may be linear or branched, may comprise modified amino acids, and may be interrupted by non-amino acids. The term also encompasses an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within this definition are, for example, polypeptides comprising one or more analogs of an amino acid (including, for example, non-natural amino acids, etc. ) , as well as other modifications known in the art. It is understood that, because the polypeptides as described herein are based on an antibody, the polypeptides can exist as a single chain or associated chain.

[0057] The term "amino acid" refers to natural, non-natural, and synthetic amino acids, including but not limited to D or L optical isomers, as well as amino acid analogs and peptidemimics. Standard single or three letter codes are used to designate amino acids. The term "natural L-amino acid" refers to the L optical isomer forms of glycine (G) , proline (P) , alanine (A) , valine (V) , leucine (L) , isoleucine (I) , methionine (M) , cysteine (C) , phenylalanine (F) , tyrosine (Y) , tryptophan (W) , histidine (H) , lysine (K ) , arginine (R) , glutamine (Q) , asparagine (N) , glutamic acid (E) , aspartic acid (D) , serine (S) , and threonine (T) .

[0058] In the present disclosure, the term "interleukin-6 (IL-6) " is a multifunctional cytokine found in 1980 and previously known as hepatocyte stimulating factor, B-cell stimulating factor 2, cytotoxic T-cell differentiation factor, B-cell differentiation factor, hybridoma / plasmacytoma growth factor, monocyte granulocyte inducer type 2 and thrombopoietin. Interleukin-6 (IL-6) is produced by various types of cells, such as T-cells, B-cells, monocytes, fibroblasts, osteoblasts, keratinocytes, endothelial cells, mesangial cells, and some tumor cells. It comprises four α-helical domains with a motif of four cysteine residues which are necessary for its tertiary structure. Interleukin-6 (IL-6) binds to two receptors, one is the specific receptor IL-6R (an 80kDa type I transmembrane protein) , and the other is gp130, which is a common receptor subunit for members of the IL-6 cytokine family. The gp130 can be expressed in all cells, but the expression of the IL-6 receptor (IL-6R) is more restricted and is found mainly in hepatocytes, neutrophils, monocytes and CD4+ T cells. The dimerization of the interleukin IL-6 receptor gp130 leads to the initiation of cellular events including activation of the JAK-STAT3 pathway and ras-mediated MAP kinase signaling.

[0059] In the present disclosure, the term “specific binding” refers to having binding selectivity to an antigen and is distinguishable from undesirable or non-specific binding. The binding ability of an antigen binding molecule to a particular antigen can be measured by enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to those skilled in the art (e.g., surface plasmon resonance (SPR) techniques, as well as by conventional binding assays. In one embodiment, for example as measured by SPR, the degree of binding of the antigen binding molecule to the unrelated protein is less than about 10%of the degree of binding of the antigen binding molecule to the target antigen. In some embodiments, the dissociation constant (Kd) of an antigen binding molecule for an antigen is ≤1 nM, ≤100 nM, ≤10 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM.

[0060] In the present disclosure, the term "affinity" or "binding affinity" refers to the strength of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding ligand (e.g., an antigen) . Binding affinity can be typically expressed by the dissociation constant (KD) , which is the ratio of the dissociation rate constant to the association rate constant (koff and kon, respectively) . Therefore, the equivalent affinity can include different rate constants as long as the ratio of the rate constants remains the same. The affinity can be measured by conventional methods known in the art, such as surface plasmon resonance (SPR) . The smaller the equilibrium dissociation constant, the more tightly the antibodies of the present disclosure or antigen-binding fragments thereof bind to IL-6R. In biological systems, good specific binding agents typically have dissociation constants in the range of 10-12 to 10-9. In some embodiments, the antibodies or antigen binding fragments thereof of the present disclosure have a binding affinity for IL-6R with dissociation constants of about 10-12, 10-11, 10-10, or 10-9.

[0061] The term "antibody" as used herein is an immunoglobulin molecule capable of specific binding to a target such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site located in a variable region of the immunoglobulin molecule. As used herein, the term encompasses not only intact polyclonal or monoclonal antibodies, but also their fragments (e.g., Fab, Fab', F (ab') 2, Fv) , single chains (ScFv) , their mutants, fusion proteins comprising an antibody portion (e.g., a domain antibody) , and any other modified configuration of the immunoglobulin molecule that comprises an antigen-recognition site. An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof) , and the antibody need not be of any particular class. The immunoglobulins can be assigned to different classes depending on the antibody amino acid sequence of the constant domain of their heavy chains. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of them can be further categorized into subclasses (isotypes) , for example, IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2. The heavy-chain constant domains that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.

[0062] In some embodiments provided herein, the antibody is a monoclonal antibody. The term "Monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies. In general, the individual antibodies that constitute the population are identical, except for possible naturally-occurring mutations that may be present in minor numbers. Monoclonal antibodies are highly specific, against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations, which typically include different antibodies against different determinants (epitopes) , each monoclonal antibody is against a single determinant on the antigen. The modifier "monoclonal" indicates that the characteristic of the antibody being obtained from a substantially homogeneous population of antibodies and is not construed as requiring production of the antibody by any particular method.

