Lipidated tlr7 / 8 modulators as adjuvants and uses thereof
Patent Information
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- PFIZER INC
- Filing Date
- 2025-10-23
- Publication Date
- 2026-06-18
AI Technical Summary
Current adjuvants for vaccines do not effectively target the lymph nodes to activate immune cells while minimizing systemic exposure, leading to potential systemic inflammation.
Development of lipidated TLR7/8 agonists that conjugate to albumin for targeted delivery to lymph nodes, enhancing immune activation and minimizing systemic exposure.
The lipidated TLR7/8 agonists enhance immune response in lymph nodes, providing sustained adjuvant activity and reducing systemic inflammation.
Smart Images

Figure IB2025060790_18062026_PF_FP_ABST
Abstract
Description
[0001] LIPIDATED TLR7 / 8 MODULATORS AS ADJUVANTS AND USES THEREOF
[0002] BACKGROUND
[0003] The present disclosure relates to novel lipidated Toll-like receptor 7 (TLR7), Toll-like receptor 8 (TLR8), and Toll-like receptor 7 / 8 (TLR7 / 8) modulating adjuvant compounds. The disclosure also relates to the preparation of the compounds and intermediates used in the preparation, compositions containing the compounds, and uses of the compounds, including as adjuvants for antigens of interest.
[0004] Studies and research regarding adjuvant use as a vaccine component have significantly increased nowadays. Adjuvants are compounds that enhance immune system activation and recognition of a vaccine's active component, concerning subunit-based vaccines, as well as RNA-based vaccines.
[0005] Adjuvants act by enhancing the innate immune system's response magnitude, breadth, and durability. The potency of adjuvants is closely related to their ability to be recognized as pathogens / foreign bodies through pattern recognition receptors (PRRs). It is expected that a vaccine's active component will become recognized, thereby triggering a specific and long-lasting immune response to be mounted through the adaptive immune system (Excler et al., Nat. Med., 27 (2021), pp. 591-600).
[0006] Toll-like receptors (TLRs) are a family of transmembrane proteins that recognize structurally conserved molecules that are derived from and unique to pathogens, referred to as pathogen-associated molecular patterns (PAMPs), a sub-class of PRR. As such, TLRs function in the mammalian immune system as front-line sensors of pathogen-associated molecular patterns, detecting the presence of invading pathogens (Takeuchi and Akira 2010 Cell 140:805-820). TLR engagement in sentinel immune cells causes biosynthesis of selected cytokines (e.g., type I interferons), induction of costimulatory molecules, and increased antigen presentation capacity. These are important molecular mechanisms that activate innate and adaptive immune responses. Accordingly, agonists and antagonists of TLRs find use in modulating immune responses. TLR agonists are typically employed to stimulate immune responses, whereas TLR antagonists are typically employed to inhibit immune responses (Gosu etal 2012. Molecules 17:13503-13529).
[0007] The human genome contains 10 known functional TLRs, of these TLR3, TLR7, TLR8, and TLR9 sense nucleic acids and their degradation products. The distribution of TLR7, TLR8, and TLR9 is restricted to the endosomal compartments of cells and they are preferentially expressed in cells of the immune system. In the activated, dimeric receptor configuration TLR7 and TLR8 recognize single strand RNA at one ligand binding site and the ribonucleoside degradation products guanosine and uridine, respectively, (as well as small molecule ligands with related structural motifs) at a second ligand binding site (Zhang et al 2016 Immunity 45(4);737-748: Tanji et al 2015 Nat Struct Mol Biol 22: 109-115). Engagement of TLR7 in plasmacytoid dendritic cells leads to the induction of Type I interferon, which plays essential functions in the control of the adaptive immune response (Bao and Liu 2013 Protein Cell 4:40-5). Engagement of TLR8 in myeloid dendritic cells, monocytes and monocyte-derived dendritic cells induces a prominent pro-inflammatory cytokine profile, characterized by increased production of tumor necrosis factor alpha, interleukin-12, and IL-18 (Eigenbrod et al J Immunol, 2015, 195,1092-1099). Thus, virtually all major types of monocytic and dendritic cells can be activated by agonists of TLR7 and TLR8 to become highly effective antigen-presenting cells, thereby promoting an effective innate and adaptive immune response. Most antigen presenting cell types express only one of these two receptors, accordingly small molecules with potent agonist activity against both TLR7 and TLR8 receptors are potentially more effective immune adjuvants than agonists specific for only one of these TLRs. Thus, a TLR7 / TLR8 (TLR7 / 8) small molecule agonist with dual bioactivity would cause innate immune responses in a wider range of antigen presenting cells and other key immune cell types, including plasmacytoid and myeloid dendritic cells, monocytes, and B cells (van Haren et al 2016 J Immunol 197:4413-4424; Ganapathi et al 2015 Pios One 10(8).e0134640).
[0008] Albumin has been extensively studied as a natural vector for lymph node targeted drug delivery (Adv. Drug Delivery Rev. 2018, 130, 73−89). First, albumin (about 7 nm in size) is the most abundant protein in the blood, reaching a concentration of 40 mg / mL, but maintaining a relatively lower concentration, about 14 mg / mL, in the interstitial fluid. This concentration difference tends to drive albumin to the lymphatics instead of blood capillaries. Second, albumin has an extraordinarily long half-life and is continuously synthesized in the liver for circulation. Third, natural ligands, such as long aliphatic fatty acids and hydrophobic molecules, have been discovered to bind albumin with their complexed crystal structures also being resolved. The albumin hitchhiking lymph node targeting was first demonstrated with TLR9 ligands conjugated to lipids and natural hydrophobic molecules such as cholesterol (Nature 507, 519–522, 2014).
[0009] What is needed in the field is a TLR7 / 8 agonist targeted to accumulate in the lymph node to (a) activate the immune cells in the lymph node to adjuvant the vaccine antigen, while (b) minimizing systemic exposure to the TLR7 / 8 agonist in order to circumvent systemic inflammation.
[0010] Accordingly, there remains a need for improved adjuvants targeted to accumulate in the lymph node. The current disclosure relates to the use of potent dual TLR7 / 8 agonists conjugated to a lipid. SUMMARY OF THE DISCLOSURE
[0011] The present disclosure provides, in part, compounds of Formula (I) and pharmaceutically acceptable salts thereof. Such compounds may agonize or modulate the activity of TLR7 and / or TLR8 and may be useful as vaccine adjuvants. Also provided are pharmaceutical compositions comprising the compounds or salts of the disclosure, alone or in combination with additional therapeutic agents. The present disclosure also provides, in part, methods for preparing such compounds, pharmaceutically acceptable salts and compositions of the disclosure, and methods of using the foregoing. This summary is provided to introduce a selection of concepts in a simplified form that are further described below in the detailed description. This summary is not intended to identify key features or essential features of the claimed subject matter, nor is it intended to be used in isolation as an aid in determining the scope of the claimed subject matter.
[0012] According to an embodiment of the disclosure there is provided a compound of Formula (I)
[0013]
[0014] or a pharmaceutically acceptable salt thereof, wherein:
[0015] Y is -O- or -CH2-; and
[0016] one of X1and X2is H, and the other of X1and X2has a formula selected from the group consisting of formula(a), formula(b), and formula(c):
[0017]
[0018]
[0019] wherein:
[0020] a is 0 or 1;
[0021] r1 is an integer from 2 to 6;
[0022] r2 is an integer from 10 to 20;
[0023] r3 is an integer from 0 to 6;
[0024] n1 is 0 or 1 and n2 is 0 or 1, wherein at least one of n1 and n2 is 1;
[0025] n3 is 0 or 1; and
[0026] p is an integer from 0 to 6.
[0027] Described below are embodiments of the disclosure, where for convenience Embodiment 1 (E1) is identical to the embodiment of Formula (I) provided above.
[0028] It is to be understood that both the foregoing general description and the following detailed description are exemplary and explanatory only and are not restrictive of the disclosure, as claimed.
[0029] SEQUENCE IDENTIFIERS SEQ ID NO: 1 sets forth an amino acid sequence for wild type E. coli full-length FimH, including the donor strand FimG peptide connected through a linker (FimH-DSG_WT) FACKTASGTAIPIGGGSANVYVNLAPWNVGQNLWDLSTQIFCHNDYPETITDYVTLQRGSAY GGVLSSFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAV LILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQ NLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRQGTIIPANNTVSLGAVGTSAVSLGLTAN YARTGGQVTAGNVQSIIGVTFVYQGGSSGGGADVTITVNGKWAK
[0030] SEQ ID NO: 2 sets forth an amino acid sequence for the mutant E. coli
[0031] FimH DSG_G 15A_G 16A_V27A FACKTASGTAIPIGAASANVYVNLAPAVNVGQNLWDLSTQIFCHNDYPETITDYVTLQRGSAY GGVLSSFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAV LILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQ NLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRQGTIIPANNTVSLGAVGTSAVSLGLTAN YARTGGQVTAGNVQSIIGVTFVYQGGSSGGGADVTITVNGKWAK SEQ ID NO: 3 sets forth the nucleic acid sequence for BMD576 / FimHDSG- SerGlyGPI / hHBB_80pA AGGAGGACUGGUCGAACCUGCAUAGUGAUCAUAAGGUCAGCAUAGCCACCAUGGAGAC CGACACACUGCUGCUGUGGGUGCUGCUGCUGUGGGUGCCCGGCUCCACCGGCUUCGC UUGCAAGACAGCCAGCGGAACCGCCAUCCCUAUCGGCGCAGCAAGCGCCAACGUCUAC GUGAAUCUGGCUCCCGCAGUGAACGUGGGACAGAAUCUGGUGGUGGAUCUGAGCACCC AGAUCUUCUGCCACAAUGACUACCCCGAGACCAUCACAGACUACGUGACACUGCAGAGA GGAAGCGCCUACGGCGGCGUGCUGAGCAGCUUCAGCGGAACCGUGAAAUACAGCGGCU CCAGCUACCCCUUCCCCACAACCAGCGAGACCCCUAGAGUGGUCUAUAACUCUAGAACA GACAAGCCUUGGCCCGUGGCUCUGUAUCUGACCCCCGUGUCCAGCGCUGGAGGAGUG GCCAUCAAGGCCGGCAGCCUCAUCGCCGUCCUCAUUCUGAGGCAGACCAACAACUACAA CAGCGACGACUUCCAGUUCGUGUGGAACAUCUACGCCAACAACGACGUGGUGGUCCCC ACCGGCGGAUGUGACGUGUCCGCCAGAGACGUGACCGUGACACUGCCCGAUUACCCCG GAAGCGUCCCUAUCCCUCUGACAGUGUACUGCGCCAAGAGCCAAAAUCUGGGCUACUA UCUGUCCGGAACCACAGCCGACGCCGGAAACUCCAUCUUCACCAACACCGCCAGCUUUU CCCCCGCCCAAGGAGUGGGAGUCCAGCUGACAAGAAGCGGCACCAUCAUCCCCGCCAG CAACACAGUGUCUCUGGGCGCUGUGGGCACAUCCGCUGUGUCUCUGGGACUGACAGCU AAUUAUGCCAGAACCGGAGGCCAAGUGACCGCUGGAAAUGUGCAGAGCAUUAUUGGGG UGACCUUCGUGUACCAGGGCGGAAGUAGCGGAGGCGGUGCCGACGUGACCAUCACCG UGAACGGCAAGGUGGUGGCCAAGAGUUCUGGUGGCGGUGGUUCAAGUGGUAGUGGCA GUUCAAGUGGGACAACACGACUGUUGAGCGGGCAUACGUGUUUUACGCUGACAGGUCU UCUGGGCACGCUGGUUACUAUGGGCUUGCUUACGUGAUGAGCUCGCUUUCUUGCUGU CCAAUUUCUAUUAAAGGUUCCUUUGUUCCCUAAGUCCAACUACUAAACUGGGGGAUAUU AUGAAGGGCCUUGAGCAUCUGGAUUCUGCCUAAUAAAAAACAUUUAUUUUCAUUGCAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAA
[0032] Sequence annotations are as follows: AUG, first methionine of the gene of interest (bold); UGAUGA stop codons after gene of interest (bold and italics); 5’UTR is underlined; polyA, 80nt tract (italics).
[0033] SEQ ID NO: 4 sets forth the nucleic acid sequence for 5’UTR_BMD582 AGGTGTCAGAGTTTAACTTGAAGACTATTTCTAGGGATAATATCCCT
[0034] SEQ ID NO: 5 sets forth the nucleic acid sequence for 5’UTR_BMD582-AGA AGATGTCAGAGTTTAACTTGAAGACTATTTCTAGGGATAATATCCCT
[0035] SEQ ID NO: 6 sets forth the nucleic acid sequence for 5’UTR_ BMD2 AGGAAAUAAGAGAGGAUAAGACGACUAAGGAGACAUACAGAAUAAGAGGCA
[0036] SEQ ID NO: 7 sets forth the nucleic acid sequence for 5’UTR_ BMD576
[0037] AGGAGGACUGGUCGAACCUGCAUAGUGAUCAUAAGGUCAGCAUA SEQ ID NO: 8 sets forth the nucleic acid sequence for 5’UTR_ BMD563 AGGAAAUAAGAGAGGAUAAGACGACUAAGGAGACAUACAGAAUAAGAAACAGGCA
[0038] SEQ ID NO: 9 sets forth the nucleic acid sequence for 5’UTR_ BMD562 AGGAAAUAAGAGAAAGAGGAUAAGACGACUAAGGAGACAUACAGAAUAAGAGGCA
[0039] SEQ ID NO: 10 sets forth the nucleic acid sequence for 5’UTR_ hHBB AGGACAUUUGCUUCUGACACAACUGUGUUCACUAGCAACCUCAAACAGCCACC SEQ ID NO: 11 sets forth the nucleic acid sequence for 5’UTR_ WHO AGGAAUAAACUAGUAUUCUUCUGGUCCCCACAGACUCAGAGAGAACCCGCCACC
[0040] SEQ ID NO: 12 sets forth the nucleic acid sequence for 3’UTR_ hHBB GCTCGCTTTCTTGCTGTCCAATTTCTATTAAAGGTTCCTTTGTTCCCTAAGTCCAACTACTA AACTGGGGGATATTATGAAGGGCCTTGAGCATCTGGATTCTGCCTAATAAAAAACATTTATT TTCATTGCAA
[0041] SEQ ID NO: 13 sets forth the nucleic acid sequence for 3’UTR_ BMD2 GCUCGCUUUCUUGCUGUCCAAUUUCUAUUAAAGGUUCCUUUGUUCCCUAAGUCCAACU ACUAAACUGGGGGAUAUUAUGAAGGGCCUUGAGCAUCUGGAUUCUGCCUAAUAAAAAAC AUUUAUUUUCAUUGCAA
[0042] SEQ ID NO: 14 sets forth the nucleic acid sequence for 3’UTR_ BMD576 GCUCGCUUUCUUGCUGUCCAAUUUCUAUUAAAGGUUCCUUUGUUCCCUAAGUCCAACU ACUAAACUGGGGGAUAUUAUGAAGGGCCUUGAGCAUCUGGAUUCUGCCUAAUAAAAAAC AUUUAUUUUCAUUGCAA
[0043] SEQ ID NO: 15 sets forth the nucleic acid sequence for 3’UTR_ BMD563 GCUCGCUUUCUUGCUGUCCAAUUUCUAUUAAAGGUUCCUUUGUUCCCUAAGUCCAACU ACUAAACUGGGGGAUAUUAUGAAGGGCCUUGAGCAUCUGGAUUCUGCCUAAUAAAAAAC AUUUAUUUUCAUUGCAA
[0044] SEQ ID NO: 16 sets forth the nucleic acid sequence for 3’UTR_ BMD562 GCUCGCUUUCUUGCUGUCCAAUUUCUAUUAAAGGUUCCUUUGUUCCCUAAGUCCAACU ACUAAACUGGGGGAUAUUAUGAAGGGCCUUGAGCAUCUGGAUUCUGCCUAAUAAAAAAC AUUUAUUUUCAUUGCAA
[0045] SEQ ID NO: 17 sets forth the nucleic acid sequence for 3’UTR_ WHO CUCGAGCUGGUACUGCAUGCACGCAAUGCUAGCUGCCCCUUUCCCGUCCUGGGUACCC CGAGUCUCCCCCGACCUCGGGUCCCAGGUAUGCUCCCACCUCCACCUGCCCCACUCAC CACCUCUGCUAGUUCCAGACACCUCCCAAGCACGCAGCAAUGCAGCUCAAAACGCUUAG CCUAGCCACACCCCCACGGGAAACAGCAGUGAUUAACCUUUAGCAAUAAACGAAAGUUU AACUAAGCUAUACUAACCCCAGGGUUGGUCAAUUUCGUGCCAGCCACACCCUGGAGCUA GO
[0046] DETAILED DESCRIPTION OF THE DISCLOSURE
[0047] The lipidated compounds, combinations, and methods of the present disclosure are believed to have one or more advantages, such as delivering the TLR7 / 8 modulating adjuvant to the lymph node via albumin trafficking. Without being bound to a particular mechanism or theory, the addition of a lipid moiety to the TLR7 / 8 modulating molecule may enhance binding of said molecule to interstitial albumin at the injection site. Binding to interstitial albumin may in turn, enhance trafficking of the TLR7 / 8 modulating molecule to the draining lymph node through afferent lymphatic vessels. Retention of the adjuvant in the lymph node via albumin trafficking may provide sustained exposure and accompanied stimulation of the immune system to allow for optimal immune response to the vaccine antigen.
[0048] Furthermore, the lipidated compounds of the present disclosure provide advantages versus non-lipidated compounds in facilitating the integration of said compounds into a liposomal adjuvant formulation. For example, when the compounds of the disclosure are combined with lipid components (i.e., phospholipids, cholesterols, etc.), the hydrophobic moieties within the TLR 7 / 8 modulating compounds of the present disclosure may facilitate the formation of a liposome comprising said compounds. Without being bound to a particular mechanism or theory, via integration into a liposome, the lipidated compounds of the present disclosure may have an enhanced ability to move throughout the lymphatic system which results in increased adjuvant activity.
[0049] The present disclosure may be understood more readily by reference to the following detailed description of the embodiments of the disclosure and the Examples included herein. It is to be understood that this disclosure is not limited to specific synthetic methods of making that may of course vary. It is to be also understood that the terminology used herein is for the purpose of describing specific embodiments only and is not intended to be limiting.
[0050] Exemplary embodiments (E) of the disclosure provided herein include:
[0051] E1 A compound of Formula (I) or a pharmaceutically acceptable salt thereof, as defined above.
[0052] E2 The compound of embodiment E1, wherein X1has formula a.
[0053] E3 The compound of embodiment E2, wherein a is 1, n1 is 0, and n2 is 1. E4 The compound of any one of embodiments E1-E3, wherein r1 is 4.
[0054] E5 The compound of any one of embodiments E1-E4, wherein p is 0.
[0055] E6 The compound of embodiment E2, wherein a is 1, n1 is 0, and n2 is 1.
[0056] E7 The compound of embodiment E6, wherein r1 is 2 and p is 3.
[0057] E8 The compound of embodiment E1, wherein X1has formula b.
[0058] E9 The compound of embodiment E8, wherein n1 is 0 and n2 is 1.
[0059] E10 The compound of embodiment E9, wherein r1 is 2 and p is 3.
[0060] E11 The compound of embodiment E8, wherein n1 is 1 and n2 is 1.
[0061] E12 The compound of embodiment E11, wherein r1 is 3 and p is 0.
[0062] E13 The compound of embodiment E1, wherein X2has formula c.
[0063] E14 The compound of embodiment E13, wherein n1 is 1, n2 is 0, and n3 is 0.
[0064] E15 The compound of embodiment E14, wherein r1 is 3, r3 is 0, and p is 0.
[0065] E16 The compound of embodiment E13, wherein n1 is 0, n2 is 1, and n3 is 1.
[0066] E17 The compound of embodiment E16, wherein r1 is 3, r3 is 2, and p is 3.
[0067] E18 The compound of any one of embodiments E1-E17, or a pharmaceutically acceptable salt thereof, wherein r2 is 13, 14, or 15.
[0068] E19 The compound of any one of embodiments E1-E18, or a pharmaceutically acceptable salt thereof, wherein r2 is 14. E20 A compound, which is N5-(4-(N-(3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)sulfamoyl)butyl)-N2-palmitoyl-L-glutamine, or a pharmaceutically acceptable salt thereof.
[0069] E21 A compound, which is (S)-1-(N-(3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)sulfamoyl)-13-oxo-16-palmitamido-3,6,9-trioxa-12-azaheptadecan-17-oic acid, or a pharmaceutically acceptable salt thereof.
[0070] E22 A compound, which is (S)-1-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)-18-oxo-21-palmitamido-8,11,14-trioxa-4,17-diazadocosan-22-oic acid, or a pharmaceutically acceptable salt thereof.
[0071] E23 A compound, which is (S)-5-(4-(2-((4-((3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)amino)butyl)amino)-2-oxoethyl)-4-hydroxypiperidin-1-yl)-5-oxo-2-palmitamidopentanoic acid, or a pharmaceutically acceptable salt thereof.
[0072] E24 A compound, which is 1-(4-(2-(4-(3-(4-Amino-2-butyl-1-(3-hydroxy-2-(hydroxymethyl)-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-7-yl)propyl)piperazin-1-yl)-2-oxoethyl)-4-hydroxypiperidin-1-yl)hexadecan-1-one, or a pharmaceutically acceptable salt thereof.
[0073] E25 A compound, which is (S)-1-(4-(3-(4-Amino-2-(ethoxymethyl)-1-(3-hydroxy-2-(hydroxymethyl)-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-7-yl)propyl)piperazin-1-yl)-1,14-dioxo-17-palmitamido-4,7,10-trioxa-13-azaoctadecan-18-oic acid, or a pharmaceutically acceptable salt thereof.
[0074] E26 A pharmaceutical composition comprising the compound according to any one of embodiments E1-E25, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient.
[0075] E27 A crystalline form of the compound according to any one of embodiments E1-E25 or a pharmaceutically acceptable salt thereof.
[0076] E28 A method of inducing an immune response to an antigen of interest in a subject, comprising administering to the subject the pharmaceutical composition of embodiment E26, wherein the composition further comprises the antigen of interest. E29 A method for immunizing a subject against a disease or disorder caused by or associated with an antigen of interest, comprising administering to the subject the pharmaceutical composition of embodiment E26, wherein the composition further comprises the antigen of interest.
[0077] E30 A method for preventing a disease or disorder caused by or associated with an antigen of interest in a subject, comprising administering to the subject the pharmaceutical composition of embodiment E26, wherein the composition further comprises the antigen of interest.
[0078] E31 A method for treating a disease or disorder caused by or associated with an antigen of interest in a subject, comprising administering to the subject the pharmaceutical composition of embodiment E26, wherein the composition further comprises the antigen of interest.
[0079] E32 A method for increasing an immune response to an antigen of interest in a subject, comprising administering to the subject the pharmaceutical composition of embodiment E26, wherein the composition further comprises the antigen of interest.
[0080] E33 The method of any one of embodiments E28 to E32, wherein the antigen of interest is an infectious disease antigen.
[0081] E34 The method of any one of embodiments E28 to E33, wherein the antigen of interest is a viral antigen, a bacterial antigen, a fungal antigen, or a parasitic antigen.
[0082] E35 The method of any one of embodiments E28 to E32, wherein the antigen of interest is a cancer antigen.
[0083] E36 The method of any one of embodiments E28-E35, wherein the method induces an immune response in the subject to the antigen of interest and the immune response is at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 100%, higher than the immune response of the subject induced by a composition comprising the antigen of interest without the compound according to any one of embodiments E1 to E25.
[0084] E37 The method of embodiment E36, wherein the immune response is measured by opsonophagocytic activity (OPA) geometric mean antibody titers. E38 The method of embodiment E36, wherein the immune response is measured by neutralization geometric mean antibody titers.
[0085] E39 The method of any one of embodiments E28 to E38, wherein the subject is human.
[0086] E40 A compound according to any one of embodiments E1 to E25 for use as a medicament.
[0087] E41 A compound according to any one of embodiments E1 to E25 for use in inducing an immune response to an antigen of interest in a subject.
[0088] E42 A compound according to any one of embodiments E1 to E25 for use in immunizing a subject against a disease or disorder caused by or associated with an antigen of interest in a subject.
[0089] E43 A compound according to any one of embodiments E1 to E25 for use in preventing a disease or disorder caused by or associated with an antigen of interest in a subject.
[0090] E44 A compound according to any one of embodiments E1 to E25 for use in treating a disease or disorder caused by or associated with an antigen of interest in a subject.
[0091] E45 A compound according to any one of embodiments E1 to E25 for use in increasing an immune response to an antigen of interest in a subject.
[0092] E46 The compound according to any one of embodiments E40-E45, wherein the subject is a human.
[0093] E47 Use of a compound according to any one of embodiments E1 to E25 for the manufacture of a medicament for inducing an immune response to an antigen of interest in a subject.
[0094] E48 Use of a compound according to any one of embodiments E1 to E25 for the manufacture of a medicament for immunizing a subject against a disease or disorder caused by or associated with an antigen of interest. E49 Use of a compound according to any one of embodiments E1 to E25 for the manufacture of a medicament for use in preventing a disease or disorder caused by or associated with an antigen of interest in the subject.
[0095] E50 Use of a compound according to any one of embodiments E1 to E25 for the manufacture of a medicament for treating a disease or disorder caused by or associated with an antigen of interest in the subject.
[0096] E51 Use of a compound according to any one of embodiments E1 to E25 for the manufacture of a medicament for increasing an immune response to an antigen of interest in a subject.
[0097] E52 The use according to any one of embodiments E47 to E51, wherein the subject is a human.
[0098] E53 A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound of Formula (I):
[0099]
[0100] or a pharmaceutically acceptable salt thereof, wherein:
[0101] Y is -O- or -CH2-; and
[0102] one of X1and X2is H, and the other of X1and X2has a formula selected from the group consisting of formula(a), formula(b), and formula(c):
[0103]
[0104]
[0105] wherein:
[0106] a is 0 or 1;
[0107] r1 is an integer from 2 to 6;
[0108] r2 is an integer from 10 to 20;
[0109] r3 is an integer from 0 to 6;
[0110] n1 is 0 or 1 and n2 is 0 or 1, wherein at least one of n1 and n2 is 1;
[0111] n3 is 0 or 1; and
[0112] p is an integer from 0 to 6.
[0113] E54 The LNP formulation of E53, wherein X1has formula a.
[0114] E55 The LNP formulation of E54, wherein a is 1, n1 is 0, and n2 is 1.
[0115] E56 The LNP formulation of any one of E53-E55, wherein r1 is 4.
[0116] E57 The LNP formulation of any one of E53-E56, wherein p is 0.
[0117] E58 The LNP formulation of E54, wherein a is 1, n1 is 0, and n2 is 1.
[0118] E59 The LNP formulation of E58, wherein r1 is 2 and p is 3.
[0119] E60 The LNP formulation of E53, wherein X1has formula b.
[0120] E61 The LNP formulation of E60, wherein n1 is 0 and n2 is 1.
[0121] E62 The LNP formulation of E61, wherein r1 is 2 and p is 3. E63 The LNP formulation of E60, wherein n1 is 1 and n2 is 1.
[0122] E64 The LNP formulation of E63, wherein r1 is 3 and p is 0.
[0123] E65 The LNP formulation of E53, wherein X2has formula c.
[0124] E66 The LNP formulation of E65, wherein n1 is 1, n2 is 0, and n3 is 0.
[0125] E67 The LNP formulation of E66, wherein r1 is 3, r3 is 0, and p is 0.
[0126] E68 The LNP formulation of E65, wherein n1 is 0, n2 is 1, and n3 is 1.
[0127] E69 The LNP formulation of E68, wherein r1 is 3, r3 is 2, and p is 3.
[0128] E70 The LNP formulation of any one of E53-E69, wherein r2 is 13, 14, or 15.
[0129] E71 The LNP formulation of any one of E53-E70, wherein r2 is 14.
[0130] E72 A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is N5-(4-(N-(3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)sulfamoyl)butyl)-N2-palmitoyl-L-glutamine, or a pharmaceutically acceptable salt thereof.
[0131] E73 A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is (S)-1-(N-(3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)sulfamoyl)-13-oxo-16-palmitamido-3,6,9-trioxa-12-azaheptadecan-17-oic acid, or a pharmaceutically acceptable salt thereof.
[0132] E74 A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is (S)-1-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)-18-oxo-21-palmitamido-8,11,14-trioxa-4,17-diazadocosan-22-oic acid, or a pharmaceutically acceptable salt thereof.
[0133] E75 A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is (S)-5-(4-(2-((4-((3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)amino)butyl)amino)-2-oxoethyl)-4-hydroxypiperidin-1-yl)-5-oxo-2-palmitamidopentanoic acid, or a pharmaceutically acceptable salt thereof. E76 A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is 1-(4-(2-(4-(3-(4-Amino-2-butyl-1-(3-hydroxy-2-(hydroxymethyl)-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-7-yl)propyl)piperazin-1-yl)-2-oxoethyl)-4-hydroxypiperidin-1-yl)hexadecan-1-one, or a pharmaceutically acceptable salt thereof.
[0134] E77 A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is (S)-1-(4-(3-(4-Amino-2-(ethoxymethyl)-1-(3-hydroxy-2-(hydroxymethyl)-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-7-yl)propyl)piperazin-1-yl)-1,14-dioxo-17-palmitamido-4,7,10-trioxa-13-azaoctadecan-18-oic acid, or a pharmaceutically acceptable salt thereof.
[0135] E78 The LNP formulation of any one of E53-E77, wherein the LNPs further comprise:
[0136] a) an ionizable cationic lipid;
[0137] b) cholesterol, a cholesterol analog, or cholesterol and a cholesterol analog; c) a neutral lipid; and
[0138] d) a polymer-conjugated lipid.
[0139] E79 The LNP formulation of E78, wherein the LNPs further comprise RNA.
[0140] E80 The LNP formulation of E79, wherein the RNA is modified RNA (modRNA) or selfamplifying RNA (saRNA).
[0141] E81 The LNP formulation of E79 or E80, wherein the RNA comprises a 5’ cap, a 5’ UTR, a 3’ UTR, and a poly-A tail.
[0142] E82 The LNP formulation of E81, wherein the 5’ cap is a 5’ cap analog.
[0143] E83 The LNP formulation of any one of E79-E82, wherein the RNA comprises a modified nucleotide selected from the group consisting of pseudouridine, 1 -methylpseudouridine, 2-thiouridine, 4 '-thiouridine, 5-methylcytosine, 2-thio-1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine, 2-thio-dihydropseudouridine, 2-thio-dihydrouridine, 2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine, 4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine, 4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine, 5-methoxyuridine, 2'-O-methyl uridine, and N1-Methylpseudourodine-5’-triphosphate (ml^PTP).
[0144] E84 The LNP formulation of any one of E79-E83, wherein the RNA comprises N1-Methylpseudourodine-5’-triphosphate (ml^PTP). E85 The LNP formulation of any one of E79-E84, wherein the RNA comprises a codon-optimized open reading frame.
[0145] E86 The LNP formulation of any one of E79-E85, wherein the molar ratio of the nitrogen atoms in the ionizable cationic lipid to the phosphate groups in the RNA (N: P ratio) is between about 2:1 and about 20: 1.
[0146] E87 The LNP formulation of E86, wherein the N: P ratio is about 6:1.
[0147] E88 The LNP formulation of any one of E78-E87, wherein the LNPs further comprise a saponin.
[0148] E89 The LNP formulation of E88, wherein the saponin is QS-7, QS-18, QS-21, or a mixture thereof.
[0149] E90 The LNP formulation of E89, wherein the saponin is QS-21.
[0150] E91 The LNP formulation of any one of E78-E90, wherein the ionizable cationic lipid is N, N-dimethyl-2,3-dioleyloxy)propylamine (DODMA), N, N-dioleyl-N, N-dimethylammonium chloride (DODAC), N, N-distearyl-N, N-dimethylammonium bromide (DDAB), N-(1-(2,3-dioleoyloxy)propyl)-N, N, N-trimethylammonium chloride (DOTAP), N-(1-(2,3-dioleyloxy)propyl)-N, N, N-trimethylammonium chloride (DOTMA), 1,2-dilinoleyloxy-N, N-dimethylaminopropane (DLinDMA), 1,2-dilinolenyloxy-N, N-dimethylaminopropane (DLenDMA), 2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane (DLin-KC2-DMA), 2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA), (4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate) (ALC-0315), 2-hexyldecyl 6-[(2-{[4-(heptylcarbonylamino)butyl]-N-methylamino}ethyl)[5-(2-hexyldecyloxycarbonyl)pentyl]amino]hexanoate (ALC-0515), 2-(7-(4-hydroxybutyl)-2,7-diazaspiro[3.5]nonan-2-yl)propane-1,3-diyl bis(2-heptylnonanoate) (PF-9032), heptadecane-9-yl 8-((2-hydroxyethyl) (6-oxo-6-(undecyloxy)hexyl) amino) octanoate (SM-102), or a mixture thereof.
[0151] E92 The LNP formulation of any one of E78-E91, wherein the ionizable cationic lipid is ALC-0315 (4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate) (ALC-0315) having the structure:
[0152]
[0153] E93 The LNP formulation of any one of E78-E91, wherein the ionizable cationic lipid is 2- hexyldecyl 6-[(2-{[4-(heptylcarbonylamino)butyl]-N-methylamino}ethyl)[5-(2- hexyldecyloxycarbonyl)pentyl]amino]hexanoate (ALC-0515) having the structure:
[0154]
[0155] E94 The LNP formulation of any one of E78-E91, wherein the ionizable cationic lipid is 2-(7- (4-hydroxybutyl)-2,7-diazaspiro[3.5]nonan-2-yl)propane-1,3-diyl bis(2-heptylnonanoate) (PF-9032) having the structure:
[0156]
[0157] E95 The LNP formulation of any one of E78-E94, wherein the LNPs comprise a cholesterol analog selected from the group consisting of sitosterol, stigmasterol, campesterol, sitostanol, campestanol, brassicasterol, fucosterol, β-sitosterol, stigmastanol, β-sitostanol, ergosterol, fecosterol, lupeol, cycloartenol, A5-avenasterol, A7-avenasterol, A7-stigmasterol, tomatidine, ursolic acid, and alpha-tocopherol, including analogs, salts or esters thereof.
[0158] E96 The LNP formulation of any one of E78-E95, wherein the LNPs comprise cholesterol and a cholesterol analog, and wherein the cholesterol analog is β-sitosterol. E97 The LNP formulation of E96, wherein the molar ratio of β-sitosterol:cholesterol is between about 8:2 and about 1:9.
[0159] E98 The LNP formulation of E96 or E97, wherein the molar ratio of p-sitosterol:cholesterol is about 6:4 or about 4:6.
[0160] E99 The LNP formulation of any one of E78-E98, wherein the neutral lipid is a phospholipid.
[0161] E100 The LNP formulation of any one of E78-E99, wherein the neutral lipid is distearoylphosphatidylcholine, 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC), dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG), dioleoylphosphatidylethanolamine (DOPE), palmitoyloleoylphosphatidylcholine (POPC), palmitoyl-oleoyl-phosphatidylethanolamine (POPE), dioleoyl- phosphatidylethanolamine 4-(N-maleimidomethyl)-cyclohexane-1 -carboxylate (DOPE-mal), dipalmitoylphosphatidylethanolamine (DPPE), dimyristoylphosphoethanolamine (DMPE), distearoylphosphatidylethanolamine (DSPE), 16-O-monomethyl PE, 16-O-dimethyl PE, 18-1-trans PE, 1-stearoyl-2-oleoylphosphatidyethanolamine (SOPE), 1,2-dielaidoyl-sn-glycero-3-phosphoethanolamine (transDOPE), hydrogenated soy phosphatidylcholine (HSPC), egg phosphatidylcholine (EPC), dioleoylphosphatidyl serine (DOPS), sphingomyelin (SM), dimyristoyl phosphatidylcholine (DMPC), dimyristoyl phosphatidylglycerol (DMPG), distearoylphosphatidylglycerol (DSPG), diemcoylphosphatidylcholine (DEPC), palmitoyloleyolphosphatidylglycerol (POPG), dielaidoyl-phosphatidylethanolamine (DEPE), 1, 2-dilauroyl-sn-glycero-3 -pho sphoethanolamine (DLPE); l,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (DPHyPE); lecithin, phosphatidylethanolamine, lysolecithin, lysophosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, sphingomyelin, egg sphingomyelin (ESM), cephalin, cardiolipin, phosphatidicacid, cerebrosides, dicetylphosphate, lysophosphatidylcholine, dilinoleoylphosphatidylcholine, or a mixture thereof.
[0162] E101 The LNP formulation of any one of E78-E100, wherein the neutral lipid is 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC).
[0163] E102 The LNP formulation of any one of E78-E101, wherein the polymer-conjugated lipid is a pegylated lipid.
[0164] E103 The LNP formulation of E102, wherein the pegylated lipid is selected from the group consisting of 2-[(polyethylene glycol)-2000]-N, N-ditetradecylacetamide (ALC-0159), PEG dialkyoxypropylcarba PEGylated diacylglycerol (PEG-DAG), 1-(monomethoxy-polyethyleneglycol)-2,3-dimyristoylglycerol (PEG-DMG), PEGylated phosphatidylethanolamine (PEG-PE), PEG succinate diacylglycerol (PEG-S-DAG), 4-O-(2',3'-di(tetradecanoyloxy)propyl-1-O-((O-methoxy(polyethoxy)ethyl)butanedioate (PEG-S-DMG), PEG-ceramide, and a-(3’-[(1,2-di[myristyloxy]propanoxy) carbonylamino]propyl)-w-methoxy, polyoxyethylene (PEG-C-DMG).
[0165] E104 The LNP formulation of E102 or E103, wherein the pegylated lipid is ALC-0159 (2-[(polyethylene glycol)-2000]-N, N-ditetradecylacetamide) having the structure:
[0166]
[0167] E105 The LNP formulation of any one of E78-E101, wherein the polymer-conjugated lipid is a terminally activated polyoxazoline (POZ)-conjugated lipid.
[0168] E106 The LNP formulation of E105, wherein the POZ-conjugated lipid is polyethyloxazoline-dimyristoylamide (PEOZ-dma) having the structure:
[0169]
[0170] wherein n is an integer from 18-22.
[0171] E107 The LNP formulation of any one of E78-E106, wherein the LNPs comprise lipids from any one of the groups from a) to I):
[0172] a) ALC-0315, beta-sitosterol, cholesterol, DSPC, and ALC-0159;
[0173] b) ALC-0315, beta-sitosterol, cholesterol, ESM, and ALC-0159;
[0174] c) ALC-0315, beta-sitosterol, cholesterol, DSPC, and PEOZ;
[0175] d) ALC-0315, beta-sitosterol, cholesterol, ESM, and PEOZ;
[0176] e) ALC-0515, beta-sitosterol, cholesterol, DSPC, and ALC-0159;
[0177] f) ALC-0515, beta-sitosterol, cholesterol, ESM, and ALC-0159;
[0178] g) ALC-0515, beta-sitosterol, cholesterol, DSPC, and PEOZ;
[0179] h) ALC-0515, beta-sitosterol, cholesterol, ESM, and PEOZ; i) PF-9032, beta-sitosterol, cholesterol, DSPC, and ALC-0159;
[0180] j) PF-9032, beta-sitosterol, cholesterol, ESM, and ALC-0159;
[0181] k) PF-9032, beta-sitosterol, cholesterol, DSPC, and PEOZ; and
[0182] l) PF-9032, beta-sitosterol, cholesterol, ESM, and PEOZ.