[0063] In some embodiments provided herein, the antibody is a humanized antibody. As used herein, the term "humanized" antibody refers to a form of a non-human (e.g., murine) antibody that is a specific chimeric immunoglobulin, immunoglobulin chain, or their fragments (such as Fv, Fab, Fab', F (ab') 2, or other antigen binding subsequence of the antibody) that contains a minimal sequence derived from a non-human immunoglobulin. For the most cases, the humanized antibody is a human immunoglobulin (a recipient antibody) in which residues from the complementary determining region (CDR) of the recipient are replaced by residues from a CDR from a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and biological activity. In some cases, the Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, the humanized antibody may comprise residues that are not found either in the recipient antibody or in the introduced CDR or framework sequence, but are included to further improve and optimize antibody performance. Typically, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody will also optimally comprise at least a portion of an immunoglobulin constant region or domain (Fc) , typically that of a human immunoglobulin. Other forms of humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody, which are also termed one or more CDRs "derived from" one or more CDRs of the original antibody.

[0064] In some embodiments provided herein, the antibody is a human antibody. As used herein, the term "human antibody" means an antibody having an amino acid sequence corresponding to that of an antibody produced by a human and / or prepared by using any of the techniques known in the art or in the present invention for preparing human antibodies. This definition of a human antibody includes antibodies containing at least one human heavy chain polypeptide or at least one human light chain polypeptide. Such one example is an antibody comprising murine light chain and human heavy chain polypeptides. Human antibodies can be produced using various techniques known in the art.

[0065] The present disclosure also relates to amino acid sequence variants of the present disclosure. When applied to a protein, the "variant" is a protein with sequence homology to the native biologically active protein that retains at least a portion of the therapeutic and / or biological activity of the biologically active protein. Amino acid sequence variants can be prepared by introducing appropriate modifications into the nucleotide sequence encoding the molecule or by peptide synthesis. Such modifications include, for example, a deletion, insertion and / or substitution of residues in the amino acid sequence of the antibody. Any combination of a deletion, insertion, and substitution can be performed to obtain a final construct, which has the desired properties, such as antigen binding activity.

[0066] The term "variable region" or "variable domain" as used herein refers to a domain of the heavy or light chain of an antibody that is involved in the binding of an antigen binding molecule to an antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of natural antibodies usually have a similar structure, where each domain comprises four conserved framework regions (FR) and three hypervariable regions (HVR) . A single VH or VL domain may be sufficient to confer antigen binding specificity. The term "variable" as used in the present invention refers to that certain segments of the variable domain are generally different in sequence between antibodies. The V domain mediates antigen binding and limits the specificity of a particular antibody for its specific antigen. However, variability is not evenly distributed throughout the variable domain. Instead, it is concentrated in three segments known as hypervariable regions (HVR) within the light chain and heavy chain variable domains. The more highly conserved portion of the variable domain is called the frame region (FR) . The variable domains of the natural heavy chain and light chain each comprise four FR regions, most of which adopt a β-sheet configuration, connected by three HVRs, which form a loop connection and, in some cases, form a part of the β-sheet structure. The HVRs in each chain are held together tightly by the FR regions and, together with the HVRs of the other chains, contribute to the formation of the antigen binding site of the antibody. Constant domains do not directly involve in antibody-antigen binding and have other effector functions, such as being involved in antibody-dependent cytotoxicity of antibodies.

[0067] The term "constant region" of an antibody as used herein refers to the constant region of the light chain of an antibody or the constant region of the heavy chain of an antibody, either alone or in combination.

[0068] The term "hypervariable region" or "HVR" as used herein, refers to a region in the variable domain region of an antibody that is highly variable in sequence and / or forms a structurally defined loop ( "hypervariable loop" ) . Typically, natural four-chain antibodies comprise six HVRs: three are present in the VH (H1, H2, H3) and three in the VL (L1, L2, L3) . HVRs typically comprise amino acid residues from hypervariable loops and / or from "complementary-determining regions (CDRs) " , and the amino acid residues from "complementary-determining regions (CDRs) " have the highest sequence variability and / or are involved in antigen recognition. It should be understood by those skilled in the art that, unless otherwise specified, the "CDR" and "complementary determining region" for a given antibody or region thereof (e.g., a variable region) should be understood to encompass any of "CDR" and "complementary determining region" as defined by any method known in the art. It is well known to those skilled in the art that the CDR of an antibody can be defined by various methods in the art, such as Kabat definition rule based on sequence variability, Chothia definition rule based on the positions of structural loop regions, Martin definition rule based on sequence and framework regions, IMGT definition rule based on amino acid sequence alignments with germline V genes, and Reference tools for antibody humanization design based on CDR grafting. It should be understood by those skilled in the art that, unless otherwise specified, the terms "CDR" and "complementary determining region" for a given antibody or region thereof (e.g., a variable region) should be understood to encompass any of CDRs as defined in the above known embodiments in the present invention. The amino acid sequences defined by the corresponding CDR definition rules should also fall within the scope of protection of the present invention.

[0069] The terms "framework" or "FR" as used herein refer to variable domain residues other than hypervariable region (HVR) residues. The FR of a variable domain typically consists of the following four FR domains: FR1, FR2, FR3, and FR4. Thus, the HVR and FR sequences typically occur in VH (or VL) in the following sequence: FR1-H1 (L1) -FR2-H2 (L2) -FR3-H3 (L3) -FR4.