[0183] E108 The LNP formulation of any one of E78-E106, wherein the LNPs comprise lipids from any one of the groups from a) to I):
[0184] a) ALC-0315, cholesterol, DSPC, and ALC-0159;
[0185] b) ALC-0315, cholesterol, ESM, and ALC-0159;
[0186] c) ALC-0315, cholesterol, DSPC, and PEOZ;
[0187] d) ALC-0315, cholesterol, ESM, and PEOZ;
[0188] e) ALC-0515, cholesterol, DSPC, and ALC-0159;
[0189] f) ALC-0515, cholesterol, ESM, and ALC-0159;
[0190] g) ALC-0515, cholesterol, DSPC, and PEOZ;
[0191] h) ALC-0515, cholesterol, ESM, and PEOZ;
[0192] i) PF-9032, cholesterol, DSPC, and ALC-0159;
[0193] j) PF-9032, cholesterol, ESM, and ALC-0159;
[0194] k) PF-9032, cholesterol, DSPC, and PEOZ; and
[0195] l) PF-9032, cholesterol, ESM, and PEOZ.
[0196] E109 The LNP formulation of any one of E78-E92, E95-E104, or E107, wherein the LNPs comprise the following lipids: ALC-0315, beta-sitosterol, cholesterol, DSPC, and ALC-0159.
[0197] E110 The LNP formulation of any one of E53-E109, wherein the LNPs have a mean diameter size between about 1 nm and about 500 nm.
[0198] E111 The LNP formulation of any one of E53-E110, wherein the LNPs have a mean diameter size that is less than about 150 nm.
[0199] E112 The LNP formulation of any one of E53-E111, wherein the LNPs have a mean diameter size between about 60 nm and about 140 nm.
[0200] E113 The LNP formulation of any one of E53-E112, wherein the LNPs have a mean diameter size selected from the group consisting of about 60 nm, about 65 nm, about 70 nm, about 75 nm, about 80 nm, about 85 nm, about 90 nm, about 95 nm, about 100 nm, about 105 nm, about 110 nm, about 115 nm, about 120 nm, about 125 nm, about 130 nm, about 135 nm, and about 140 nm.
[0201] E114 The LNP formulation of any one of E53-E113, wherein the LNPs have a polydispersity index (PDI) that is less than about 0.15, about 0.2, about 0.25, or about 0.3.
[0202] E115 The LNP formulation of any one of E53-E114, wherein the LNPs have a PDI between about 0.05 and about 0.2.
[0203] E116 The LNP formulation of any one of E78-E115, wherein the ionizable cationic lipid comprises between about 30 mol % and about 60 mol % of the total lipid.
[0204] E117 The LNP formulation of any one of E78-E116, wherein the ionizable cationic lipid comprises between about 40 mol % and about 50 mol % of the total lipid.
[0205] E118 The LNP formulation of any one of E78-E117, wherein the ionizable cationic lipid comprises about 47.5 mol% of the total lipid.
[0206] E119 The LNP formulation of any one of E78-E118, wherein the cholesterol, the cholesterol analog, or the cholesterol and the cholesterol analog comprise between about 30 mol % and about 50 mol % of the total lipid.
[0207] E120 The LNP formulation of any one of E78-E119, wherein the cholesterol, the cholesterol analog, or the cholesterol and the cholesterol analog comprise between about 40 mol % and about 41 mol % of the total lipid.
[0208] E121 The LNP formulation of any one of E78-E120, wherein the cholesterol, the cholesterol analog, or the cholesterol and the cholesterol analog comprise about 40.7 mol % of the total lipid.
[0209] E122 The LNP formulation of any one of E78-E121, wherein the neutral lipid comprises between about 1 mol % and about 30 mol % of the total lipid.
[0210] E123 The LNP formulation of any one of E78-E122, wherein the neutral lipid comprises between about 5 mol % and about 15 mol % of the total lipid.
[0211] E124 The LNP formulation of any one of E78-E123, wherein the neutral lipid comprises about 10 mol % of the total lipid. E125 The LNP formulation of any one of E78-E124, wherein the polymer-conjugated lipid comprises between about 0.5 mol % and about 10 mol % of the total lipid.
[0212] E126 The LNP formulation of any one of E78-E125, wherein the polymer-conjugated lipid comprises between about 1 mol % and about 2 mol % of the total lipid.
[0213] E127 The LNP formulation of any one of E78-E126, wherein the polymer-conjugated lipid comprises about 1.8 mol % of the total lipid.
[0214] E128 An immunogenic composition comprising the LNP formulation of any one of E53-E127, wherein the LNPs comprise RNA, and wherein the RNA comprises at least one open reading frame (ORF) encoding an immunogen of interest.
[0215] E129 The immunogenic composition of E128, wherein the immunogen is derived from E. coli.
[0216] E130 The immunogenic composition of E129, wherein the immunogen is a fimbrial adhesin (FimH) polypeptide, or a functional fragment thereof.
[0217] E131 The immunogenic composition of E130, wherein the FimH polypeptide, or functional fragment thereof, comprises each of the mutations of G15A, G16A, and V27A, and wherein the amino acid positions are numbered according to SEQ ID NO: 1.
[0218] E132 The immunogenic composition of any one of E128-E131, wherein the RNA comprises or consists of the sequence of SEQ ID NO: 3.
[0219] E133 The immunogenic composition of any one of E128-E132, wherein the composition further comprises a fatty acid, a fatty acid derivative, or a salt thereof.
[0220] E134 The immunogenic composition of E133, wherein the fatty acid is selected from the group consisting of oleic acid, arachidonic acid, eruric acid, linolenic acid, ricinoleic acid, palmitoleic acid, and linoleic acid.
[0221] E135 The immunogenic composition of E133 or E134, wherein the salt is selected from the group consisting of sodium, potassium, magnesium, and calcium.
[0222] E136 The immunogenic composition of any one of E128-E135, wherein the composition comprises oleic acid or sodium oleate. E137 The immunogenic composition of E136, wherein the immunogenic composition has a oleic acid to RNA mass ratio (g / g) selected from the group consisting of about 1:1, about 2:1, about 3:1, about 4:1, about 5:1, about 6:1, about 7:1, about 8:1, about 9:1, about 10:1, about 11:1, about 12:1, and about 13:1.
[0223] E138 The immunogenic composition of E137, wherein the immunogenic composition has a oleic acid to RNA mass ratio (g / g) of about 8:1.
[0224] E139 The immunogenic composition of any one of E128-E138, wherein the composition comprises a buffer and a cryoprotectant.
[0225] E140 The immunogenic composition of E139, wherein the buffer is Tris and the cryoprotectant is sucrose.
[0226] E141 The immunogenic composition of E139 or E140, wherein the composition comprises 10 mM Tris and 300 mM sucrose.
[0227] E142 The immunogenic composition of any one of E128-E141, wherein the percentage of intact RNA in the composition is at least about 80%, about 85%, or about 90%.
[0228] E143 The immunogenic composition of any one of E128-E142, wherein at least about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the total RNA in the composition is encapsulated in the plurality of LNPs.
[0229] E144 The immunogenic composition of any one of E128-E143, wherein at least about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the compound is encapsulated in the plurality of LNPs.
[0230] E145 The immunogenic composition of any one of E128-E144, wherein the concentration of the compound is between about 1 pg / mL and about 1000 pg / mL.
[0231] E146 The immunogenic composition of any one of E128-E145, wherein the concentration of the compound is between about 10 pg / mL and about 100 pg / mL.
[0232] E147 The immunogenic composition of any one of E128-E146, wherein the concentration of the compound is about 17 pg / mL or about 86 pg / mL. E148 The immunogenic composition of any one of E128-E147, wherein the LNPs comprise QS-21, and wherein the concentration of QS-21 in the composition is between about 0.001 mg / mL and about 0.2 mg / mL.
[0233] E149 The immunogenic composition of any one of E128-E148, wherein the LNPs comprise QS-21, and wherein the concentration of QS-21 in the composition is about 0.009 mg / mL, about 0.023 mg / mL, about 0.045 mg / mL, or about 0.1 mg / mL.
[0234] E150 The immunogenic composition of any one of E128-E149, wherein the concentration of the RNA in the composition is less than about 1 mg / mL.
[0235] E151 The immunogenic composition of any one of E128-E150, wherein the concentration of the RNA in the composition is about 0.1 mg / mL.
[0236] E152 The immunogenic composition of any one of E128-E151, wherein the in-vitro expression (IVE) of the immunogen in a cell line treated with the immunogenic composition is at least about 40%, about 50%, about 60%, about 70%, about 80%, or about 90%.
[0237] E153 A method of inducing an immune response in a subject against the immunogen of interest, comprising administering to the subject the immunogenic composition of any one of E128-E152.
[0238] E154 A method for immunizing a subject against a disease or disorder caused by or associated with the immunogen of interest, comprising administering to the subject the immunogenic composition of any one of E128-E152.
[0239] E155 A method for preventing a disease or disorder caused by or associated with the immunogen of interest in a subject, comprising administering to the subject the immunogenic composition of any one of E128-E152.
[0240] E156 A method for treating a disease or disorder caused by or associated with the immunogen of interest in a subject, comprising administering to the subject the immunogenic composition of any one of E128-E152.
[0241] E157 A method for increasing an immune response to the immunogen of interest in a subject, comprising administering to the subject the immunogenic composition of any one of E128-E152.
[0242] E158 The method of any one of E153-E157, wherein the method induces an immune response in the subject to the immunogen of interest and the immune response is at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 100% higher than the immune response of the subject induced by a composition comprising the immunogen of interest without the LNP formulation of any one of E53-E127.
[0243] E159 The method of any one of E153-E157, wherein the method induces an immune response in the subject to the immunogen of interest and the immune response is at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, or at least about 500% higher than the immune response of the subject induced by a composition comprising the immunogen of interest without the LNP formulation of any one of E53-E127.
[0244] E160 The method of any one of E153-E157, wherein the method induces an immune response in the subject to the immunogen of interest and the immune response is at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 100% higher than the immune response of the subject induced by a composition comprising the immunogen of interest and an LNP formulation wherein the LNPs in the LNP formulation do not comprise the compound of any one of E1-E25.
[0245] E161 The method of any one of E153-E157, wherein the method induces an immune response in the subject to the immunogen of interest and the immune response is at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, or at least about 500% higher than the immune response of the subject induced by a composition comprising the immunogen of interest and an LNP formulation wherein the LNPs in the LNP formulation do not comprise the compound of any one of E1-E25.
[0246] E162 The method of any one of E153 or E157-E161, wherein the immune response is measured by opsonophagocytic activity (OPA) geometric mean antibody titers.
[0247] E163 The method of any one of E153 or E157-E161, wherein the immune response is measured by neutralization geometric mean antibody titers.
[0248] E164 The method of any one of E153-E163, wherein the subject is human.
[0249] E165 The immunogenic composition of any one of E128-E152, for use as a medicament.
[0250] E166 The immunogenic composition of any one of E128-E152, for use in inducing an immune response to the immunogen of interest in a subject. E167 The immunogenic composition of any one of E128-E152, for use in immunizing a subject against a disease or disorder caused by or associated with the immunogen of interest.
[0251] E168 The immunogenic composition of any one of E128-E152, for use in preventing a disease or disorder caused by or associated with the immunogen of interest in a subject.
[0252] E169 The immunogenic composition of any one of E128-E152, for use in treating a disease or disorder caused by or associated with the immunogen of interest in a subject.
[0253] E170 The immunogenic composition of any one of E128-E152, for use in increasing an immune response to the immunogen of interest in a subject.
[0254] E171 Use of the immunogenic composition of any one of E128-E152, for the manufacture of a medicament for inducing an immune response to the immunogen of interest in a subject.
[0255] E172 Use of the immunogenic composition of any one of E128-E152, for the manufacture of a medicament for immunizing a subject against a disease or disorder caused by or associated with the immunogen of interest.
[0256] E173 Use of the immunogenic composition of any one of E128-E152, for the manufacture of a medicament for use in preventing a disease or disorder caused by or associated with the immunogen of interest in a subject.
[0257] E174 Use of the immunogenic composition of any one of E128-E152, for the manufacture of a medicament for treating a disease or disorder caused by or associated with the immunogen of interest in a subject.
[0258] E175 Use of the immunogenic composition of any one of E128-E152, for the manufacture of a medicament for increasing an immune response to the immunogen of interest in a subject.
[0259] E176 The method or use of any one of E153-E175, wherein the expression of TNF-α, IL-6, IL-8, and / or IFN-β in the subject is increased.
[0260] E177 A method of making the LNP formulation of any one of E79-E127 or the immunogenic composition of any one of E128-E152, comprising the steps of:
[0261] (i) dissolving the compound, ionizable cationic lipid, cholesterol and / or cholesterol analog, neutral lipid, and polymer-conjugated lipid in an organic solvent to form an organic phase;
[0262] (ii) dissolving the RNA in water or buffer to form an aqueous phase; and (iii) mixing the organic phase and the aqueous phase to form the LNP formulation.
[0263] E178 The method of E177, wherein in step (i) the organic solvent is ethanol or isopropyl alcohol.
[0264] E179 The method of E177 or E178, wherein in step (ii) the aqueous phase comprises citrate buffer at pH 4.
[0265] E180 The method of any one of E177-E179, wherein in step (iii) the organic phase and the aqueous phase are mixed in a microfluidic mixer.
[0266] E181 The method of E180, wherein the microfluidic mixer is a T-mixer.
[0267] E182 The method of any one of E176-E181, wherein in step (iii) the ratio of the aqueous phase to the organic phase by volume is 3:1.
[0268] E183 The method of any one of E177-E182, further comprising step (iv) dialyzing the LNP formulation against a buffer.
[0269] E184 The method of E183, wherein the buffer of step (iv) is 10 mM Tris (pH 7.4).
[0270] E185 The method of any one of E177-E184, further comprising step (v) adding a cryoprotectant to the LNP formulation.
[0271] E186 The method of E185, wherein the cryoprotectant is sucrose.
[0272] E187 The method of E185 or E186, wherein step (v) further comprises adding sodium oleate to the LNP formulation.
[0273] Furthermore, each of the embodiments described herein envisions within its scope pharmaceutically acceptable salts, tautomers, or stereoisomers thereof of the compounds described herein.
[0274] Definitions
[0275] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure have the meanings that are commonly understood by those of ordinary skill in the art.
[0276] The disclosure described herein suitably may be practiced in the absence of any element(s) not specifically disclosed herein. “Compounds of the disclosure” include compounds of Formula (I) and the novel intermediates used in the preparation thereof. One of ordinary skill in the art will appreciate that compounds of the disclosure include conformational isomers (e.g., cis and trans isomers) and all optical isomers (e.g., enantiomers and diastereomers), racemic, diastereomeric and other mixtures of such isomers, tautomers thereof, where they may exist. One of ordinary skill in the art will also appreciate that compounds of the disclosure include solvates, hydrates, isomorphs, polymorphs, esters, salt forms, prodrugs, derivatives and isotopically labeled versions thereof, where they may be formed.
[0277] As used herein, the singular form "a", "an", and "the" include plural references unless indicated otherwise. For example, "a" substituent includes one or more substituents.
[0278] As used herein, the term “about” when used to modify a numerically defined parameter (e.g., the dose of 5 mg) means that the parameter may vary by as much as 10% below or above the stated numerical value for that parameter. For example, a dose of about 5 mg means 5 mg ± 10%, i.e., it may vary between 4.5 mg and 5.5 mg.
[0279] If substituents are described as being “independently selected” from a group, each substituent is selected independent of the other. Each substituent therefore may be identical to or different from the other substituent(s).
[0280] “Optional" or "optionally" means that the subsequently described event or circumstance may, but need not occur, and the description includes instances where the event or circumstance occurs and instances in which it does not.
[0281] The terms “optionally substituted” and “substituted or unsubstituted” are used interchangeably to indicate that the particular group being described may have no
[0282] non-hydrogen substituents (i.e., unsubstituted), or the group may have one or more
[0283] non-hydrogen substituents (i.e., substituted). If not otherwise specified, the total number of substituents that may be present is equal to the number of H atoms present on the unsubstituted form of the group being described. Where an optional substituent is attached via a double bond, such as an oxo (=0) substituent, the group occupies two available valences, so the total number of other substituents that are included is reduced by two. In the case where optional substituents are selected independently from a list of alternatives, the selected groups may be the same or different. Throughout the disclosure, it will be understood that the number and nature of optional substituent groups will be limited to the extent that such substitutions make chemical sense to one of ordinary skill in the art.
[0284] “Halogen” or “halo” refers to fluoro, chloro, bromo and iodo (F, Cl, Br, I).
[0285] “Cyano” refers to a substituent having a carbon atom joined to a nitrogen atom by a triple bond, i.e., -C=N.
[0286] "Hydroxy" refers to an -OH group. “Oxo” refers to a double bonded oxygen (=0).
[0287] "Alkyl" refers to a saturated, monovalent aliphatic hydrocarbon radical that has a specified number of carbon atoms, including straight chain or branched chain groups. Alkyl groups may contain, but are not limited to, 1 to 12 carbon atoms (“C1-C12 alkyl”), 1 to 8 carbon atoms (“Ci-Cs alkyl”), 1 to 6 carbon atoms (“Ci-Ce alkyl”), 1 to 5 carbon atoms (“C1-C5 alkyl”), 1 to 4 carbon atoms (“C1-C4 alkyl”), 1 to 3 carbon atoms (“C1-C3 alkyl”), or 1 to 2 carbon atoms (“C1-C2 alkyl”). Examples include, but are not limited to, methyl, ethyl, n-propyl, isopropyl, n-butyl, sec-butyl, isobutyl, tert-butyl, n-pentyl, isopentyl, neopentyl, n-hexyl, n-heptyl, n-octyl, and the like. Alkyl groups may be optionally substituted, unsubstituted or substituted, as further defined herein. In some instances, substituted alkyl groups are specifically named by reference to the substituent group. For example, “haloalkyl” refers to an alkyl group having the specified number of carbon atoms that is substituted by one or more halo substituents, up to the available valence number.
[0288] “Alkoxy” refers to an alkyl group, as defined herein, that is single bonded to an oxygen atom. The attachment point of an alkoxy radical to a molecule is through the oxygen atom. An alkoxy radical may be depicted as alkyl-O-. Alkoxy groups may contain, but are not limited to, 1 to 8 carbon atoms (“Ci-Cs alkoxy”), 1 to 6 carbon atoms (“Ci-Ce alkoxy”), 1 to 4 carbon atoms (“C1-C4 alkoxy”), or 1 to 3 carbon atoms (“C1-C3 alkoxy”). Alkoxy groups include, but are not limited to, methoxy, ethoxy, n-propoxy, isobutoxy, and the like.
[0289] “Alkenyl” refers to an alkyl group, as defined herein, consisting of at least two carbon atoms and at least one carbon-carbon double bond. For example, as used herein, the term "C₂-C₆ alkenyl" means straight or branched chain unsaturated radicals of 2 to 6 carbon atoms, including, but not limited to, ethenyl, 1 -propenyl, 2-propenyl, 1-, 2-, or 3-butenyl, and the like.
[0290] “Amino” refers to a group -NH₂, which is unsubstituted. Where the amino is described as substituted or optionally substituted, the term includes groups of the form -NRxRy, where each of Rx and Ry is defined as further described herein. For example, “alkylamino” refers to a group -NRxRy, wherein one of Rx and Ry is an alkyl moiety and the other is H, and “dialkylamino” refers to -NRxRy wherein both of Rx and Ry are alkyl moieties, where the alkyl moieties have the specified number of carbon atoms (e.g., -NH(C₁-C₄ alkyl) or -N(C₁-C₄ alkyl)₂.
[0291] "Aryl" or “aromatic” refers to monocyclic, bicyclic (e.g., biaryl, fused) or polycyclic ring systems that contain the specified number of ring atoms, in which all carbon atoms in the ring are of sp2hybridization and in which the pi electrons are in conjugation. Aryl groups may contain, but are not limited to, 6 to 20 carbon atoms ("C₆-C₂₀ aryl"), 6 to 14 carbon atoms ("C₆-C₁₄ aryl"), 6 to 12 carbon atoms ("C₆-C₁₂ aryl"), or 6 to 10 carbon atoms ("C₆-C₁₀ aryl"). Fused aryl groups may include an aryl ring (e.g., a phenyl ring) fused to another aryl ring. Examples include, but are not limited to, phenyl, biphenyl, naphthyl, anthracenyl, phenanthrenyl, indanyl, and indenyl. Aryl groups may be optionally substituted, unsubstituted or substituted, as further defined herein.
[0292] The term “pharmaceutically acceptable” means the substance (e.g., the compounds described herein) and any salt thereof, or composition containing the substance or salt of the disclosure is suitable for administration to a subject or patient.
[0293] The compounds of the disclosure have asymmetric carbon atoms. The carbon-carbon bonds of the compounds of the disclosure may be depicted herein using a solid line ( - ), a solid wedge ("^^* ), or a dotted wedge (ul|l). The use of a solid line to depict bonds to asymmetric carbon atoms is meant to indicate that all possible stereoisomers (e.g., specific enantiomers, racemic mixtures, etc.) at that carbon atom are included. The use of either a solid or dotted wedge to depict bonds to asymmetric carbon atoms is meant to indicate that only the stereoisomer shown is meant to be included. It is possible that compounds of Formula (I) may contain more than one asymmetric carbon atom. In those compounds, the use of a solid line to depict bonds to asymmetric carbon atoms is meant to indicate that all possible stereoisomers are meant to be included. For example, unless stated otherwise, it is intended that the compounds of Formula (I) can exist as enantiomers and diastereomers or as racemates and mixtures thereof. The use of a solid line to depict bonds to one or more asymmetric carbon atoms in a compound of Formula (I) and the use of a solid or dotted wedge to depict bonds to other asymmetric carbon atoms in the same compound is meant to indicate that a mixture of diastereomers is present.
[0294] The terms “inhibiting,” “decreasing,” or “reducing” or any variation of these terms includes any measurable decrease (e.g., a 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% decrease) or complete inhibition to achieve a desired result. The terms “improve,” “promote,” or “increase” or any variation of these terms includes any measurable increase (e.g., a 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% increase) to achieve a desired result or production of a protein or molecule.
[0295] As used herein, the terms “reference,” “standard,” or “control” describe a value relative to which a comparison is performed. For example, an agent, subject, population, sample, or value of interest is compared with a reference, standard, or control agent, subject, population, sample, or value of interest. A reference, standard, or control may be tested and / or determined substantially simultaneously and / or with the testing or determination of interest for an agent, subject, population, sample, or value of interest and / or may be determined or characterized under comparable conditions or circumstances to the agent, subject, population, sample, or value of interest under assessment.
[0296] The term “isolated” may refer to a nucleic acid or polypeptide that is substantially free of cellular material, bacterial material, viral material, or culture medium (when produced by recombinant DNA techniques) of their source of origin, or chemical precursors or other chemicals (when chemically synthesized). Moreover, an isolated compound refers to one that may be administered to a subject as an isolated compound; in other words, the compound may not simply be considered “isolated” if it is adhered to a column or embedded in an agarose gel. Moreover, an “isolated nucleic acid fragment” or “isolated peptide” is a nucleic acid or protein fragment that is not naturally occurring as a fragment and / or is not typically in the functional state and / or that is altered or removed from the natural state through human intervention. For example, a DNA naturally present in a living animal is not “isolated,” but a synthetic DNA, or a DNA partially or completely separated from the coexisting materials of its natural state is “isolated.” An isolated nucleic acid may exist in substantially purified form, or may exist in a non-native environment such as, for example, a cell into which the nucleic acid has been delivered.
[0297] A “nucleic acid,” as used herein, is a molecule comprising nucleic acid components and refers to DNA or RNA molecules. It may be used interchangeably with the term “polynucleotide.” A nucleic acid molecule is a polymer comprising or consisting of nucleotide monomers, which are covalently linked to each other by phosphodiester-bonds of a sugar / phosphate-backbone. Nucleic acids may also encompass modified nucleic acid molecules, such as base-modified, sugar-modified or backbone-modified etc. DNA or RNA molecules. Nucleic acids may exist in a variety of forms such as: isolated segments and recombinant vectors of incorporated sequences or recombinant polynucleotides encoding polypeptides, such as antigens or one or both chains of an antibody, or a fragment, derivative, mutein, or variant thereof, polynucleotides sufficient for use as hybridization probes, PCR primers or sequencing primers for identifying, analyzing, mutating or amplifying a polynucleotide encoding a polypeptide, anti-sense nucleic acids for inhibiting expression of a polynucleotide, mRNA, modRNA and complementary sequences of the foregoing described herein. Nucleic acids may encode an epitope to which antibodies may bind.
[0298] The term “epitope” refers to a moiety that is specifically recognized by an immunoglobulin (e.g., antibody or receptor) binding component. In some aspects, an epitope is comprised of a plurality of chemical atoms or groups on a target molecule. In some aspects, such chemical atoms or groups are surface-exposed when the target molecule adopts a relevant three-dimensional conformation. In some aspects, such chemical atoms or groups are physically near to each other in space when the target molecule adopts such a conformation. In some aspects, at least some such chemical atoms are groups are physically separated from one another when the target molecule adopts an alternative conformation (e.g., is linearized).
[0299] Nucleic acids may be single-stranded or double-stranded and may comprise RNA and / or DNA nucleotides and artificial variants thereof (e.g., peptide nucleic acids). In some cases, a nucleic acid sequence may encode a polypeptide sequence with additional heterologous coding sequences, for example to allow for purification of the polypeptide, transport, secretion, post- translational modification, or for therapeutic benefits such as targeting or efficacy. A tag or other heterologous polypeptide may be added to the modified polypeptide-encoding sequence, wherein “heterologous” refers to a polypeptide that is not the same as the modified polypeptide.
[0300] The term “polynucleotide” refers to a nucleic acid molecule that may be recombinant or has been isolated from total genomic nucleic acid. Included within the term “polynucleotide” are oligonucleotides (nucleic acids 100 residues or less in length), recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like. Polynucleotides include, in certain aspects, regulatory sequences, isolated substantially away from their naturally occurring genes or protein encoding sequences. Polynucleotides may be single-stranded (coding or antisense) or double-stranded, and may be RNA, DNA (genomic, cDNA, or synthetic), analogs thereof, or a combination thereof. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide.
[0301] In certain aspects, there are polynucleotide variants having substantial identity to the sequences disclosed herein; those comprising equal to any one of, at least any one of, at most any one of, or between any two of 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or higher sequence identity, compared to a polynucleotide sequence provided herein using the methods described herein (e.g., BLAST analysis using standard parameters). In certain aspects, the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 80% (e.g., at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identity to a wild-type polynucleotide encoding a polypeptide over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide. In some aspects, the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 90% identity to an amino acid sequence described herein, over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide. In some aspects, the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 95% identity to an amino acid sequence described herein, over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide.
[0302] In certain aspects, the isolated polypeptide will comprise an amino acid sequence encoding a polypeptide that has at least 80% (e.g., at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identity to a wild-type amino acid sequence encoding a polypeptide over the entire length of the sequence. In some aspects, the isolated polypeptide will comprise an amino acid sequence encoding a polypeptide that has at least 90% identity to an amino acid sequence described herein, over the entire length of the sequence. In some aspects, the isolated polypeptide will comprise an amino acid sequence encoding a polypeptide that has at least 95% identity to an amino acid sequence described herein, over the entire length of the sequence.
[0303] The nucleic acid segments, regardless of the length of the coding sequence itself, may be combined with other nucleic acid sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably. The nucleic acids may be any length. They may be, for example, equal to any one of, at least any one of, at most any one of, or between any two of 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 175, 200, 250, 300, 350, 400, 450, 500, 750, 1000, 1500, 3000, 5000, 6000, 7000, 8000, 9000, 10000, 11000, 12000, 13000, 14000, 15000 or more nucleotides in length, and / or may comprise one or more additional sequences, for example, regulatory sequences, and / or be a part of a larger nucleic acid, for example, a vector. It is therefore contemplated that a nucleic acid fragment of almost any length may be employed, with the total length being limited by the ease of preparation and use in the intended recombinant nucleic acid protocol.
[0304] In this respect, the term “gene” is used to refer to a nucleic acid that encodes a protein, polypeptide, or peptide (including any sequences required for proper transcription, post-translational modification, or localization). As will be understood by those in the art, this term encompasses genomic sequences, expression cassettes, cDNA sequences, and smaller engineered nucleic acid segments that express, or may be adapted to express, proteins, polypeptides, domains, peptides, fusion proteins, and mutants. A nucleic acid encoding all or part of a polypeptide may contain a contiguous nucleic acid sequence encoding all or a portion of such a polypeptide. It also is contemplated that a particular polypeptide may be encoded by nucleic acids containing variations having slightly different nucleic acid sequences but, nonetheless, encode the same or substantially similar polypeptide.
[0305] As used herein, the term “expression” of a nucleic acid sequence refers to the generation of any gene product from the nucleic acid sequence. In some aspects, a gene product may be a transcript. In some aspects, a gene product may be a polypeptide. In some aspects, expression of a nucleic acid sequence involves one or more of the following: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, etc.); (3) translation of an RNA into a polypeptide or protein; and / or (4) post-translational modification of a polypeptide or protein.
[0306] In general, the term “engineered” refers to the aspect of having been manipulated by the hand of man. For example, a polynucleotide is considered to be “engineered” when two or more sequences that are not linked together in that order in nature are manipulated by the hand of man to be directly linked to one another in the engineered polynucleotide and / or when a particular residue in a polynucleotide is non-naturally occurring and / or is caused through action of the hand of man to be linked with an entity or moiety with which it is not linked in nature.
[0307] The term “DNA,” as used herein, means a nucleic acid molecule comprising nucleotides such as deoxy-adenosine-monophosphate, deoxy-thymidine-monophosphate, deoxy-guanosine-monophosphate and deoxy-cytidine-monophosphate monomers which are composed of a sugar moiety (deoxyribose), a base moiety and a phosphate moiety, and polymerize by a characteristic backbone structure. The backbone structure is, typically, formed by phosphodiester bonds between the sugar moiety of the nucleotide, e.g., deoxyribose, of a first and a phosphate moiety of a second, adjacent monomer. The specific order of the monomers, e.g., the order of the bases linked to the sugar / phosphate-backbone, is called the DNA sequence. DNA may be single stranded or double stranded. In the double stranded form, the nucleotides of the first strand typically hybridize with the nucleotides of the second strand, e.g. by A / T-base-pairing and G / C-base-pairing. DNA may contain all, ora majority of, deoxyribonucleotide residues. As used herein, the term “deoxyribonucleotide” means a nucleotide lacking a hydroxyl group at the 2' position of a p-D-ribofuranosyl group. Without any limitation, DNA may encompass double stranded DNA, antisense DNA, single stranded DNA, isolated DNA, synthetic DNA, DNA that is recombinantly produced, and modified DNA.
[0308] The term “RNA,” as used herein, means a nucleic acid molecule comprising nucleotides such as adenosine-monophosphate, uridine-monophosphate, guanosine-monophosphate and cytidine-monophosphate monomers which are connected to each other along a so-called backbone. The backbone is formed by phosphodiester bonds between the sugar, e.g., ribose, of a first and a phosphate moiety of a second, adjacent monomer. RNA may be obtainable by transcription of a DNA-sequence, e.g., inside a cell. In eukaryotic cells, transcription is typically performed inside the nucleus or the mitochondria. In vivo, transcription of DNA may result in premature RNA which is processed into messenger-RNA (mRNA). Processing of the premature RNA, e.g. in eukaryotic organisms, comprises various posttranscriptional modifications such as splicing, 5' capping, polyadenylation, export from the nucleus or the mitochondria. Mature messenger RNA is processed and provides the nucleotide sequence that may be translated into an amino acid sequence of a peptide or protein. A mature mRNA may comprise a 5' cap, a 5' UTR, an open reading frame, a 3' UTR and a poly-A tail sequence. RNA may contain all, or a majority of, ribonucleotide residues. As used herein, the term “ribonucleotide” means a nucleotide with a hydroxyl group at the 2' position of a p-D-ribofuranosyl group. In one aspect, RNA may be messenger RNA (mRNA) that relates to a RNA transcript which encodes a peptide or protein. As known to those of skill in the art, mRNA generally contains a 5' untranslated region (5' UTR), a polypeptide coding region, and a 3' untranslated region (3' UTR). Without any limitation, RNA may encompass double stranded RNA, antisense RNA, single stranded RNA, isolated RNA, synthetic RNA, RNA that is recombinantly produced, and modified RNA (modRNA).
[0309] An “isolated RNA” is defined as an RNA molecule that may be recombinant or has been isolated from total genomic nucleic acid. An isolated RNA molecule or protein may exist in substantially purified form, or may exist in a non-native environment such as, for example, a host cell.
[0310] A “modified RNA” or “modRNA” refers to an RNA molecule having at least one addition, deletion, substitution, and / or alteration of one or more nucleotides as compared to naturally occurring RNA. Such alterations may refer to the addition of non-nucleotide material to internal RNA nucleotides, or to the 5' and / or 3' end(s) of RNA. In one aspect, such modRNA contains at least one modified nucleotide, such as an alteration to the base of the nucleotide. For example, a modified nucleotide may replace one or more uridine and / or cytidine nucleotides. For example, these replacements may occur for every instance of uridine and / or cytidine in the RNA sequence, or may occur for only select uridine and / or cytidine nucleotides. Such alterations to the standard nucleotides in RNA may include non-standard nucleotides, such as chemically synthesized nucleotides or deoxynucleotides. For example, at least one uridine nucleotide may be replaced with N1-methylpseudouridine (denoted by the symbol m1Ψ) in an RNA sequence. Other such altered nucleotides are known to those of skill in the art. Such altered RNA molecules are considered analogs of naturally-occurring RNA. In some aspects, the RNA is produced by in vitro transcription using a DNA template, where DNA refers to a nucleic acid that contains deoxyribonucleotides. In some aspects, the RNA may be replicon RNA (replicon), in particular self-replicating RNA, or self-amplifying RNA (saRNA).
[0311] In some embodiments, the RNA molecule is an saRNA. “saRNA,” “self-amplifying RNA,” and “replicon” refer to RNA with the ability to replicate itself. Self-amplifying RNA molecules may be produced by using replication elements derived from a virus or viruses, e.g., alphaviruses, and substituting the structural viral polypeptides with a nucleotide sequence encoding a polypeptide of interest. A self-amplifying RNA molecule is typically a positive-strand molecule that may be directly translated after delivery to a cell, and this translation provides an RNA-dependent RNA polymerase which then produces both antisense and sense transcripts from the delivered RNA. The delivered RNA leads to the production of multiple daughter RNAs. These daughter RNAs, as well as collinear subgenomic transcripts, may be translated themselves to provide in situ expression of an encoded gene of interest, e.g., a viral antigen, or may be transcribed to provide further transcripts with the same sense as the delivered RNA which are translated to provide in situ expression of the protein of interest, e.g., an antigen. The overall result of this sequence of transcriptions is an amplification in the number of the introduced saRNAs and so the encoded gene of interest, e.g., a viral antigen, can become a major polypeptide product of the cells.
[0312] As contemplated herein, without any limitations, RNA may be used as a therapeutic modality to treat and / or prevent a number of conditions in mammals, including humans. Methods described herein comprise administration of the RNA described herein to a mammal, such as a human. In one aspect, the RNA administered is in vitro transcribed RNA.
[0313] “Prevent” or “prevention,” as used herein when used in connection with the occurrence of a disease, disorder, and / or condition, refers to reducing the risk of developing the disease, disorder and / or condition and / or to delaying onset of one or more characteristics or symptoms of the disease, disorder or condition. Prevention may be considered complete when onset of a disease, disorder, or condition has been delayed for a predefined period of time.
[0314] As will be understood from context, “risk” of a disease, disorder, and / or condition refers to a likelihood that a particular individual will develop the disease, disorder, and / or condition. In some aspects, risk is expressed as a percentage. In some aspects, risk is, is at least, or is at most from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90 up to 100%. In some aspects risk is expressed as a risk relative to a risk associated with a reference sample or group of reference samples. In some aspects, a reference sample or group of reference samples have a known risk of a disease, disorder, condition and / or event. In some aspects a reference sample or group of reference samples are from individuals comparable to a particular individual. In some aspects, risk may reflect one or more genetic attributes, e.g., which may predispose an individual toward development (or not) of a particular disease, disorder and / or condition. In some aspects, risk may reflect one or more epigenetic events or attributes and / or one or more lifestyle or environmental events or attributes. Susceptible to: An individual who is “susceptible to” a disease, disorder, and / or condition is one who has a higher risk of developing the disease, disorder, and / or condition than does a member of the general public. In some aspects, an individual who is susceptible to a disease, disorder and / or condition may not have been diagnosed with the disease, disorder, and / or condition. In some aspects, an individual who is susceptible to a disease, disorder, and / or condition may exhibit symptoms of the disease, disorder, and / or condition. In some aspects, an individual who is susceptible to a disease, disorder, and / or condition may not exhibit symptoms of the disease, disorder, and / or condition. In some aspects, an individual who is susceptible to a disease, disorder, and / or condition will develop the disease, disorder, and / or condition. In some aspects, an individual who is susceptible to a disease, disorder, and / or condition will not develop the disease, disorder, and / or condition.
[0315] The terms “protein,” “polypeptide,” or “peptide” are used herein as synonyms and refer to a polymer of amino acid monomers, e.g., a molecule comprising at least two amino acid residues. Polypeptides may include gene products, naturally occurring polypeptides, synthetic polypeptides, homologs, orthologs, paralogs, fragments and other equivalents, variants, and analogs of the foregoing. Polypeptides may be a single molecule or may be a multi-molecular complex such as a dimer, trimer or tetramer. A protein comprises one or more peptides or polypeptides, and may be folded into a 3-dimensional form, which may be required for the protein to exert its biological function.
[0316] As used herein, the term “wild type” or ”WT” or “native” refers to the endogenous version of a molecule that occurs naturally in an organism. In some aspects, wild type versions of a protein or polypeptide are employed, however, in other aspects of the disclosure, a modified protein or polypeptide is employed to generate an immune response. The terms described above may be used interchangeably.