[0070] The term "Fc region" as used herein is used to define a C-terminal region of an immunoglobulin heavy chain. "Fc region" may be a native sequence Fc region or a variant Fc region. The Fc region of immunoglobulins usually comprises two constant domains, CH2 and CH3. Although the boundaries of the Fc region of an immunoglobulin heavy chain can vary, the Fc region of a human IgG heavy chain is usually defined as a stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus.

[0071] The terms "Fc receptor" and "FcR" as used herein describe a receptor that binds to the Fc region of an antibody. The preferred FcR is a native sequence human FcR. Moreover, a preferred FcR is one which binds to an IgG antibody (aγ receptor) and includes the receptors of the FcγRI, FcγRII, and FcγRIII subclasses, including allelic variants and alternatively spliced forms of these receptors. FcγRII receptors include FcγRIIA (an "activating receptor" ) and FcγRIIB (an "inhibitory receptor" ) , which have similar amino acid sequences that differ primarily in cytoplasmic domains thereof. "FcR" also includes the neonatal receptor FcRn, which is responsible for transferring maternal IgG to the fetus.

[0072] The term "functional Fc region" as used herein has at least one effector function of a native sequence Fc region. Exemplary "effector function" includes C1q binding; complement-dependent cytotoxicity (CDC) ; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC) ; phagocytosis; and down-regulation of cell-surface receptors (e.g., B-cell receptors; BCRs) . Such effector functions typically require the combination of the Fc region with a binding domain (e.g., an antibody variable domain) and can be assessed using various assays known in the art for evaluating such antibody effector functions.

[0073] The term "native sequence Fc region" as used herein comprises an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature. A "variant Fc region" comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, but retains at least one effector function of the native sequence Fc region. Preferably, the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or the Fc region of a parent polypeptide, e.g., from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in the native sequence Fc region or the Fc region of the parent polypeptide. The variant Fc region herein preferably has at least about 80%sequence identity to a native sequence Fc region and / or the Fc region of a parent polypeptide, and most preferably has at least about 90%sequence identity thereto, and more preferably has at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%sequence identity thereto. In some embodiments of the present disclosure, the Fc region of the antibody of the present disclosure has mutations at positions 252, 254, and / or 256, where the numbering of the amino acid residue follows the numbering of the EU index in Kabat. In a specific embodiment, the heavy chain of the antibody may have an amino acid sequence as shown in SEQ ID NOs: 62~66 or an amino acid sequence having at least 85%sequence identity thereto.

[0074] The term "humanized antibody" as used herein comprises a complete humanized antibody sequence obtained by splicing the amino acid residues from a non-human hypervariable region (HVR) with constant regions of the heavy and light chains derived from a human antibody. In some embodiments, the humanized antibody comprises at least one, and typically two, variable domains, wherein all or substantially all of the HVRs (e.g., CDRs) correspond to the HVRs of the non-human antibody, and all or substantially all of the framework regions (FRs) correspond to the FRs of the human antibody. The humanized antibody may optionally comprise at least a portion of an antibody constant region derived from the human antibody. A "humanized form" of an antibody, such as a non-human antibody, refers to an antibody that has been humanized.

[0075] The term "classes" of an antibody as used herein refers to the type of constant domain or constant region possessed by the heavy chain of the antibody. There are five classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these classes can be further categorized into subclasses (isotypes) such as IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2. The heavy chain constant domains corresponding to the different classes of immunoglobulins are referred to as α, δ, ε, γ and μ. In specific embodiments, the antibody herein is a humanized IgG1 antibody.

[0076] When applied to a protein, the term "fragment" as used herein is a truncated form of a native biologically active protein that may or may not retain at least a portion of its therapeutic and / or biological activity. For example, a variant protein may share at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%amino acid sequence identity compared to the reference biologically active protein. Unless otherwise indicated, "antibody fragment" and "antigen binding fragment" are interchangeable in the context of the present invention and refer to an antibody fragment that retains the ability to specifically bind an antigen bound by a full-length antibody, such as a fragment that retains one or more CDR regions. Examples of antigen binding fragments include, but are not limited to, Fab, Fab', F (ab') 2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules, such as single-chain Fv (ScFv) ; nanobodies and multispecific antibodies formed by antibody fragments.

[0077] In the context of a polypeptide, a "linear sequence" or "sequence" is an order of amino acids in an amino to carboxyl terminus direction in a polypeptide, in which residues that neighbor each other in the sequence are continuous in the primary structure of the polypeptide. A "partial sequence" is a linear sequence of a portion of a polypeptide known to comprise additional residues in one or both directions.

[0078] The terms "polynucleotide" or "nucleic acid" , as used interchangeably herein refers to a polymer of nucleotides of any length and includes DNA and RNA. The nucleotides may be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and / or their analogs, or any substrate that may be incorporated into the polymer by DNA or RNA polymerase. The polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modifications to the nucleotide structure can be imparted before or after polymer assembly. Nucleotide sequences can be interrupted by non-nucleotide components. A polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component. Other types of modifications include, for example, "caps" , substitution of one or more of the naturally occurring nucleotides with an analog, inter-nucleotide modifications such as, for example, those modifications with uncharged linkages (e.g., methyl phosphonate, phosphotriester, phosphoramidate, carbamate, etc. ) and with charged linkages (e.g., phosphorothioate, phosphorodithioate, etc. ) , those modifications containing pendant moieties, such as proteins (e.g., nucleases, toxins, antibodies, signal peptides, poly-L-lysine, etc. ) , those modifications with intercalators (e.g., acridine, psoralen, etc. ) , those modifications containing chelators (e.g., a metal, a radioactive metal, boron, an oxidative metal, etc. ) , those modifications containing an alkylating agent, and those modifications with modified linkages (e.g., α anomeric nucleic acid, etc. ) , and unmodified forms of polynucleotide (s) . Further, any hydroxyl group ordinarily present in the sugar can be replaced, for example, with a phosphonate group, a phosphate group, protected by a standard protecting group, or activated to prepare an additional linkage to an additional nucleotide, or can be conjugated to a solid support. The 5' and 3' terminal OH may be partially phosphorylated or substituted with an amine or organic capping group of from 1 to 20 carbon atoms. Other hydroxyl groups can also be derivatized to standard protecting groups. Polynucleotide may also contain analogous forms of ribose or deoxyribose commonly known in the art, including, for example, 2'-O-methyl-, 2'-O-allyl-, 2'-fluoro-, or 2'-azido-ribose, carbocyclic sugar analogs, α-anomeric sugars, epimeric sugars (e.g., arabinose, xylose, or lyxoses) , pyranoses, furanose, sedoheptose, acyclic analogs, and abasic nucleoside analogs such as methyl ribosides. One or more phosphodiester linkages may be replaced with alternative linking groups. These alternative linking groups include, but are not limited to, embodiments in which phosphate is replaced with P (O) S ( "thioate" ) , P (S) S ( "dithioate" ) , (O) NR2 ( "amidinate " ) , P (O) R, P (O) OR', CO, or CH2 ( "formacetal" ) , in which each R or R' is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-O-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl, or arylalkyl (aralkyl) . Not all linages in a polynucleotide need to be the same. The aforementioned description applies to all polynucleotides referred to herein, including RNA and DNA.

[0079] The term "%sequence identity" or "sequence identity" as used herein is used to describe the degree of similarity between two nucleotide sequences or two amino acid sequences in the context of the present invention and has the same meaning as "percentage identity" . "The percentage homology of two sequences can be calculated as follows, after aligning the two sequences, by dividing the number of positions with identical residues by the total length of the aligned sequence and multiplying by 100%. Methods and tools for aligning two amino acid sequences or nucleotide sequences are well known in the art, such as the BLAST suite available on the NCBI website (Altschul, S. F. et al. (1990) J. Mol. Biol. 215: 403-410) . As used herein, a sequence having "at least 85%sequence identity" to another sequence refers to a sequence that has at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%sequence identity to that sequence.

[0080] The terms "vector" or "expression vector" and "expression construct" are used interchangeably herein and refer to a DNA molecule that can introduce a specific gene operably linked to it into a target cell and directs its expression. The vectors include those vectors as self-replicating nucleic acid structures and those vectors incorporated into the genome of a host cell into which they have been introduced. The expression vector of the present invention comprises an expression cassette. The expression vectors allow transcription of large amounts of stable mRNA. Once the expression vector is inside the target cell, a ribonucleic acid molecule or protein encoded by the gene is generated by the cellular transcription and / or translation machinery.

[0081] The terms "host cell" , "host cell line" and "host cell culture" are used interchangeably herein and refer to cells into which exogenous nucleic acids have been introduced, also including the progeny of such cells. Host cells include "transformants" and "transformed cells" , including primary transformed cells and the progenies derived from them. The nucleic acids of the progenies may not be completely identical to the parental cells and can contain mutations. Host cells include cultured cells, such as cultured mammalian cells, such as CHO cells, HEK293 cells, BHK cells, NS0 cells, SP2 / 0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER. C6 cells, or hybridoma cells, yeast cells, insect cells, and plant cells, and also include transgenic animals, transgenic plants or cells contained within cultured plant or animal tissues.

[0082] The term "individual" or "subject" as used herein is a mammal, more preferably a human. The mammal also includes, but is not limited to, farm animal, sports animal, pet, primate, horse, dog, cat, mouse and rat.

[0083] The term "effective amount" or "therapeutically effective amount" as used herein refers to an amount of an agent sufficient to produce a beneficial or desired result. The therapeutically effective amount may vary depending upon one or more of: the subject and disease condition to be treated, the weight and age of the subject, the severity of the disease condition, the manner of administration, and the like, which can be readily determined by one of ordinary skill in the art. An effective amount of an active agent may be administered in a single or multiple doses. A component may be described herein as having at least an effective amount, or at least an amount effective to produce a desired result, for example, a result associated with a particular goal or purpose, such as a result associated with any particular goal or purpose described herein. "Effective amount" also applies to a dosage that will provide an image for detection by an appropriate imaging method. The specific dosage can vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, the timing of administration, the tissue to be imaged, and the physical delivery system in which the agent is carried.

[0084] The term "pharmaceutically acceptable auxiliary material" as used herein refers to an auxiliary component that is pharmacologically and / or physiologically compatible with a subject and an active ingredient, which is well known in the art. Examples include one or more of a carrier, an excipient, an adjuvant, a filler, a diluent, a disintegrant, a lubricant, a glidant, a binder, a solubilizer, a surfactant, an emulsifier, a preservative, an antioxidant, a flavor agent, a colorant, an osmolality regulator, and a support agent.