[0317] A “modified protein” or “modified polypeptide” refers to a protein or polypeptide whose chemical structure, particularly its amino acid sequence, is altered with respect to the wild type protein or polypeptide. In some aspects, a modified / variant protein or polypeptide has at least one modified activity or function (recognizing that proteins or polypeptides may have multiple activities or functions). It is specifically contemplated that a modified / variant protein or polypeptide may be altered with respect to one activity or function yet retain a wild type activity or function in other respects, such as immunogenicity. Where a protein is specifically mentioned herein, it is in general a reference to a native (wild type) or recombinant (modified) protein. The protein may be isolated directly from the organism of which it is native, produced by recombinant DNA / exogenous expression methods, produced by solid-phase peptide synthesis (SPPS), or other in vitro methods. In particular aspects, there are isolated nucleic acid segments and recombinant vectors incorporating nucleic acid sequences that encode a polypeptide (e.g., an antigen or fragment thereof). The term “recombinant” may be used in conjunction with a polypeptide or the name of a specific polypeptide, and this generally refers to a polypeptide produced from a nucleic acid molecule that has been manipulated in vitro or that is a replication product of such a molecule.
[0318] The term “fragment,” with reference to an amino acid sequence (peptide or protein), relates to a part of an amino acid sequence, e.g., a sequence which represents the amino acid sequence shortened at the N-terminus and / or C-terminus. A fragment shortened at the C-terminus (N-terminal fragment) is obtainable, e.g., by translation of a truncated open reading frame that lacks the 3'-end of the open reading frame. A fragment shortened at the N-terminus (C-terminal fragment) is obtainable, e.g., by translation of a truncated open reading frame that lacks the 5'-end of the open reading frame, as long as the truncated open reading frame comprises a start codon that serves to initiate translation. A fragment of an amino acid sequence comprises, e.g., at least 50 %, at least 60 %, at least 70 %, at least 80%, at least 90%, or at least 99% of the amino acid residues from an amino acid sequence. In the present disclosure, a fragment of a polypeptide, DNA nucleic acid or RNA nucleic acid sequence refers to a sequence having sequence identity of at least, at most, exactly, or between any two of 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% with a polypeptide, DNA nucleic acid or RNA nucleic acid sequence, from which it is derived.
[0319] In one aspect, a fragment of a polypeptide, DNA nucleic acid or RNA nucleic acid sequence refers to a sequence having sequence identity of at least 70% with a polypeptide, DNA nucleic acid or RNA nucleic acid sequence, from which it is derived. In one aspect, a fragment of a polypeptide, DNA nucleic acid or RNA nucleic acid sequence refers to a sequence having sequence identity of at least 80% with a polypeptide, DNA nucleic acid or RNA nucleic acid sequence, from which it is derived. In one aspect, a fragment of a polypeptide, DNA nucleic acid or RNA nucleic acid sequence refers to a sequence having sequence identity of at least 85% with a polypeptide, DNA nucleic acid or RNA nucleic acid sequence, from which it is derived. In one aspect, a fragment of a polypeptide, DNA nucleic acid or RNA nucleic acid sequence refers to a sequence having sequence identity of at least 90% with a polypeptide, DNA nucleic acid or RNA nucleic acid sequence, from which it is derived. In one aspect, a fragment of a polypeptide, DNA nucleic acid or RNA nucleic acid sequence refers to a sequence having sequence identity of at least 95% with a polypeptide, DNA nucleic acid or RNA nucleic acid sequence, from which it is derived. In one aspect, a fragment of a polypeptide, DNA nucleic acid or RNA nucleic acid sequence refers to a sequence having sequence identity of at least 97% with a polypeptide, DNA nucleic acid or RNA nucleic acid sequence, from which it is derived. In one aspect, a fragment of a polypeptide, DNA nucleic acid or RNA nucleic acid sequence refers to a sequence having sequence identity of at least 99% with a polypeptide, DNA nucleic acid or RNA nucleic acid sequence, from which it is derived.
[0320] As used herein in the context of molecules, e.g., nucleic acids, proteins, or small molecules, the term “variant” refers to a molecule that shows significant structural identity with a reference molecule but differs structurally from the reference molecule, e.g., in the presence or absence or in the level of one or more chemical moieties as compared to the reference entity. In some aspects, a variant also differs functionally from its reference molecule. In general, whether a particular molecule is properly considered to be a “variant” of a reference molecule is based on its degree of structural identity with the reference molecule. As will be appreciated by those skilled in the art, any biological or chemical reference molecule has certain characteristic structural elements. A variant, by definition, is a distinct molecule that shares one or more such characteristic structural elements but differs in at least one aspect from the reference molecule. In some aspects, a variant polypeptide or nucleic acid may differ from a reference polypeptide or nucleic acid as a result of one or more differences in amino acid or nucleotide sequence and / or one or more differences in chemical moieties (e.g., carbohydrates, lipids, phosphate groups) that are covalently components of the polypeptide or nucleic acid (e.g., that are attached to the polypeptide or nucleic acid backbone). In some aspects, a variant polypeptide or nucleic acid shows an overall sequence identity with a reference polypeptide or nucleic acid that is at least, at most, exactly, or between any two of 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%. In some aspects, a variant polypeptide or nucleic acid does not share at least one characteristic sequence element with a reference polypeptide or nucleic acid. In some aspects, a reference polypeptide or nucleic acid has one or more biological activities. In some aspects, a variant polypeptide or nucleic acid shares one or more of the biological activities of the reference polypeptide or nucleic acid. In some aspects, a variant polypeptide or nucleic acid lacks one or more of the biological activities of the reference polypeptide or nucleic acid. In some aspects, a variant polypeptide or nucleic acid shows a reduced level of one or more biological activities as compared to the reference polypeptide or nucleic acid. In some aspects, a polypeptide or nucleic acid of interest is considered to be a “variant” of a reference polypeptide or nucleic acid if it has an amino acid or nucleotide sequence that is identical to that of the reference but for a small number of sequence alterations at particular positions. Preferably, the variant polypeptide or nucleic acid sequence has at least one modification compared to the reference polypeptide or nucleic acid sequence, e.g., from 1 to about 20 modifications. In one aspect, the variant polypeptide or nucleic acid sequence has from 1 to about 10 modifications compared to the reference polypeptide or nucleic acid sequence. In one aspect, the variant polypeptide or nucleic acid sequence has from 1 to about 5 modifications compared to the reference polypeptide or nucleic acid sequence. In one aspect, the variant polypeptide or nucleic acid sequence has from 1 to about 4 modifications compared to the reference polypeptide or nucleic acid sequence. Typically, fewer than about 20%, about 15%, about 10%, about 9%, about 8%, about 7%, about 6%, about 5%, about 4%, about 3%, or about 2% of the residues in a variant are substituted, inserted, or deleted, as compared to the reference. Often, a variant polypeptide or nucleic acid comprises a very small number (e.g., fewer than about 5, about 4, about 3, about 2, or about 1) number of substituted, inserted, or deleted, functional residues (e.g., residues that participate in a particular biological activity) relative to the reference. In some aspects, a variant polypeptide or nucleic acid comprises about 10, about 9, about 8, about 7, about 6, about 5, about 4, about 3, about 2, or about 1 substituted residues as compared to a reference. In some aspects, a variant polypeptide or nucleic acid comprises fewer than about 25, about 20, about 19, about 18, about 17, about 16, about 15, about 14, about 13, about 10, about 9, about 8, about 7, about 6, and commonly fewer than about 5, about 4, about 3, or about 2 additions or deletions as compared to the reference. In some aspects, a variant polypeptide or nucleic acid comprises not more than about 5, about 4, about 3, about 2, or about 1 addition or deletion, and, in some aspects, comprises no additions or deletions, as compared to the reference. In some aspects, a reference polypeptide or nucleic acid is a wild type (WT) or native sequence found in nature, including allelic variations. For the purposes of the present disclosure, “variants” of an amino acid sequence (peptide, protein, or polypeptide) can comprise amino acid insertion variants, amino acid addition variants, amino acid deletion variants and / or amino acid substitution variants. “Variants” of a nucleotide sequence can comprise nucleotide insertion variants, nucleotide addition variants, nucleotide deletion variants and / or nucleotide substitution variants. The term “variant” includes all mutants, splice variants, post-translationally modified variants, conformations, isoforms, allelic variants, species variants, and species homologs, in particular those which are naturally occurring. The term “variant” also includes, in particular, fragments of an amino acid or nucleic acid sequence.
[0321] Changes may be introduced by mutation into a nucleic acid, thereby leading to changes in the amino acid sequence of a polypeptide (e.g., an antigen) that it encodes. Mutations may be introduced using any technique known in the art. In one aspect, one or more particular amino acid residues are changed using, for example, a site-directed mutagenesis protocol. In another aspect, one or more randomly selected residues are changed using, for example, a random mutagenesis protocol. In some aspects, however it is made, a mutant polypeptide may be expressed and screened for a desired property.
[0322] Mutations may be introduced into a nucleic acid without significantly altering the biological activity of a polypeptide that it encodes. For example, one may make nucleotide substitutions leading to amino acid substitutions at non-essential amino acid residues. Alternatively, one or more mutations may be introduced into a nucleic acid that selectively changes the biological activity of a polypeptide that it encodes. For example, the mutation may quantitatively or qualitatively change the biological activity. Examples of quantitative changes include increasing, reducing or eliminating the activity. Examples of qualitative changes include altering the antigen specificity of an antibody.
[0323] “Sequence similarity” indicates the percentage of amino acids that either are identical or that represent conservative amino acid substitutions. “Sequence identity” between two amino acid sequences indicates the percentage of amino acids that are identical between the sequences. “Sequence identity” between two nucleic acid sequences indicates the percentage of nucleotides that are identical between the sequences.
[0324] The terms “% identical,” “% identity,” or similar terms are intended to refer, in particular, to the percentage of nucleotides or amino acids which are identical in an optimal alignment between the sequences to be compared. Said percentage is purely statistical, and the differences between the two sequences may be but are not necessarily randomly distributed over the entire length of the sequences to be compared. Comparisons of two sequences are usually carried out by comparing the sequences, after optimal alignment, with respect to a segment or “window of comparison,” in order to identify local regions of corresponding sequences. The optimal alignment for a comparison may be carried out manually or with the aid of the local homology algorithm by Smith and Waterman, 1981, Ads App. Math. 2, 482, with the aid of the local homology algorithm by Neddleman and Wunsch, 1970, J. Mol. Biol. 48, 443, with the aid of the similarity search algorithm by Pearson and Lipman, 1988, Proc. Natl Acad. Sci. USA 88, 2444, or with the aid of computer programs using said algorithms (GAP, BESTFIT, FASTA, BLAST P, BLAST N, and TFASTA in Wisconsin Genetics Software Package, Genetics Computer Group). In some aspects, percent identity of two sequences is determined using the BLASTN or BLASTP algorithm, as available on the United States National Center for Biotechnology Information (NCBI) website.
[0325] Percentage identity is obtained by determining the number of identical positions at which the sequences to be compared correspond, dividing this number by the number of positions compared (e.g., the number of positions in the reference sequence) and multiplying this result by 100.
[0326] In some aspects, the degree of similarity or identity is given for a region that is at least, at most, exactly, or between any two of about 50%, about 60%, about 70%, about 80%, about 90%, or about 100% of the entire length of the reference sequence. For example, if the reference nucleic acid sequence consists of 200 nucleotides, the degree of identity is given for at least, at most, exactly, or between any two of about 100, about 120, about 140, about 160, about 180, or about 200 nucleotides, in some aspects, continuous nucleotides. In some aspects, the degree of similarity or identity is given for the entire length of the reference sequence.
[0327] Homologous amino acid sequences may exhibit at least, at most, exactly, or between any two of 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 99% identity of the amino acid residues. In one aspect, homologous amino acid sequences exhibit at least 95% identity of the amino acid residues. In one aspect, homologous amino acid sequences exhibit at least 98% identity of the amino acid residues. In one aspect, homologous amino acid sequences exhibit at least 99% identity of the amino acid residues.
[0328] A fragment or variant of an amino acid sequence (peptide or protein) may be a “functional fragment” or “functional variant.” The term “functional fragment” or “functional variant” of an amino acid sequence relates to any fragment or variant exhibiting one or more functional properties identical or similar to those of the amino acid sequence from which it is derived, e.g., it is functionally equivalent. With respect to antigens or antigenic sequences, one particular function is one or more immunogenic activities displayed by the amino acid sequence from which the fragment or variant is derived. The term “functional fragment” or “functional variant,” as used herein, in particular refers to a variant molecule or sequence that comprises an amino acid sequence that is altered by one or more amino acids compared to the amino acid sequence of the parent molecule or sequence and that is still capable of fulfilling one or more of the functions of the parent molecule or sequence, e.g., inducing an immune response. In one aspect, the modifications in the amino acid sequence of the parent molecule or sequence do not significantly affect or alter the characteristics of the molecule or sequence. The term “mutant” of a wild-type protein, “mutant” of a protein, “protein mutant,” or “modified protein” refer to a polypeptide that displays introduced mutations relative to a wild-type protein.
[0329] An amino acid sequence (peptide, protein, or polypeptide) “derived from” a designated amino acid sequence (peptide, protein, or polypeptide) refers to the origin of the first amino acid sequence. Preferably, the amino acid sequence which is derived from a particular amino acid sequence has an amino acid sequence that is identical, essentially identical, or homologous to that particular sequence or a fragment thereof. Amino acid sequences derived from a particular amino acid sequence may be variants of that particular sequence or a fragment thereof. For example, it will be understood by one of ordinary skill in the art that the antigens suitable for use herein may be altered such that they vary in sequence from the naturally occurring or native sequences from which they were derived, while retaining the desirable activity of the native sequences.
[0330] In the present disclosure, a vector refers to a nucleic acid molecule, such as an artificial nucleic acid molecule. A vector may be used to incorporate a nucleic acid sequence, such as a nucleic acid sequence comprising an open reading frame. Vectors include, but are not limited to, storage vectors, expression vectors, cloning vectors, transfer vectors. A vector may be an RNA vector or a DNA vector. In some aspects the vector is a DNA molecule. In some aspects, the vector is a plasmid vector. In some aspects, the vector is a viral vector. Typically, an expression vector will contain a desired coding sequence and appropriate other sequences necessary for the expression of the operably linked coding sequence in a particular host organism (e.g., bacteria, yeast, plant, insect, or mammal) or in in vitro expression systems. Cloning vectors are generally used to engineer and amplify a certain desired fragment (typically a DNA fragment), and may lack functional sequences needed for expression of the desired fragment(s).
[0331] As used herein, the term “immunogen” refers to a substance, which is capable of being recognized by the immune system, e.g. by the adaptive immune system, and which is capable of eliciting an antigen-specific immune response, e.g. by formation of antibodies and / or antigenspecific T cells as part of an adaptive immune response. An immunogen may be or may comprise a peptide or protein, which may be presented by the MHC to T-cells. An immunogen may be the product of translation of a provided nucleic acid molecule, e.g. an RNA molecule comprising at least one coding sequence as described herein. In addition, fragments, variants and derivatives of an immunogen, such as a peptide or a protein, comprising at least one epitope are understood as immunogens. As used herein, the term “vaccine” refers to a pharmaceutical composition comprising an immunogenic agent, immunogen, or antigen, wherein the pharmaceutical composition is intended to generate an immune response, for example to a disease-associated (e.g., disease-causing) agent (e.g., a bacteria). In some aspects, a vaccine generates an immune response to an infectious agent. In some aspects, a vaccine generates an immune response to a tumor; in some such aspects, the vaccine is “personalized” in that it is partly or wholly directed to epitope(s) (e.g., which may be or include one or more neoepitopes) determined to be present in a particular individual’s tumors.
[0332] An immune response refers to a humoral response, a cellular response, or both a humoral and cellular response in an organism. An immune response may be measured by assays that include, but are not limited to, assays measuring the presence or amount of antibodies that specifically recognize a protein or cell surface protein, assays measuring T-cell activation or proliferation, and / or assays that measure modulation in terms of activity or expression of one or more cytokines.
[0333] Those skilled in the art will appreciate that the term “dosing regimen” may be used to refer to a set of unit doses (typically more than one) that are administered individually to a subject, typically separated by periods of time. In some aspects, a given therapeutic agent has a recommended dosing regimen, which may involve one or more doses. In some aspects, a dosing regimen comprises a plurality of doses each of which is separated in time from other doses. In some aspects, individual doses are separated from one another by a time period of the same length; in some aspects, a dosing regimen comprises a plurality of doses and at least two different time periods separating individual doses. In some aspects, all doses within a dosing regimen are of the same unit dose amount. In some aspects, different doses within a dosing regimen are of different amounts. In some aspects, a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount different from the first dose amount. In some aspects, a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount same as the first dose amount. In some aspects, a dosing regimen is correlated with a desired or beneficial outcome when administered across a relevant population (e.g., is a therapeutic dosing regimen).
[0334] Salts
[0335] Salts encompassed within the term “pharmaceutically acceptable salts” refer to the compounds of this disclosure which are generally prepared by reacting the free base or free acid with a suitable organic or inorganic acid, or a suitable organic or inorganic base, respectively, to provide a salt of the compound of the disclosure that is suitable for administration to a subject or patient. In addition, the compounds of Formula I may also include other salts of such compounds which are not necessarily pharmaceutically acceptable salts, which may be useful as intermediates for one or more of the following: 1) preparing compounds of Formula I; 2) purifying compounds of Formula I; 3) separating enantiomers of compounds of Formula I; or 4) separating diastereomers of compounds of Formula I.
[0336] Suitable acid addition salts are formed from acids which form non-toxic salts. Examples include, but are not limited to, acetate, adipate, aspartate, benzoate, besylate, bicarbonate / carbonate, bisulfate / sulfate, borate, camsylate, citrate, cyclamate, edisylate, esylate, formate, fumarate, gluceptate, gluconate, glucuronate, hexafluorophosphate, hibenzate, hydrochloride / chloride, hydrobromide / bromide, hydroiodide / iodide, isethionate, lactate, malate, maleate, malonate, mesylate, methylsulfate, naphthylate, 2-napsylate, nicotinate, nitrate, orotate, oxalate, palmitate, pamoate, phosphate / hydrogen phosphate / dihydrogen phosphate, pyroglutamate, saccharate, stearate, succinate, tannate, tartrate, tosylate, trifluoroacetate, 1,5-naphathalenedisulfonic acid and xinafoate salts.
[0337] Suitable base salts are formed from bases which form non-toxic salts. Examples include, but are not limited to aluminum, arginine, benzathine, calcium, choline, diethylamine, diolamine, glycine, lysine, magnesium, meglumine, olamine, potassium, sodium, tromethamine and zinc salts.
[0338] Hemisalts of acids and bases may also be formed, for example, hemisulfate and hemicalcium salts.
[0339] For a review on suitable salts, see Paulekun, G. S. et al., Trends in Active Pharmaceutical Ingredient Salt Selection Based on Analysis of the Orange Book Database, J. Med. Chem. 2007; 50(26), 6665-6672.
[0340] Pharmaceutically acceptable salts of compounds of the disclosure may be prepared by methods well known to one skilled in the art, including but not limited to the following procedures (i) by reacting a compound of the disclosure with the desired acid or base;
[0341] (ii) by removing an acid- or base-labile protecting group from a suitable precursor of a compound of the disclosure or by ring-opening a suitable cyclic precursor, for example, a lactone or lactam, using the desired acid or base; or
[0342] (iii) by converting one salt of a compound of the disclosure to another. This may be accomplished by reaction with an appropriate acid or base or by means of a suitable ion exchange procedure.
[0343] These procedures are typically carried out in solution. The resulting salt may precipitate out and be collected by filtration or may be recovered by evaporation of the solvent.
[0344] Solvates The compounds of the disclosure, and pharmaceutically acceptable salts thereof, may exist in unsolvated and solvated forms. The term ‘solvate’ is used herein to describe a molecular complex comprising the compound of the disclosure, or a pharmaceutically acceptable salt thereof, and one or more pharmaceutically acceptable solvent molecules, for example, ethanol. The term ‘hydrate’ is employed when said solvent is water.