[0085] In order to make the object, technical solution and advantage of the present invention clearer and more understandable, the present invention is further described in detail below in conjunction with examples. The specific examples described herein are intended to explain the present invention and should not be construed as limiting the scope of the present invention. In addition, in the following description, known structures and techniques have been omitted to avoid unnecessary confusion about the concepts of the present disclosure. Such structures and techniques are also described in numerous publications.

[0086] The following examples and drawings are provided below to aid in understanding the present invention. It should be understood, however, that these examples and drawings are intended to illustrate the present invention only, but do not constitute any limitation on the present invention. The actual scope of protection of the present invention is set forth in the claims. It should be understood that any modifications and changes may be made without departing from the spirit of the present invention.

[0087] Example

[0088] Example 1. Expression and purification of 206mab-mut in HEK293 cells

[0089] One day before transfection, 50mL of HEK293 cells were formulated using KOP293 cells (Kairuibiotech, Zhuhai) at a density of 1.2×106cells / mL, placed in a 250mL Erlenmeyer flask, and cultured for 20-25h at 135rpm, 37℃, and 5%CO2. The cells were used for transfection experiments when the cell density reached about 2×106cells / mL with the cells in the logarithmic growth phase and the viability of above 95%. The recombinant plasmids were constructed by cloning the nucleic acids encoding heavy and light chain of the antibody (the sequences as shown in SEQ ID NO: 67~83) into PEE6.4 vector and PEE14.4 vector through the HindIII &EcoRI restriction sites, respectively. 50 μg of recombinant plasmid expressing 206mab and 206mab mutants 206mab-mut-1~17 (the amino acid sequences as shown in Table 3) was added to Opti-MEM in a total volume of 2 mL and gently mixed, and 250 μg of PEI was added to Opti-MEM in a total volume of 2 mL and incubated for 5 min at room temperature. 2mL of PEI dilution was added to the corresponding plasmid dilution, mixed well and incubated at room temperature for 20min. The PEI-DNA mixture solution was slowly dropped in the Erlenmeyer flask containing HEK293 cells with gently agitating, then the transfected cells were cultured in a shaking incubator at 135 rpm, 37℃, and 5%CO2.24 hours after transfection, 50×KT-Feed 1mL and 500×VPA 100ul were added, and 5 days after transfection, the culture supernatant was collected by centrifugation at 3,000 rpm for 15 min. The cell expression supernatant was subjected to high-speed centrifugation, followed by filtering to remove impurities. The supernatant obtained was subjected to affinity chromatography using a HiTrap MabSelect SuRe pre-packed column. The column was rinsed with pure water and equilibrated with PB buffer, then the supernatant was loaded to the chromatography column for binding. Following loading, the column was rinsed with PB buffer to the baseline, and then the protein was eluted with 0.1 M citrate eluent, and the eluted protein was neutralized with 1 M Tris-HCl, appropriately concentrated, and loaded on the Superdex200 column pre-equilibrated with PBS for further purification. The collected proteins were concentrated and subjected to SDS-PAGE electrophoresis identification and SEC-HPLC purity detection. The purity results were shown in Table 4.

[0090] Table 3. Amino acid sequences of 206mab-H mutants

[0091] The amino acid sequences of the light chain variable regions of 206mab and 206mab mutants 206mab-mut-1 to 17 are as follows:

[0092] DIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYYTSRLHSGVPSR FSGSGSGTDFTFTISSLQPEDIATYYCGQGNRLPYTFGQGTKVEIK (SEQ ID NO: 60)

[0093] The amino acid sequences of the light chains of 206mab and 206mab mutants206mab-mut-1 to 17 are as follows:

[0094] DIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYYTSRLHSGVP SRFSGSGSGTDFTFTISSLQPEDIATYYCGQGNRLPYTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 61)

[0095] Table 4. SEC purity results for 206mab-mut

[0096] Example 2. Affinity assay for transiently expressed 206mab-mut antibodies

[0097] The affinity of 206mab-mut-1~17 and their parent antibody 206mab for IL6R was determined by Bio-Layer Interferometry (BLI) . All 18 monoclonal antibodies were diluted to 20 nM, and the human IL6R protein (P08887-1) was serially diluted from 50 nM down to approximately 3.125 nM. 18 monoclonal antibodies were loaded onto the ProA probe at 400 rpm, and then diluted different concentrations of hIL6R were bound to the ProA probe with the antibodies attached. The probes with antigen-antibody complex were placed in analyte-free Q buffer to dissociate the bound analyte. The probes were immersed in regeneration buffer to remove any remaining bound analytes to regenerate and then be stored. The affinity data were obtained by integrating the fitted curves of various concentrations using the analysis software provided with the gator system. The results were shown in Table 5.

[0098] Table 5. Affinity results of 206mab and 206mab-mut-1~17

[0099] Example 3. Proliferation inhibition assay for the biological activity of 206mab-mut antibodies

[0100] DS-1 cells (CRL-11102) were starved for 24h and then plated in a 96-well plate at a density of 2×104 cells / 80μl / well. IL-6 was diluted to 20 ng / mL with 1640 medium containing 10%FBS (Gibco) and added to the sample wells and positive control wells at 10 μl / well, and 1640 medium containing 10%FBS was added to the negative wells at 10 μl / well. The antibodies 206mab and 206mab-mut-1~17 were diluted to 1mg / mL with 1640 medium and serially diluted into 8 concentrations in a 4-fold gradient, and added to the corresponding position wells of the 96-well plate at 10μl / well, with duplicates for each concentration, and 1640 medium was added to the positive and negative control groups at 10 μl / well. After adding the samples, the above reaction plate was thoroughly mixed on a plate shaker and then placed in a 37℃ cell culture incubator for 72h. The MTS detection reagent (Promega) was thawed, mixed well and then added to the above 96-well plate at 20 μl / well. The plate was mixed again on a plate shaker and then incubated in a 37℃ cell incubator for 0.5h. Absorbance was measured at 490 nm wavelength on a TECAN multifunctional microplate reader. And the data were plotted using Prism 5 (GraphPad) software and the relative biological activity of 206mab mut was calculated using the formula: 206mab IC50 / 206mab mut IC50) *100%. The biological activity of 206mab was set as 100%, and the results were shown in Table 6 and Figure 1. The biological activities of the three antibody molecules, 206mab-mut-3, 206mab-mut-10, and 206mab-mut-14, were significantly improved compared to 206mab.

[0101] Table 6. Biological activity results of 206mab-mut

[0102] Example 4. Relative binding activity assay of VDJ020

[0103] Five antibodies, 206mab-mut-1, 206mab-mut-3, 206mab-mut-10, 206mab-mut-13, 206mab-mut-14, were selected, each of which was modified at three amino acid sites (M252Y  / S254T  / T256E) of the heavy chain Fc region. These modifications were intended to prolong the half-life of the antibodies. The modified antibodies were named VDJ020-1, VDJ020-3, VDJ020-10, VDJ020-13, VDJ020-14, respectively and the sequences are shown in Table 7.

[0104] Table 7. Heavy chain sequences of the antibodies with modified Fc region

[0105] The heavy and light chain genes of the five antibodies were cloned into pCDNA3.4 vector through HindIII &EcoRI double digestion site, and the heavy and light chains were co-transformed into HEK293 cells, and the five antibodies, VDJ020-1, VDJ020-3, VDJ020-10, VDJ020-13, and VDJ020-14 were expressed and purified according to the method in Example 1, and the relative binding activity of the five antibodies was detected using an ELISA method. Human IL6R was diluted to 1 μg / mL, and added at 100 μL / well. The plate was coated at 4℃ overnight. The next day, the plate was washed and blocked with 5%skim milk for 2 hours. Then the plate was washed and the antibody samples with different concentrations were added and incubated at 37℃ for 1h. The plate was washed again, 100 μl of HRP-labeled goat anti-human IgG secondary antibody was added to each plate, and incubated at 37℃ for 30 min. Then TMB substrate solution was added, and color development was allowed to proceed at 37℃ for 10 min, and finally 50 μL of H2SO4 was added to stop the reaction. The OD450 values were read using TECAN multifunctional microplate reader. The data were plotted using the Prism 5 (GraphPad) software, and the relative binding activity was calculated using the formula: (206mab EC50 / VDJ020EC50) *100%. The binding activity of 206mab was set as 100%and the results were shown in Figure 2 and Table 8. The relative binding activities were essentially consistent.

[0106] Table 8. Relative binding activity results for VDJ020

[0107] Example 5. Affinity assay of VDJ020

[0108] The affinity of five antibodies, VDJ020-1, VDJ020-3, VDJ020-10, VDJ020-13, and VDJ020-14, to IL6R was detected using a SPR method with a Biacore instrument. The results were shown in Table 9.

[0109] Table 9. Results of affinity assay of VDJ020

[0110] Example 6. Biological activity of VDJ020 detected by reporter gene assay

[0111] The HEK293-IL6 luciferase reporter gene cell line was constructed by transfecting the plasmid pGL4.47 [luc2P SIE Hygro] (Promega) into HEK293 cells (ATCC) . HEK293-IL6 reporter gene cells were digested with trypsin at room temperature for about 1 min, and the digestion was terminated by adding DMEM medium (Gibco) when the cells were detached. Cells were mixed with gently blowing and centrifuged at 200~300g for 5 min. The supernatant was discarded, and the cells were resuspended and counted. The cell density was adjusted to 5×105 cells / mL and added to the corresponding wells at 80μL / well. IL6 was diluted to 50ng / mL and added to the sample and positive control wells at 10μL / well, and the basal medium was added to the negative control at 10μl / wells. The antibodies 206mab and VDJ020 were diluted to 200 μg / mL with medium and serially diluted to 8 concentrations in a 5-fold gradient. the diluted antibodies were added to the corresponding wells in the 96-well plate at 10μl / well, with duplicates for each concentration. The basal medium was added to positive and negative control groups at 10μl / well, respectively. The cell plates were incubated in a 37℃, 5%CO2 cell incubator for 22h. The next day, One Lite assay reagent that had been thawed, mixed and warmed to room temperature was then added to the above 96-well plate at 100 μl / well. The plate was mixed well on a shaker for 3 min, and luminescence values were read using a multifunctional microplate reader. The data were also plotted using Prism 5 (GraphPad) software and the relative biological activity of VDJ020 was calculated using the formula: (206mab IC50 / VDJ020 IC50) *100%. The biological activity of 206mab was set as 100%. The results were shown in Table 10 and Figure 3. The data showed that the biological activity of VDJ020-14 was 2.6 times higher than 206mab.