[0345] In addition, the compounds of Formula I may also include other solvates of such compounds which are not necessarily pharmaceutically acceptable solvates, which may be useful as intermediates for one or more of the following: 1) preparing compounds of Formula I; 2) purifying compounds of Formula I; 3) separating enantiomers of compounds of Formula I; or 4) separating diastereomers of compounds of Formula I.
[0346] A currently accepted classification system for organic hydrates is one that defines isolated site, channel, or metal-ion coordinated hydrates - see Polymorphism in Pharmaceutical Solids by K. R. Morris (Ed. H. G. Brittain, Marcel Dekker, 1995). Isolated site hydrates are ones in which the water molecules are isolated from direct contact with each other by intervening organic molecules. In channel hydrates, the water molecules lie in lattice channels where they are next to other water molecules. In metal-ion coordinated hydrates, the water molecules are bonded to the metal ion.
[0347] When the solvent or water is tightly bound, the complex may have a well-defined stoichiometry independent of humidity. When, however, the solvent or water is weakly bound, as in channel solvates and hygroscopic compounds, the water / solvent content may be dependent on humidity and drying conditions. In such cases, non-stoichiometry will be the norm.
[0348] Complexes
[0349] Also included within the scope of the disclosure are multi-component complexes (other than salts and solvates) wherein the drug and at least one other component are present in stoichiometric or non-stoichiometric amounts. In one embodiment, the compounds of the disclosure are in a complex with aluminum. In another embodiment, the compounds of the disclosure are in a complex with aluminum hydroxide. In another embodiment, the compounds of the disclosure are in a complex with aluminum phosphate. Complexes of this type include clathrates (drug-host inclusion complexes) and co-crystals. The latter are typically defined as crystalline complexes of neutral molecular constituents which are bound together through non-covalent interactions, for example, hydrogen bonded complex (cocrystal) may be formed with either a neutral molecule or with a salt. Co-crystals may be prepared by melt crystallization, by recrystallization from solvents, or by physically grinding the components together - see Chem Commun, 17;1889-1896, by O. Almarsson and M. J. Zaworotko (2004). For a general review of multi-component complexes, see J Pharm Sci, 64(8), 1269-1288, by Haleblian (August 1975). Solid form
[0350] The compounds of the disclosure may exist in a continuum of solid states ranging from amorphous to crystalline. The term ‘amorphous’ refers to a state in which the material lacks long range order at the molecular level and, depending upon temperature, may exhibit the physical properties of a solid or a liquid. Typically, such materials do not give distinctive X-ray diffraction patterns and, while exhibiting the properties of a solid, are more formally described as a liquid. Upon heating, a change from solid to liquid properties occurs which is characterized by a change of state, typically second order (‘glass transition’). The term ‘crystalline’ refers to a solid phase in which the material has a regular ordered internal structure at the molecular level and gives a distinctive X-ray diffraction pattern with defined peaks. Such materials when heated sufficiently will also exhibit the properties of a liquid, but the change from solid to liquid is characterized by a phase change, typically first order (‘melting point’).
[0351] The compounds of the disclosure may also exist in a mesomorphic state (mesophase or liquid crystal) when subjected to suitable conditions. The mesomorphic state is intermediate between the true crystalline state and the true liquid state (either melt or solution) and consists of two dimensional order on the molecular level. Mesomorphism arising as the result of a change in temperature is described as ‘thermotropic’ and that resulting from the addition of a second component, such as water or another solvent, is described as ‘lyotropic’. Compounds that have the potential to form lyotropic mesophases are described as ‘amphiphilic’ and consist of molecules which possess an ionic (such as -COO'Na+, -COO'K+, or -SO3-Na+) or non-ionic (such as -N+(CH3)3) polar head group. For more information, see Crystals and the Polarizing Microscope by N. H. Hartshorne and A. Stuart, 4thEdition (Edward Arnold, 1970).
[0352] Stereoisomers
[0353] Compounds of the disclosure may exist as two or more stereoisomers. Stereoisomers of the compounds may include c / s and trans isomers (geometric isomers), optical isomers such as R and S enantiomers, diastereomers, rotational isomers, atropisomers, and conformational isomers. For example, compounds of the disclosure containing one or more asymmetric carbon atoms may exist as two or more stereoisomers. Where a compound of the disclosure contains an alkenyl or alkenylene group, geometric cis / trans (or Z / E) isomers are possible. Cis / trans isomers may also exist for saturated rings.
[0354] The pharmaceutically acceptable salts of compounds of the disclosure may also contain a counterion which is optically active (e.g., d-lactate or l-lysine) or racemic (e.g., dl-tartrate or dl-arginine). Cis / trans isomers may be separated by conventional techniques well known to those skilled in the art, for example, chromatography and fractional crystallization.
[0355] Conventional techniques for the preparation / isolation of individual enantiomers include chiral synthesis from a suitable optically pure precursor or resolution of the racemate (or the racemate of a salt or derivative) using, for example, chiral high pressure liquid chromatography (HPLC). Alternatively, the racemate (or a racemic precursor) may be reacted with a suitable optically active compound, for example, an alcohol, or, in the case where a compound of the disclosure contains an acidic or basic moiety, a base or acid such as 1 -phenylethylamine or tartaric acid. The resulting diastereomeric mixture may be separated by chromatography, fractional crystallization, or by using both of said techniques, and one or both of the diastereoisomers converted to the corresponding pure enantiomer(s) by means well known to a skilled person. Chiral compounds of the disclosure (and chiral precursors thereof) may be obtained in enantiomerically-enriched form using chromatography, typically HPLC Concentration of the eluate affords the enriched mixture. Chiral chromatography using sub-and supercritical fluids may be employed. Methods for chiral chromatography useful in some embodiments of the present disclosure are known in the art (see, for example, Smith, Roger M., Loughborough University, Loughborough, UK; Chromatographic Science Series (1998), 75 (Supercritical Fluid Chromatography with Packed Columns), pp. 223-249 and references cited therein).
[0356] When any racemate crystallizes, crystals of two different types are possible. The first type is the racemic compound (true racemate) referred to above wherein one homogeneous form of crystal is produced containing both enantiomers in equimolar amounts. The second type is the racemic mixture or conglomerate wherein two crystal forms are produced in equimolar amounts each comprising a single enantiomer. While both of the crystal forms present in a racemic mixture have identical physical properties, they may have different physical properties compared to the true racemate. Racemic mixtures may be separated by conventional techniques known to those skilled in the art - see, for example, Stereochemistry of Organic Compounds by E. L. Eliel and S. H. Wilen (Wiley, 1994).
[0357] Tautomerism
[0358] Where structural isomers are interconvertible via a low energy barrier, tautomeric isomerism (‘tautomerism’) may occur. This may take the form of proton tautomerism in compounds of the disclosure containing, for example, an imino / amino, keto / enol, or oxime / nitroso group, lactam / lactim or so-called valence tautomerism in compounds which contain an aromatic moiety. It follows that a single compound may exhibit more than one type of isomerism. It must be emphasized that while, for conciseness, the compounds of the disclosure have been drawn herein in a single tautomeric form, all possible tautomeric forms are included within the scope of the disclosure.
[0359] Isotopes
[0360] The present disclosure includes all pharmaceutically acceptable isotopically-labeled compounds of the disclosure wherein one or more atoms are replaced by atoms having the same atomic number, but an atomic mass or mass number different from the atomic mass or mass number which predominates in nature.
[0361] Examples of isotopes suitable for inclusion in the compounds of the disclosure may include isotopes of hydrogen, such as2H (D, deuterium) and3H (T, tritium), carbon, such as11C,13C and14C, chlorine, such as36CI, fluorine, such as18F, iodine, such as123l and125l, nitrogen, such as13N and15N, oxygen, such as15O,17O and18O, phosphorus, such as32P, and sulfur, such as35S.
[0362] Certain isotopically-labelled compounds of the disclosure, for example those incorporating a radioactive isotope, are useful in one or both of drug or substrate tissue distribution studies. The radioactive isotopes, such as, tritium and14C are particularly useful for this purpose in view of their ease of incorporation and ready means of detection. Substitution with positron emitting isotopes, such as,11C,18F,15O and13N, may be useful in Positron Emission Topography (PET) studies for examining substrate receptor occupancy. Substitution with deuterium may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life, reduced dosage requirements, reduced CYP450 inhibition (competitive or time dependent), or an improvement in therapeutic index or tolerability.
[0363] In some embodiments, the disclosure provides deuterium-labeled (or deuterated) compounds and salts, where the formula and variables of such compounds and salts are each and independently as described herein. “Deuterated” means that at least one of the atoms in the compound is deuterium in an abundance that is greater than the natural abundance of deuterium (typically approximately 0.015%). A skilled artisan recognized that in chemical compounds with a hydrogen atom, the hydrogen atom actually represents a mixture of H and D, with about 0.015% being D. The concentration of the deuterium incorporated into the deuterium-labeled compounds and salt of the disclosure may be defined by the deuterium enrichment factor. It is understood that one or more deuterium may exchange with hydrogen under physiological conditions.
[0364] In some embodiments, one or more hydrogen atoms on certain metabolic sites on the compounds of the disclosure are deuterated. Isotopically-labeled compounds of the disclosure may generally be prepared by conventional techniques known to those skilled in the art or by processes analogous to those described in the accompanying Examples and Preparations using an appropriate isotopically-labeled reagent in place of the non-labeled reagent previously employed.
[0365] Pharmaceutically acceptable solvates in accordance with the disclosure include those wherein the solvent of crystallization may be isotopically substituted, e.g., D2O, d6-acetone, d6-DMSO.
[0366] Metabolites
[0367] Also included within the scope of the disclosure are active metabolites of compounds of the disclosure, that is, compounds formed in vivo upon administration of the drug, often by oxidation or dealkylation. Some examples of metabolites in accordance with the disclosure include, but are not limited to,
[0368] (i) where the compound of the disclosure contains an alkyl group, a hydroxyalkyl derivative thereof (-CH — > -COH):
[0369] (ii) where the compound of the disclosure contains an alkoxy group, a hydroxy derivative thereof (-OR — > -OH);
[0370] (iii) where the compound of the disclosure contains a tertiary amino group, a secondary amino derivative thereof (-NRR’ — > -NHR or -NHR);
[0371] (iv) where the compound of the disclosure contains a secondary amino group, a primary derivative thereof (-NHR — > -NH2);
[0372] (v) where the compound of the disclosure contains a phenyl moiety, a phenol derivative thereof (-Ph — > -PhOH);
[0373] (vi) where the compound of the disclosure contains an amide group, a carboxylic acid derivative thereof (-CONH2 -> COOH); and
[0374] (vii) where the compound contains a hydroxy or carboxylic acid group, the compound may be metabolized by conjugation, for example with glucuronic acid to form a glucuronide. Other routes of conjugative metabolism exist. These pathways are frequently known as Phase 2 metabolism and include, for example, sulfation or acetylation. Other functional groups, such as NH groups, may also be subject to conjugation.
[0375] Adjuvants
[0376] The compounds of the present disclosure can be used as adjuvants, for example within an immunogenic composition (i.e., vaccine). An adjuvant is a substance that enhances the immune response when administered together with an immunogen or antigen. Adjuvants may act primarily as a delivery system, primarily as an immune modulator or have strong features of both. Suitable adjuvants include those suitable for use in mammals, including humans. For example, adjuvants augment the intrinsic immune response to an immunogen without causing conformational changes in the immunogen that may affect the qualitative form of the immune response. In some embodiments, the adjuvant is a TLR 7 / 8 modulating molecule described herein.
[0377] An effective amount of an adjuvant, such as those described herein, refers to the amount necessary or sufficient to realize a desired biologic effect. For example, an effective amount of an adjuvant administered with an antigen for inducing an antigen-specific immune response is that amount necessary to induce an immune response in response to an antigen upon exposure to the antigen. Combined with the teachings provided herein, by choosing among the various adjuvants and weighing factors such as potency, relative bioavailability, subject body weight, severity of adverse side-effects and preferred mode of administration, an effective prophylactic or therapeutic treatment regimen can be planned which does not cause substantial toxicity and yet is effective to treat the particular subject. The effective amount for any particular application can vary depending on such factors as the disease or condition being treated, the particular adjuvant being administered, the size of the subject, or the severity of the disease or condition.
[0378] In some embodiments, a compound of the present disclosure can be used as an adjuvant in combination with one or more additional adjuvants. For example, in some embodiments, a compound of the present disclosure can be used as an adjuvant in combination with 1, 2, 3, 4, or more additional adjuvants. In some embodiments, a compound of the present disclosure can be used as an adjuvant in combination with an additional TLR modulating compound. For example, a compound of the present disclosure can be used as an adjuvant in combination with an additional TLR 7 / 8 modulating compound. In other embodiments, a compound of the present disclosure can be used as an adjuvant in combination with a TLR 4 modulating compound. In other embodiments, a compound of the present disclosure can be used as an adjuvant in combination with a TLR 5 modulating compound. In other embodiments, a compound of the present disclosure can be used as an adjuvant in combination with a TLR 9 modulating compound. In still other embodiments, a compound of the present disclosure can be used as an adjuvant in combination with a cytokine. In some embodiments, a compound of the present disclosure can be used as an adjuvant in combination with a saponin. In some embodiments, a compound of the present disclosure can be used as an adjuvant in combination with a compound that modulates the stimulator of interferon genes (STING) pathway. In other embodiments, a compound of the present disclosure can be used as an adjuvant in combination with a retinoic acid-inducible gene I (RIG-1) modulating compound. In yet other embodiments, a compound of the present disclosure can be used as an adjuvant in combination with aluminum. In one embodiment, a compound of the present disclosure can be used as an adjuvant in combination with aluminum phosphate. In another embodiment, a compound of the present disclosure can be used as an adjuvant in combination with aluminum hydroxide.
[0379] In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with lipid nanoparticles (LNPs) to form a liposomal adjuvant formulation comprising LNPs, herein referred to as a “LNP adjuvant formulation”. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with a saponin to form a LNP adjuvant formulation. In one embodiment, a TLR 7 / 8 modulating molecule described herein is combined with QS-21 to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with a phospholipid to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with distearyl phosphatidylcholine (DSPC) to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with a sterol to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with cholesterol and / or a cholesterol analog to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with a cationic lipid to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with (4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate) (ALC-0315) to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with a polymer conjugated lipid to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with a-[2-(ditetradecylamino)-2-oxoethyl]-w-methoxy-poly(oxy-1,2-ethanediyl) (ALC-0159) to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with ALC-0315 and ALC-0159 to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with a saponin, a phospholipid, a cationic lipid, a polymer conjugated lipid, and a sterol to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with QS-21, a phospholipid, a cationic lipid, a polymer conjugated lipid, as well as cholesterol and / or a cholesterol analog to form a LNP adjuvant formulation. In some embodiments, a TLR 7 / 8 modulating molecule described herein is combined with QS-21, DSPC, a cationic lipid, a polymer conjugated lipid, and cholesterol to form a LNP adjuvant formulation. In a particular embodiment, a TLR 7 / 8 modulating molecule described herein is combined with QS-21, DSPC, ALC-0315, ALC-0159, and cholesterol to form a LNP adjuvant formulation.
[0380] In some embodiments, an LNP formulation described herein, when administered to a subject in combination with an immunogen of interest (or comprising an immunogen of interest), induces an immune response in the subject to the immunogen of interest and the immune response is at least 10%, at least 15%, at least 20%, least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, least 95%, at least 100%, at least 125%, at least 150%, at least 175%, at least 200%, at least 225%, at least 250%, at least 275%, at least 300%, at least 350%, at least 400%, at least 450%, or at least 500% higher than the immune response of the subject induced by the administration of the immunogen of interest to the subject without the LNP formulation. In a preferred embodiment, an LNP formulation described herein, when administered to a subject in combination with an immunogen of interest (or comprising an immunogen of interest), induces an immune response in the subject to the immunogen of interest and the immune response is at least 50% higher than the immune response of the subject induced by the administration of the immunogen of interest to the subject without the LNP formulation. In another preferred embodiment, an LNP formulation described herein, when administered to a subject in combination with an immunogen of interest (or comprising an immunogen of interest), induces an immune response in the subject to the immunogen of interest and the immune response is at least 100% higher than the immune response of the subject induced by the administration of the immunogen of interest to the subject without the LNP formulation. In another preferred embodiment, an LNP formulation described herein, when administered to a subject in combination with an immunogen of interest (or comprising an immunogen of interest), induces an immune response in the subject to the immunogen of interest and the immune response is at least 200% higher than the immune response of the subject induced by the administration of the immunogen of interest to the subject without the LNP formulation. In some embodiments, the immune response is measured by opsonophagocytic activity (OPA) geometric mean antibody titers. In some embodiments, the immune response is measured by neutralization geometric mean antibody titers.
[0381] In some embodiments, an LNP formulation comprising a TLR 7 / 8 modulating molecule described herein, when administered to a subject in combination with an immunogen of interest (or comprising an immunogen of interest), induces an immune response in the subject to the immunogen of interest and the immune response is at least 10%, at least 15%, at least 20%, least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, least 95%, at least 100%, at least 125%, at least 150%, at least 175%, at least 200%, at least 225%, at least 250%, at least 275%, at least 300%, at least 350%, at least 400%, at least 450%, or at least 500% higher than the immune response of the subject induced by the administration to the subject of the immunogen of interest and an LNP formulation that does not comprise a TLR 7 / 8 modulating molecule. In some embodiments, an LNP formulation comprising a TLR 7 / 8 modulating molecule described herein, when administered to a subject in combination with an immunogen of interest (or comprising an immunogen of interest), induces an immune response in the subject to the immunogen of interest and the immune response is at least 50% higher than the immune response of the subject induced by the administration to the subject of the immunogen of interest and an LNP formulation that does not comprise a TLR 7 / 8 modulating molecule. In some embodiments, an LNP formulation comprising a TLR 7 / 8 modulating molecule described herein, when administered to a subject in combination with an immunogen of interest (or comprising an immunogen of interest), induces an immune response in the subject to the immunogen of interest and the immune response is at least 100% higher than the immune response of the subject induced by the administration to the subject of the immunogen of interest and an LNP formulation that does not comprise a TLR 7 / 8 modulating molecule. In some embodiments, an LNP formulation comprising a TLR 7 / 8 modulating molecule described herein, when administered to a subject in combination with an immunogen of interest (or comprising an immunogen of interest), induces an immune response in the subject to the immunogen of interest and the immune response is at least 200% higher than the immune response of the subject induced by the administration to the subject of the immunogen of interest and an LNP formulation that does not comprise a TLR 7 / 8 modulating molecule. In some embodiments, the immune response is measured by opsonophagocytic activity (OPA) geometric mean antibody titers. In some embodiments, the immune response is measured by neutralization geometric mean antibody titers.
[0382] Linkers
[0383] In some embodiments, the TLR 7 / 8 modulating molecules disclosed herein comprise a linker that connects the TLR 7 / 8 modulating portion of the molecule to a terminal hydrophobic moiety. In some embodiments, the TLR 7 / 8 modulating molecules disclosed herein comprise a linker that connects the TLR 7 / 8 modulating portion of the molecule to a terminal hydrocarbon chain. In some embodiments, the TLR 7 / 8 modulating molecules disclosed herein comprise a linker that connects the TLR 7 / 8 modulating portion of the molecule to a terminal hydrophobic moiety, wherein the linker comprises polyethylene glycol (PEG). In some embodiments, the linker comprises one or more polyethylene glycol (PEG) repeat units. In some embodiments, the linker comprises PEG repeat units, wherein the number of PEG repeat units is an integer between about 1 and about 10. In some embodiments, the linker comprises PEG repeat units, wherein the number of PEG repeat units is an integer between about 1 and about 5. For example, in some embodiments, the linker comprises PEG repeat units, wherein the number of PEG repeat units is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the linker comprises PEG repeat units, wherein the number of PEG repeat units is 1. In some embodiments, the linker comprises PEG repeat units, wherein the number of PEG repeat units is 2. In particular embodiments, the linker comprises PEG repeat units, wherein the number of PEG repeat units is 3. In other embodiments, the linker comprises PEG repeat units, wherein the number of PEG repeat units is 4. In other embodiments, the linker comprises PEG repeat units, wherein the number of PEG repeat units is 5.
[0384] In some embodiments, the TLR 7 / 8 modulating molecules disclosed herein comprise a linker that connects the TLR 7 / 8 modulating portion of the molecule to a terminal hydrophobic moiety, wherein the linker does not comprise PEG.
[0385] In various embodiments, the TLR 7 / 8 modulating molecules disclosed herein comprise a linker that connects the TLR 7 / 8 modulating portion of the molecule to a terminal hydrophobic moiety, wherein the linker comprises an alkyl group. For example, in some embodiments the linker comprises an alkyl group that contains 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 carbons. In a particular embodiment, the linker comprises an alkyl group that contains 2 carbons. In another particular embodiment, the linker comprises an alkyl group that contains 3 carbons. In another particular embodiment, the linker comprises an alkyl group that contains 4 carbons. In some embodiments, the TLR 7 / 8 modulating molecules disclosed herein comprise a linker that connects the TLR 7 / 8 modulating portion of the molecule to a terminal hydrophobic moiety, wherein the linker comprises a cyclic amine. In some embodiments, the TLR 7 / 8 modulating molecules disclosed herein comprise a linker that connects the TLR 7 / 8 modulating portion of the molecule to a terminal hydrophobic moiety, wherein the linker comprises a derivative of an amino acid.
[0386] SAPONINS
[0387] In some embodiments, the LNPs disclosed herein comprise a saponin. For the present embodiments, a suitable saponin is Quil A, its derivatives thereof, or any purified component thereof (for example, QS-7, QS-18, QS-21, or a mixture thereof). Quil A is a saponin preparation isolated from the South American tree Quillaja Saponaria Molina and was first found to have adjuvant activity. (See Dalsgaard et al., 1974, Archiv. fur die gesanite Virusforschung, 44: 243-254). Purified fragments of Quil A have been isolated by HPLC ( See EP Patent No. 0362279), including, for example, QS-7 and QS-21 (also known as QA7 and QA21, respectively). QS-21 is the 21st fraction purified from the sap of Quillaja Saponaria tree (See Qi et al. A Two-Step Orthogonal Chromatographic Process for Purifying the Molecular Adjuvant QS-21 with High Purity and Yield. J Chromatogr A. 2021 Jan 4; 1635:461705). QS-21 has been shown to induce CD8+ cytotoxic T cells (CTLs), Th1 cells, and a predominant IgG2a antibody response (See Wong et al:, TCR Vaccines Against T Cell Lymphoma: QS-21 and IL-12 Adjuvants Induce a Protective CD8+ T Cell Response!. J Immunol 15 February 1999; 162 (4): 2251–2258). In some embodiments, a composition comprising LNPs is provided, wherein the LNPs comprise a saponin, and wherein the concentration of the saponin in the composition (total weight per ml of the composition) is less than about 1 mg / ml. In some embodiments, a composition comprising LNPs is provided, wherein the LNPs comprise a saponin, and wherein the concentration of the saponin in the composition is about 0.9 mg / ml, about 0.8 mg / ml, about 0.7 mg / ml, about 0.6 mg / ml, about 0.5 mg / ml, about 0.4 mg / ml, about 0.3 mg / ml, about 0.2 mg / ml, or about 0.1 mg / ml. In some embodiments, a composition comprising LNPs is provided, wherein the LNPs comprise a saponin, and wherein the concentration of the saponin in the composition is between about 0.001 mg / mL and about 0.1 mg / mL. In some embodiments, a composition comprising LNPs is provided, wherein the LNPs comprise a saponin, and wherein the concentration of the saponin in the composition is about 0.09 mg / ml, about 0.08 mg / ml, about 0.07 mg / ml, about 0.06 mg / ml, about 0.05 mg / ml, about 0.04 mg / ml, about 0.03 mg / ml, about 0.02 mg / ml, or about 0.01 mg / ml.
[0388] In a preferred embodiment, a composition comprising LNPs is provided, wherein the LNPs comprise a saponin, and wherein the concentration of the saponin in the composition is about 0.009 mg / mL. In another preferred embodiment, a composition comprising LNPs is provided, wherein the LNPs comprise a saponin, and wherein the concentration of the saponin in the composition is about 0.023 mg / mL. In another preferred embodiment, a composition comprising LNPs is provided, wherein the LNPs comprise a saponin, and wherein the concentration of the saponin in the composition is about 0.045 mg / mL. In yet another preferred embodiment, a composition comprising LNPs is provided, wherein the LNPs comprise a saponin, and wherein the concentration of the saponin in the composition is about 0.1 mg / mL.
[0389] In some embodiments, a composition comprising LNPs is provided, wherein the LNPs comprise QS-21, and wherein the concentration of the QS-21 in the composition (total weight per ml of the composition) is less than about 1 mg / ml. In some embodiments, a composition comprising LNPs is provided, wherein the LNPs comprise QS-21, and wherein the concentration of the QS-21 in the composition is about 0.9 mg / ml, about 0.8 mg / ml, about 0.7 mg / ml, about 0.6 mg / ml, about 0.5 mg / ml, about 0.4 mg / ml, about 0.3 mg / ml, about 0.2 mg / ml, or about 0.1 mg / ml. In some embodiments, a composition comprising LNPs is provided, wherein the LNPs comprise QS-21, and wherein the concentration of the QS-21 in the composition is between about 0.001 mg / mL and about 0.1 mg / mL. In some embodiments, a composition comprising LNPs is provided, wherein the LNPs comprise QS-21, and wherein the concentration of the QS-21 in the composition is about 0.09 mg / ml, about 0.08 mg / ml, about 0.07 mg / ml, about 0.06 mg / ml, about 0.05 mg / ml, about 0.04 mg / ml, about 0.03 mg / ml, about 0.02 mg / ml, or about 0.01 mg / ml. In a preferred embodiment, a composition comprising LNPs is provided, wherein the LNPs comprise QS-21, and wherein the concentration of the QS-21 in the composition is about 0.009 mg / mL. In another preferred embodiment, a composition comprising LNPs is provided, wherein the LNPs comprise QS-21, and wherein the concentration of the QS-21 in the composition is about 0.023 mg / mL. In another preferred embodiment, a composition comprising LNPs is provided, wherein the LNPs comprise QS-21, and wherein the concentration of the saponin in the composition is about 0.045 mg / mL. In yet another preferred embodiment, a composition comprising LNPs is provided, wherein the LNPs comprise QS-21, and wherein the concentration of the QS-21 in the composition is about 0.1 mg / mL.
[0390] LNP Components
[0391] In an embodiment, a mRNA vaccine comprises a LNP formulation comprising lipids and mRNA (RNA-LNPs). The lipids encapsulate the mRNA in the form of a lipid nanoparticle (LNP) to aid cell entry and stability of the RNA-LNPs.
[0392] Lipid nanoparticles may include a lipid component and one or more additional components, such as a therapeutic and / or prophylactic. A LNP may be designed for one or more specific applications or targets. The elements of a LNP may be selected based on a particular application or target, and / or based on the efficacy, toxicity, expense, ease of use, availability, or other feature of one or more elements. Similarly, the particular formulation of a LNP may be selected for a particular application or target according to, for example, the efficacy and toxicity of particular combinations of elements. The efficacy and tolerability of a LNP formulation may be affected by the stability of the formulation.
[0393] Lipid nanoparticles may be designed for one or more specific applications or targets. For example, a LNP may be designed to deliver a therapeutic and / or prophylactic such as an RNA to a particular cell, tissue, organ, or system or group thereof in a mammal's body. The LNP delivery system may have adjuvant effects which enhance the immunogenicity of an encoded antigen and / or other antigens in the composition.
[0394] Physiochemical properties of lipid nanoparticles may be altered to increase selectivity for particular bodily targets. For instance, particle sizes may be adjusted based on the fenestration sizes of different organs. The therapeutic and / or prophylactic included in a LNP may also be selected based on the desired delivery target or targets. For example, a therapeutic and / or prophylactic may be selected for a particular indication, condition, disease, or disorder and / or for delivery to a particular cell, tissue, organ, or system or group thereof (e.g., localized or specific delivery). In certain embodiments, a LNP may include an mRNA encoding a polypeptide of interest capable of being translated within a cell to produce the polypeptide of interest. Such a composition may be designed to be specifically delivered to a particular organ. In some embodiments, a composition may be designed to be specifically delivered to a mammalian liver. In some embodiments, a composition may be designed to be specifically delivered to a lymph node. In some embodiments, a composition may be designed to be specifically delivered to a mammalian spleen.
[0395] Lipid nanoparticles may include a lipid component and one or more additional components, such as a therapeutic and / or prophylactic, such as a nucleic acid. A LNP may be designed for one or more specific applications or targets. The elements of a LNP may be selected based on a particular application or target, and / or based on the efficacy, toxicity, expense, ease of use, availability, or other feature of one or more elements. Similarly, the particular formulation of a LNP may be selected for a particular application or target according to, for example, the efficacy and toxicity of particular combination of elements. The efficacy and tolerability of a LNP formulation may be affected by the stability of the formulation.
[0396] In some embodiments, for example, a polymer may be included in and / or used to encapsulate or partially encapsulate or be conjugated to a lipid (polymer-conjugated lipid or polymer lipid) in a LNP. A polymer may be biodegradable and / or biocompatible. A polymer may be selected from, but is not limited to, polyamines, polyethers, polyamides, polyesters, poly carbamates, polyureas, polycarbonates, polystyrenes, polyimides, polysulfones, polyurethanes, polyacetylenes, polyethylenes, polyethyleneimines, polyisocyanates, polyacrylates, polymethacrylates, polyacrylonitriles, and polyarylates. For example, a polymer may include poly(caprolactone) (PCL), ethylene vinyl acetate polymer (EVA), poly(lactic acid) (PLA), poly(L-lactic acid) (PLLA), poly(gly colic acid) (PGA), poly(lactic acid-co-gly colic acid) (PLGA), poly(L-lactic acid-co-gly colic acid) (PLLGA), poly(D. L-lactide) (PDLA), poly(L- lactide) (PLLA), poly(D, L-lactide-co-caprolactone), poly(D, L-lactide-co-caprolactone-co- glycolide), poly(D, L-lactide-co-PEO-co-D, L-lactide), poly(D, L-lactide-co-PPO-co-D, L-lactide), polyalkyl cyanoacrylate, polyurethane, poly-L-lysine (PLL), hydroxypropyl methacrylate (HPMA), polyethyleneglycol, poly-L-glutamic acid, poly(hydroxy acids), polyanhydrides, polyorthoesters, poly(ester amides), polyamides, poly(ester ethers), polycarbonates, polyalkylenes such as polyethylene and polypropylene, polyalkylene glycols such as poly(ethylene glycol) (PEG), polyalkylene oxides (PEG), polyalkylene terephthalates such as poly(ethylene terephthalate), polyvinyl alcohols (P A), polyvinyl ethers, polyvinyl esters such as poly(vinyl acetate), polyvinyl halides such as poly(vinyl chloride) (PVC), polyvinylpyrrolidone (PVP), polysiloxanes, polystyrene, polyurethanes, derivatized celluloses such as alkyl celluloses, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, nitro celluloses, hydroxypropylcellulose, carboxymethylcellulose, polymers of acrylic acids, such as poly(methyl(meth)acrylate) (PMMA), poly(ethyl(meth)acrylate), poly(butyl(meth)acrylate), poly(isobutyl(meth)acrylate), poly(hexyl(meth)acrylate), poly(isodecyl(meth)acrylate), poly(lauryl(meth)acrylate), poly(phenyl(meth)acrylate), poly(methyl acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate), poly(octadecyl acrylate) and copolymers and mixtures thereof, polydioxanone and its copolymers, polyhydroxyalkanoates, polypropylene fumarate, polyoxymethylene, poloxamers, poloxamines, poly(ortho)esters, poly(butyric acid), poly(valeric acid), poly(lactide-co-caprolactone), trimethylene carbonate, poly(N-acryloylmorpholine) (PAcM), poly(2-methyl-2-oxazoline) (PMOX), poly(2-ethyl-2-oxazoline) (PEOZ), poly(2-oxazoline)(POZ), which is a synthetic, water-soluble, and low-viscosity polymer, and polyglycerol.
[0397] In some embodiments, the amount of polymer-lipid in the lipid composition of a pharmaceutical composition disclosed herein ranges from about 0.1 mol % to about 5 mol %, from about 0.5 mol % to about 5 mol %, from about 1 mol % to about 5 mol %, from about 1.5 mol % to about 5 mol %, from about 2 mol % to about 5 mol %, from about 0.1 mol % to about 4 mol %, from about 0.5 mol % to about 4 mol %, from about 1 mol % to about 4 mol %, from about 1.5 mol % to about 4 mol %, from about 2 mol % to about 4 mol %, from about 0.1 mol % to about 3 mol %, from about 0.5 mol % to about 3 mol %, from about 1 mol % to about 3 mol %, from about 1.5 mol % to about 3 mol %, from about 2 mol % to about 3 mol %, from about 0.1 mol % to about 2 mol %, from about 0.5 mol % to about 2 mol %, from about 1 mol % to about 2 mol %, from about 1.5 mol % to about 2 mol %, from about 0.1 mol % to about 1.5 mol %, from about 0.5 mol % to about 1.5 mol %, or from about 1 mol % to about 1.5 mol %.
[0398] In some embodiments, the amount of polymer-lipid in the lipid composition disclosed herein is about 2 mol %. In some embodiments, the amount of polymer-lipid in the lipid composition disclosed herein is about 1.5 mol %. In some embodiments, the amount of polymer-lipid in the lipid composition disclosed herein is at least about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, or 5 mol %. In a preferred embodiment, the amount of polymer-lipid (or polymer-conjugated lipid) in the lipid composition is 1.8 mol %.
[0399] Surface altering agents may include, but are not limited to, anionic proteins (e.g., bovine serum albumin), surfactants (e.g., cationic surfactants such as dimethyldioctadecyl- ammonium bromide), sugars or sugar derivatives (e.g., cyclodextrin), nucleic acids, polymers (e.g., heparin, polyethylene glycol, and poloxamer), mucolytic agents (e.g., acetylcysteine, mugwort, bromelain, papain, clerodendrum, bromhexine, carbocisteine, eprazinone, mesna, ambroxol, sobrerol, domiodol, letosteine, stepronin, tiopronin, gelsolin, thymosin (34, dornase alfa, neltenexine, and erdosteine), and DNases (e.g., rhDNase). A surface altering agent may be disposed within a nanoparticle and / or on the surface of a LNP (e.g., by coating, adsorption, covalent linkage, or other process). A LNP may also comprise one or more functionalized lipids. For example, a lipid may be functionalized with an alkyne group that, when exposed to an azide under appropriate reaction conditions, may undergo a cycloaddition reaction. In particular, a lipid bilayer may be functionalized in this fashion with one or more groups useful in facilitating membrane permeation, cellular recognition, or imaging. The surface of a LNP may also be conjugated with one or more useful antibodies. Functional groups and conjugates useful in targeted cell delivery, imaging, and membrane permeation are well known in the art.
[0400] In addition to these components, lipid nanoparticles may include any substance useful in pharmaceutical compositions. For example, the lipid nanoparticle may include one or more pharmaceutically acceptable excipients or accessory ingredients such as, but not limited to, one or more solvents, dispersion media, diluents, dispersion aids, suspension aids, surface active agents, buffering agents, preservatives, and other species.
[0401] Surface active agents and / or emulsifiers may include, but are not limited to, natural emulsifiers (e.g., acacia, alginic acid, sodium alginate, cholesterol, and lecithin), sorbitan fatty acid esters (e.g., polyoxy ethylene sorbitan monolaurate [TWEEN®20], polyoxy ethylene sorbitan [TWEEN® 60], polyoxy ethylene sorbitan monooleate [TWEEN®80], sorbitan monopalmitate [SPAN®40], sorbitan monostearate [SPAN®60], sorbitan tristearate [SPAN®65], glyceryl monooleate, sorbitan monooleate [SPAN®80]), polyoxyethylene esters (e.g., polyoxyethylene monostearate [MYRJ® 45], polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and SOLUTOL®), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g., CREMOPHOR®), polyoxyethylene ethers, (e.g., polyoxyethylene lauryl ether [BRIJ® 30]), poly(vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, PLURONIC®F 68, POLOXAMER® 188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, and / or combinations thereof.
[0402] Examples of preservatives may include, but are not limited to, antioxidants, chelating agents, free radical scavengers, antimicrobial preservatives, antifungal preservatives, alcohol preservatives, acidic preservatives, and / or other preservatives. Examples of antioxidants include, but are not limited to, alpha tocopherol, ascorbic acid, ascorbyl palmitate, butylated hydroxyanisole, butylated hydroxy toluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and / or sodium sulfite. Examples of chelating agents include ethylenediaminetetraacetic acid (EDTA), citric acid monohydrate, disodium edetate, dipotassium edetate, edetic acid, fumaric acid, malic acid, phosphoric acid, sodium edetate, tartaric acid, and / or trisodium edetate. Examples of antimicrobial preservatives include, but are not limited to, benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and / or thimerosal. Examples of antifungal preservatives include, but are not limited to, butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and / or sorbic acid.
[0403] Examples of alcohol preservatives include, but are not limited to, ethanol, polyethylene glycol, benzyl alcohol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and / or phenylethyl alcohol. Examples of acidic preservatives include, but are not limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroascorbic acid, ascorbic acid, sorbic acid, and / or phytic acid. Other preservatives include, but are not limited to, tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisole (BHA), butylated hydroxy toluene (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, GLYDANT PLUS®, PHENONIP®, methylparaben, GERMALL® 115, GERMABEN®II, NEOLONE™, KATHON™, and / or EUXYL®. An exemplary free radical scavenger includes butylated hydroxytoluene (BHT or butylhydroxytoluene) or deferoxamine.
[0404] Examples of buffering agents include, but are not limited to, citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, d-gluconic acid, calcium glycerophosphate, calcium lactate, calcium lactobionate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, amino-sulfonate buffers (e.g., HEPES), magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl alcohol, Tris buffer, and / or combinations thereof.
[0405] In some embodiments, the formulation including a LNP may further include a salt, such as a chloride salt. In some embodiments, the formulation including a LNP may further includes a sugar such as a disaccharide. In some embodiments, the formulation further includes a sugar but not a salt, such as a chloride salt. In some embodiments, a LNP may further include one or more small hydrophobic molecules such as a vitamin (e.g., vitamin A or vitamin E) or a sterol. Carbohydrates may include simple sugars (e.g., glucose) and polysaccharides (e.g., glycogen and derivatives and analogs thereof). The characteristics of a LN P may depend on the components thereof. For example, a LNP including cholesterol as a structural lipid may have different characteristics than a LNP that includes a different structural lipid. As used herein, the term “structural lipid” refers to sterols and also to lipids containing sterol moieties. As defined herein, “sterols” are a subgroup of steroids consisting of steroid alcohols. In some embodiments, the structural lipid is a steroid. In some embodiments, the structural lipid is cholesterol. In some embodiments, the structural lipid is an analog of cholesterol.
[0406] The lipid nanoparticle compositions may include a mixture of structural lipids.