[0112] Table 10. Biological activity results of VDJ020

[0113] Example 7. Assay of binding capacity of VDJ020 to FcRn

[0114] The affinity of VDJ020 to FcRn was determined in different pH buffer systems. Human RcRn (hFcRn, Acrobiosystems) was biotinylated using a biotinylation kit, diluted to a concentration of 25 nM, loaded onto the SA probe, and then reacted with different concentration gradients of VDJ020 antibodies in both pH 6.0 and pH 7.4 buffer systems, respectively. The dissociation was performed in buffers at corresponding pH. The affinity values were obtained by fitting the data using the software provided with the instrument. The results were shown in Table 11. The results showed that the binding of VDJ020 antibody to hFcRn was dramatically increased compared to 206mab in both pH 6.0 and pH 7.4 buffer systems.

[0115] Table 11. Affinity results of VDJ020 antibody to hFcRn

[0116] Example 8. Thermal Stability Analysis of VDJ020 Antibody

[0117] The thermal stability of IgG1 humanized antibodies was analyzed by the Institute of Process Engineering, Chinese Academy of Sciences, using a MicrolCalTM VP-DSC system (Malvern, UK) , based on the principle of differential scanning calorimetry (DSC) . The samples and buffers were degassed by a vacuum pump for 5 min and then assayed. The instrument parameters were as follows: the heating rate of 60℃ / h; the temperature range of 25-95℃; and the feedback mode: none. Sample spectra were subtracted the buffer spectrum, and the data analysis was performed by the MicrolCal Origin 7.0 (Origin-Lab Corp., MA) software provided with the system. The results were shown in Table 12 and Figure 4. Tm1 was the temperature at which the interface of the two CH2 domains melted, Tm2 was the temperature at which the interface of the heavy and light chains melted, and Tm3 was the temperature at which the interface of the two CH3 domains melted. The data indicate that the Tm1 value of the VDJ020 antibody was slightly decreased, while Tm2 and Tm3 remain essentially unchanged.

[0118] Table 12. Thermal Stability Results of VDJ020 Antibody

[0119] Example 9. Isoelectric point determination of VDJ020

[0120] The isoelectric point (pI) of VDJ020 was detected using a Maurice bifunctional analysis system based on the principle of capillary electrophoresis. The inner wall of the capillary was coated with polymer to reduce the electroosmotic flow, and then the test samples and the ampholytes were mixed and injected. The two electrode chambers were filled with acid and alkali solutions, respectively. and a pH gradient was gradually formed in the capillary after applying a voltage to the operational electrolyte solution. Each solute became neutral when migrating to its respective pI in the capillary to form a focused zone, and then detected using the full-column imaging method. The results were shown in Table 13. The isoelectric point of VDJ020 did not change significantly, compared to 206mab.

[0121] Table 13. Isoelectric point detection results of VDJ020

[0122] Example 10. Stability Assay of VDJ020 Antibody

[0123] Combining all the above data collected, two antibodies, VDJ020-3 and VDH020-14, were selected for stability testing, and two concentrations of 67 mg / mL and 2 mg / mL were set for testing of each antibody. The high concentration samples were subjected to accelerated stability testing for 0 week, 1 week, 2 weeks, and 4 weeks at 40℃. The low concentration samples were divided into two groups; one group was subjected to repeated freeze-thaw cycle treatments of 3, 5, and 10 times, while the other group was subjected to accelerated treatments for 0 week, 1 week, 2 weeks, and 4 weeks at 40℃. The prepared samples were assayed for protein content, purity, isoelectric point, charge heterogeneity, reduced and non-reduced CE-SDS, biological activity and relative binding activity to evaluate the stability of the VDJ020 antibody, and the results were shown in Tables 14~16. Considering all the data, it was shown that both molecules, VDJ020-3 and VDJ020-14, were relatively stable under accelerated conditions of high temperature at 40℃ and under freeze-thaw conditions.

[0124] Table 14. High temperature stability results of 67 mg / mL formulations

[0125] Table 15. High Temperature Stability Results of 2 mg / mL Formulations

[0126] Table 16. Freeze-thaw stability results for 2 mg / mL formulations

[0127] Example 11. Biological activity of VDJ020 antibody detected using different methods

[0128] The biological activities of VDJ020-3 and VDJ020-14 were detected using reporter gene assay and proliferation inhibition assay, respectively, with the same method as above. The results were shown in Table 17 and Figure 5. The data showed that the biological activity of VDJ020-14 detected by the reporter gene method was 2.8 times higher than that of VDJ020-3. The biological activity of VDJ020-14 was 3.2 times higher than that of VDJ020-3 as detected by the proliferation inhibition assay. The biological activity of VDJ020-14 was approximately 3 times higher than that of VDJ020-3.

[0129] Table 17. Biological activity detection results of VDJ020 antibody using different methods

Claims

1.An anti-interleukin 6 receptor antibody or antigen binding fragment, characterized in that the antibody or antigen binding fragment comprises at least one light chain and at least one heavy chain, wherein the light chain comprises at least one light chain variable region and the heavy chain comprises at least one heavy chain variable region;the heavy chain variable region has an HCDR1 having an amino acid sequence as shown in SEQ ID NO: 1, an HCDR2 having an amino acid sequence as represented by general formula (1) , and an HCDR3 having an amino acid sequence as shown in SEQ ID NO: 3;the light chain variable region has an LCDR1 having an amino acid sequence as shown in SEQ ID NO: 4, an LCDR2 having an amino acid sequence as shown in SEQ ID NO: 5, and an LCDR3 having an amino acid sequence as shown in SEQ ID NO: 6; andthe general formula (1) has an amino acid sequence shown as FISYSGX1TTYNPSLKS, wherein X1 is selected from G, V, F, K, or R.2.The antibody or antigen binding fragment according to claim 1, characterized in that the HCDR2 of the heavy chain variable region has an amino acid sequence as shown in any one of SEQ ID NOs: 7, 9, 16, 19 and 20.3.The antibody or antigen binding fragment according to claim 1, characterized in that the heavy chain variable region comprises an amino acid sequence as shown in any one of SEQ ID NOs: 25, 27, 34, 37 and 38, or an amino acid sequence having at least 85%sequence identity thereto, and / or, the light chain variable region has an amino acid sequence as shown in SEQ ID NO: 60 or an amino acid sequence having at least 85%sequence identity thereto.4.The antibody or antigen binding fragment according to claim 1, characterized in that the antibody has an Fc region having a mutation at positions 252, 254 and / or 256;preferably, the Fc region of the antibody has a mutation of M252Y, S254T and / or T256E;preferably, the heavy chain comprises an amino acid sequence as shown in any one of SEQ ID NOs: 62~66, or an amino acid sequence having at least 85%sequence identity thereto, and / orthe light chain has an amino acid sequence as shown in SEQ ID NO: 61, or an amino acid sequence having at least 85%sequence identity thereto.5.The antibody or antigen binding fragment according to claim 1, characterized in that the antibody is a humanized antibody,preferably, the antibody is an IgA, IgD, IgE, IgG or IgM antibody,more preferably, the antibody is an IgG1, IgG2, IgG3, IgG4, IgA1 or IgA2 antibody.6.The antibody or antigen binding fragment according to claim 1, characterized in that the antibody or antigen binding fragment has thermal stability and freeze-thaw stability.7.The antibody or antigen binding fragment according to claim 1, characterized in that the antibody or antigen binding fragment has an isoelectric point ranging from 9.0~10.0.8.A nucleic acid molecule encoding the antibody or antigen binding fragment according to any one of claims 1 to 7.9.An expression vector comprising the nucleic acid molecule according to claim 8.10.A host cell comprising the nucleic acid molecule according to claim 8.11.A kit for detecting an interleukin 6 receptor, comprising the antibody or antigen binding fragment according to any one of claims 1 to 7.12.A pharmaceutical composition comprising: the antibody or antigen binding fragment according to any one of claims 1 to 7, the nucleic acid molecule according to claim 8, the expression vector according to claim 9, and / or the host cell according to claim 10; and a pharmaceutically acceptable auxiliary material;preferably, the pharmaceutically acceptable auxiliary material includes, but is not limited to, one or more of a carrier, an excipient, an adjuvant, a filler, a diluent, a disintegrant, a lubricant, a glidant, a binder, a solubilizer, a surfactant, an emulsifier, a preservative, an antioxidant, a flavor agent, a colorant, an osmolality regulator, and a support agent.13.Use of the antibody or antigen binding fragment according to any one of claims 1 to 7 or the nucleic acid molecule according to claim 8 in the preparation of a kit for diagnosing an interleukin 6 receptor-associated disease.14.Use of the antibody or antigen binding fragment according to any one of claims 1 to 7 or the nucleic acid molecule according to claim 8 in the preparation of a medicament for preventing and / or treating an interleukin 6 receptor-associated disease.15.The use according to claim 13 or 14, characterized in that the disease includes tumor, transplant rejection, autoimmune disease, infection, infection-related endotoxic shock, arthritis, inflammatory bowel disease, pelvic inflammatory disease, Alzheimer's disease, irritable bowel syndrome, ankylosing spondylitis, dermatomyositis, uveitis, Peyronie's disease, gallbladder disease, pilonidal disease, peritonitis, vasculitis, surgical adhesions, stroke, Lyme arthritis, meningoencephalitis, immune-mediated inflammatory diseases of central and peripheral nervous system, pancreatitis, surgical trauma, graft-versus-host disease, cardiac disease, bone resorption, burns, myocardial infarction, Paget's disease, osteoporosis, septicemia, hepatic / pulmonary fibrosis, periodontitis, or hypochlorhydria;preferably, the tumor comprises renal cell carcinoma, liver cancer, multiple myeloma, prostate cancer, bladder cancer, pancreatic cancer, B-cell malignancy, or nervous system cancer;preferably, the arthritis comprises rheumatoid arthritis, psoriatic arthritis or systemic juvenile idiopathic arthritis;preferably, the autoimmune disease comprises systemic lupus erythematosus, asthma, Crohn's disease, psoriasis, celiac disease, type I diabetes, multiple sclerosis, or ulcerative colitis.

Citation Information

Patent Citations

  • Method of Modifying Isoelectric Point of Antibody Via Amino Acid Substitution in CDR

    US20110076275A1

  • Antibody Molecules

    US20110098450A1

  • Anti-IL-6 Receptor Antibody

    US20110245473A1

  • Antibodies, composition and kits comprising same, and methods of use thereof

    US20190315854A1

  • AU2012200724A1