[0407] Incorporation of structural lipids in the lipid nanoparticle may help mitigate aggregation of other lipids in the particle. Structural lipids can be selected from the group including but not limited to, cholesterol and cholesterol analogs such as fecosterol, sitosterol, p-sitosterol, ergosterol, campesterol, stigmasterol, brassicasterol, tomatidine, tomatine, ursolic acid, alpha-tocopherol, hopanoids, sitostanol, phytosterols, steroids, and mixtures thereof. In some embodiments, the structural lipid is a sterol. In some embodiments, the structural lipid is a steroid. In some embodiments, the structural lipid is cholesterol. In certain embodiments, the structural lipid is an analog of cholesterol. In some preferred embodiments, the sterol comprises
[0408]
[0409] In some preferred embodiments, the sterol comprises
[0410]
[0411] In some preferred embodiments, the sterol comprises stigmasterol.
[0412] In some preferred embodiments, the sterol comprises p-sitosterol
[0413]
[0414] In some embodiments, the structural lipid is a sitosterol, a stigmasterol, a campesterol, a sitostanol, a campestanol, a brassicasterol, a fucosterol, beta-sitosterol, stigmastanol, beta-sitostanol, ergosterol, lupeol, cycloartenol, A5-avenasterol, A7-avenasterol or a A7-stigmasterol, including analogs, salts or esters thereof, alone or in combination. In some embodiments, the sterol component of a LNP of the disclosure is a single phytosterol. In some embodiments, the phytosterol component of a LNP of the disclosure is a mixture of different phytosterols (e.g. 2, 3, 4, 5 or 6 different phytosterols). In some embodiments, the phytosterol component of an LNP of the disclosure is a blend of one or more phytosterols and one or more zoosterols, such as a blend of a phytosterol (e.g., a sitosterol, such as beta-sitosterol) and cholesterol. In some embodiments, the phytosterol is p-sitosterol, campesterol, sigmastanol, or any combination thereof. In some embodiments, the phytosterol is p-sitosterol. In some embodiments, the cholesterol analog comprises p-sitosterol, campesterol, and stigmasterol. In some embodiments, an LNP disclosed herein comprises 1, 2, 3, or more structural lipids.
[0415] In some embodiments, an LNP formulation disclosed herein comprises cholesterol and P-sitosterol. In some embodiments, an LNP formulation disclosed herein comprises cholesterol and p-sitosterol, wherein the ratio of cholesterol to p-sitosterol is between about 6:1 and about 1:6. In some embodiments, an LNP formulation disclosed herein comprises cholesterol and p-sitosterol, wherein the ratio of cholesterol to p-sitosterol is between about 6:1 and about 1:1. In some embodiments, an LNP formulation disclosed herein comprises cholesterol and p-sitosterol, wherein the ratio of cholesterol to p-sitosterol is about 6:5, about 6:4, about 6:3, about 6:2, or about 6:1.
[0416] In some embodiments, an LNP formulation disclosed herein comprises cholesterol and P-sitosterol. In some embodiments, an LNP formulation disclosed herein comprises cholesterol and p-sitosterol, wherein the ratio of cholesterol to p-sitosterol is between about 1:9 and about 9:1. In some embodiments, an LNP formulation disclosed herein comprises cholesterol and p-sitosterol, wherein the ratio of cholesterol to p-sitosterol is about 1:9, about 2:8, about 8:2, or about 9:1.
[0417] In a preferred embodiment, an LNP formulation disclosed herein comprises cholesterol and p-sitosterol, wherein the ratio of cholesterol to p-sitosterol is about 6:4. In another preferred embodiment, an LNP formulation disclosed herein comprises cholesterol and p-sitosterol, wherein the ratio of cholesterol to p-sitosterol is about 4:6.
[0418] In some embodiments, an LNP formulation disclosed herein comprises p-sitosterol, stigmasterol, and campesterol. In some embodiments, an LNP formulation disclosed herein comprises structural lipids p-sitosterol, stigmasterol, and campesterol, wherein the mixture of structural lipids comprises about 35% to about 85% of p-sitosterol, about 5% to about 35% stigmasterol, and about 5% to about 35% of campesterol. In some embodiments, an LNP formulation disclosed herein comprises structural lipids p-sitosterol, stigmasterol, and campesterol, wherein the mixture of structural lipids comprises about 35% to about 45% of p-sitosterol, about 20% to about 30% stigmasterol, and about 20% to about 30% of campesterol. In some embodiments, an LNP formulation disclosed herein comprises structural lipids p-sitosterol, stigmasterol, and campesterol, wherein the mixture of structural lipids comprises about 65% to about 75% of p-sitosterol, about 5% to about 15% stigmasterol, and about 5% to about 15% of campesterol.
[0419] In some embodiments, an LNP formulation disclosed herein comprises structural lipids P-sitosterol and stigmasterol, wherein the mixture of structural lipids comprises about 35% to about 85% of p-sitosterol and about 5% to about 35% stigmasterol. In some embodiments, an LNP formulation disclosed herein comprises structural lipids p-sitosterol and stigmasterol, wherein the mixture of structural lipids comprises about 35% to about 45% of p-sitosterol, and about 20% to about 30% stigmasterol.
[0420] In some embodiments, an LNP formulation disclosed herein comprises cholesterol, p-sitosterol, and stigmasterol, wherein the mixture of structural lipids comprises about 10% to about 30% of cholesterol, about 10% to about 30% p-sitosterol, and about 10% to about 30% stigmasterol. In some embodiments, an LNP formulation disclosed herein comprises about 30-50% cationic lipid and about 5-25% phospholipid.
[0421] In some embodiments, the mol% of structural lipids out of total lipids in an LNP formulation disclosed herein is between about 30 mol% and about 60 mol%. In some embodiments, the mol% of structural lipids out of total lipids in an LNP formulation disclosed herein is between about 40 mol% and about 60 mol%. In some embodiments, the mol% of structural lipids out of total lipids in an LNP formulation disclosed herein is between about 30 mol% and about 50 mol%. In some embodiments, the mol% of structural lipids out of total lipids in an LNP formulation disclosed herein is between about 40 mol% and about 50 mol%. In some embodiments, the mol% of structural lipids out of total lipids in an LNP formulation disclosed herein is about 35 mol%, about 36 mol%, about 37 mol%, about 38 mol%, about 39 mol%, about 40 mol%, about 41 mol%, about 42 mol%, about 43 mol%, about 44 mol%, or about 45 mol%. In a preferred embodiment, the mol% of structural lipids out of total lipids in an LNP formulation disclosed herein is between about 40 mol% and about 41 mol%. In a preferred embodiment, the mol% of structural lipids out of total lipids in an LNP formulation disclosed herein is about 40.7 mol%.
[0422] In another preferred embodiment, an LNP formulation disclosed herein comprises cholesterol and p-sitosterol, and the mol% of cholesterol and p-sitosterol out of total lipids in the LNP formulation is between about 40 mol% and about 41 mol%. In another preferred embodiment, an LNP formulation disclosed herein comprises cholesterol and p-sitosterol, and the mol% of cholesterol and p-sitosterol out of total lipids in the LNP formulation is about 40.7 mol%
[0423] In some embodiments, the characteristics of a LNP may depend on the absolute or relative amounts of its components. For instance, a LNP including a higher molar fraction of a phospholipid may have different characteristics than a LNP including a lower molar fraction of a phospholipid. Characteristics may also vary depending on the method and conditions of preparation of the lipid nanoparticle. In general, phospholipids comprise a phospholipid moiety and one or more fatty acid moieties. A phospholipid moiety can be selected, for example, from the non-limiting group consisting of phosphatidyl choline, phosphatidyl ethanolamine, phosphatidyl glycerol, phosphatidyl serine, phosphatidic acid, and 2-lysophosphatidyl choline.
[0424] Further examples of a phospholipid moiety for the lipid nanoparticle include a lipid that is selected from the group consisting of distearoyl-sn-glycero-phosphoethanolamine, distearoylphosphatidylcholine (DSPC), dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC), dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG), dioleoyl-phosphatidylethanolamine (DOPE), palmitoyloleoylphosphatidylcholine (POPC), palmitoyloleoylphosphatidylethanolamine (POPE), dioleoyl-phosphatidylethanolamine 4-(N-maleimidomethyl)-cyclohexane- 1- carboxylate (DOPE-mal), dipalmitoyl phosphatidyl ethanolamine (DPPE), dimyristoylphosphoethanolamine (DMPE), distearoyl-phosphatidyl-ethanolamine (DSPE), monomethyl-phosphatidylethanolamine (such as 16-O-monomethyl PE), dimethyl- phosphatidylethanolamine (such as 16-O-dimethyl PE), 18-1-trans PE, l-stearoyl-2-oleoyl- phosphatidyethanolamine (SOPE), hydrogenated soy phosphatidylcholine (HSPC), egg phosphatidylcholine (EPC), dioleoylphosphatidyl serine (DOPS), sphingomyelin (SM), dimyristoyl phosphatidylcholine (DMPC), dimyristoyl phosphatidylglycerol (DMPG), distearoylphosphatidylglycerol (DSPG), diemcoylphosphatidylcholine (DEPC), palmitoyloleyolphosphatidylglycerol (POPG), dielaidoylphosphatidylethanolamine (DEPE), l,2-dilauroyl-sn-glycero-3 -pho sphoethanolamine (DLPE); l,2-diphytanoyl-sn-glycero-3- phosphoethanolamine (DPHyPE); lecithin, phosphatidylethanolamine, lysolecithin, lysophosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, cephalin, cardiolipin, phosphatidicacid, cerebrosides, dicetylphosphate, lysophosphatidylcholine, dilinoleoylphosphatidylcholine, and mixtures thereof.
[0425] A fatty acid moiety can be selected, for example, from the non-limiting group consisting of lauric acid, myristic acid, myristoleic acid, palmitic acid, palmitoleic acid, stearic acid, oleic acid, linoleic acid, alpha-linolenic acid, erucic acid, phytanoic acid, arachidic acid, arachidonic acid, eicosapentaenoic acid, behenic acid, docosapentaenoic acid, and docosahexaenoic acid. Particular phospholipids can facilitate fusion to a membrane. In some embodiments, a cationic phospholipid can interact with one or more negatively charged phospholipids of a membrane (e.g., a cellular or intracellular membrane). Fusion of a phospholipid to a membrane can allow one or more elements (e.g., a therapeutic agent) of a lipid-containing composition (e.g., LNPs) to pass through the membrane permitting, e.g., delivery of the one or more elements to a target tissue. Non-natural phospholipid species including natural species with modifications and substitutions including branching, oxidation, cyclization, and alkynes are also contemplated. In some embodiments, a phospholipid can be functionalized with or cross-linked to one or more alkynes (e.g., an alkenyl group in which one or more double bonds is replaced with a triple bond). Under appropriate reaction conditions, an alkyne group can undergo a copper-catalyzed cycloaddition upon exposure to an azide. Such reactions can be useful in functionalizing a lipid bilayer of a nanoparticle composition to facilitate membrane permeation or cellular recognition or in conjugating a nanoparticle composition to a useful component such as a targeting or imaging moiety (e.g., a dye). Phospholipids include, but are not limited to, glycerophospholipids such as phosphatidylcholines, phosphatidyl-ethanolamines, phosphatidylserines, phosphatidylinositols, phosphatidy glycerols, and phosphatidic acids. In some embodiments, a phospholipid useful or potentially useful in the present invention is an analog or variant of DSPC.
[0426] Lipid nanoparticles may be characterized by a variety of methods. For example, microscopy (e.g., transmission electron microscopy or scanning electron microscopy) may be used to examine the morphology and size distribution of a LNP. Dynamic light scattering or potentiometry (e.g., potentiometric titrations) may be used to measure zeta potentials. Dynamic light scattering may also be utilized to determine particle sizes. Instruments such as the Zetasizer Nano ZS (Malvern Instruments Ltd, Malvern, Worcestershire, UK) may also be used to measure multiple characteristics of a LNP, such as particle size, polydispersity index, and zeta potential.
[0427] The term “mean diameter” refers to the mean hydrodynamic diameter of particles as measured by dynamic laser light scattering (DLS) with data analysis using the so-called cumulant algorithm, which provides as results the so-called Z-average with the dimension of a length, and the polydispersity index (PDI), which is dimensionless (Koppel, D., J. Chem. Phys. 57, 1972, pp 4814-4820, ISO 13321). Here, “mean diameter,” “diameter,” “size” or “mean size” for particles is used synonymously with this value of the Z-average. In some aspects, an LNP formulation disclosed herein comprises LNPs having a mean diameter between about 1 and about 500 nm. In some aspects, an LNP formulation disclosed herein comprises LNPs having a mean diameter between about 30 nm and about 150 nm, between about 40 nm and about 150 nm, between about 50 nm and about 150 nm, between about 60 nm and about 130 nm, between about 70 nm and about 110 nm, between about 70 nm and about 100 nm, between about 80 nm and about 100 nm, between about 90 nm and about 100 nm, between about 70 and about 90 nm, between about 80 nm and about 90 nm, between about 70 nm and about 80 nm, between about 60 nm and about 70 nm, or at least, at most, exactly, or between any two of 30 nm, 35 nm, 40 nm, 45 nm, 50 nm, 55 nm, 60 nm, 65 nm, 70 nm, 75 nm, 80 nm, 85 nm, 90 nm, 95 nm, 100 nm, 105 nm, 110 nm, 115 nm, 120 nm, 125 nm, 130 nm, 135 nm, 140 nm, 145 nm, or 150 nm. In a particular embodiment, an LNP formulation disclosed herein comprises LNPs having a mean diameter between about 60 nm and about 140 nm.
[0428] In some embodiments, an LNP formulation is provided herein wherein the LNPs comprise a TLR 7 / 8 modulating molecule, and the average size of the LNPs in the formulation is within 20%, 15%, 10%, 5%, 4%, 3%, 2%, or 1% of the average size of LNPs in a formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule. In a preferred embodiment, an LNP formulation is provided herein wherein the LNPs comprise a TLR 7 / 8 modulating molecule and the average size of the LNPs in the formulation is within 10% of the average size of LNPs in a formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule. In another preferred embodiment, an LNP formulation is provided herein wherein the LNPs comprise a TLR 7 / 8 modulating molecule and the average size of the LNPs in the formulation is within 5% of the average size of LNPs in a formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule.
[0429] An LNP formulation disclosed herein may be relatively homogenous. A polydispersity index (PDI) may be used to indicate the homogeneity of an LNP formulation, e.g., the particle size distribution of the lipid nanoparticles. The PDI is, in some aspects, calculated based on dynamic light scattering measurements by the so-called cumulant analysis as mentioned in the definition of the “average diameter.” Under certain prerequisites, it may be taken as a measure of the size distribution of an ensemble of nanoparticles. A small (e.g., less than 0.3) PDI generally indicates a narrow particle size distribution. An LNP formulation disclosed herein may have a PDI from about 0 to about 0.25, such as 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.10, 0.11, 0.12, 0.13, 0.14, 0.15, 0.16, 0.17, 0.18, 0.19, 0.20, 0.21, 0.22, 0.23, 0.24, or 0.25. An LNP formulation disclosed herein may exhibit a PDI from about 0.10 to about 0.20. An LNP formulation disclosed herein may exhibit a PDI less than about 0.5, less than about 0.4, less than about 0.3, less than about 0.2, or less than about 0.1.
[0430] In a preferred embodiment, an LNP formulation disclosed herein has a PDI less than about 0.2. In another preferred embodiment, an LNP formulation disclosed herein has a PDI between about 0.05 and about 0.2.
[0431] In some embodiments, in an LNP formulation wherein the LNPs comprise a TLR 7 / 8 modulating molecule, the PDI of the LNPs in the formulation is within 20%, 15%, 10%, 5%, 4%, 3%, 2%, or 1% of the PDI of LNPs in a formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule. In a preferred embodiment, in an LNP formulation wherein the LNPs comprise a TLR 7 / 8 modulating molecule, the PDI of the LNPs in the formulation is within 10% of the PDI of LNPs in a formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule. In another preferred embodiment, in an LNP formulation wherein the LNPs comprise a TLR 7 / 8 modulating molecule, the PDI of the LNPs in the formulation is within 5% of the PDI of LNPs in a formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule.
[0432] The zeta potential of a LNP may be used to indicate the electrokinetic potential of the composition. For example, the zeta potential may describe the surface charge of an LNP. Lipid nanoparticles with relatively low charges, positive or negative, are generally desirable, as more highly charged species may interact undesirably with cells, tissues, and other elements in the body. In some embodiments, the zeta potential of a LNP may be from about -10 mV to about +20 mV, from about -10 mV to about +15 mV, from about -10 mV to about +10 mV, from about -10 mV to about +5 mV, from about -10 mV to about 0 mV, from about -10 mV to about - 5 mV, from about -5 mV to about +20 mV, from about -5 mV to about +15 mV, from about -5 mV to about +10 mV, from about -5 mV to about +5 mV, from about -5 mV to about 0 mV, from about 0 mV to about +20 mV, from about 0 mV to about +15 mV, from about 0 mV to about +10 mV, from about 0 mV to about +5 mV, from about +5 mV to about +20 mV, from about +5 mV to about +15 mV, or from about +5 mV to about + 10 m V.
[0433] A LNP may optionally comprise one or more coatings. For example, a LNP may be formulated in a capsule, film, or tablet having a coating. A capsule, film, or tablet including a composition described herein may have any useful size, tensile strength, hardness, or density.
[0434] Formulations comprising amphiphilic polymers and lipid nanoparticles may be formulated in whole or in part as pharmaceutical compositions. Pharmaceutical compositions may include one or more amphiphilic polymers and one or more lipid nanoparticles. For example, a pharmaceutical composition may include one or more amphiphilic polymers and one or more lipid nanoparticles including one or more different therapeutics and / or prophylactics. Pharmaceutical compositions may further include one or more pharmaceutically acceptable excipients or accessory ingredients such as those described herein. General guidelines for the formulation and manufacture of pharmaceutical compositions and agents are available, for example, in Remington's The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro; Lippincott, Williams & Wilkins, Baltimore, MD, 2006. Conventional excipients and accessory ingredients may be used in any pharmaceutical composition, except insofar as any conventional excipient or accessory ingredient may be incompatible with one or more components of a LN P or the one or more amphiphilic polymers in the formulation of the disclosure. An excipient or accessory ingredient may be incompatible with a component of a LNP or the amphiphilic polymer of the formulation if its combination with the component or amphiphilic polymer may result in any undesirable biological effect or otherwise deleterious effect.
[0435] In some embodiments, one or more excipients or accessory ingredients may make up greater than 50% of the total mass or volume of a pharmaceutical composition including a LNP. For example, the one or more excipients or accessory ingredients may make up 50%, 60%, 70%, 80%, 90%, or more of a pharmaceutical convention. In some embodiments, a pharmaceutically acceptable excipient is at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% pure. In some embodiments, an excipient is approved for use in humans and for veterinary use. In some embodiments, an excipient is approved by United States Food and Drug Administration. In some embodiments, an excipient is pharmaceutical grade. In some embodiments, an excipient meets the standards of the United States Pharmacopoeia (USP), the European Pharmacopoeia (EP), the British Pharmacopoeia, and / or the International Pharmacopoeia. Relative amounts of the one or more amphiphilic polymers, the one or more lipid nanoparticles, the one or more pharmaceutically acceptable excipients, and / or any additional ingredients in a pharmaceutical composition in accordance with the present disclosure will vary, depending upon the identity, size, and / or condition of the subject treated and further depending upon the route by which the composition is to be administered. By way of example, a pharmaceutical composition may comprise between 0.1% and 100% (wt / wt) of one or more lipid nanoparticles. As another example, a pharmaceutical composition may comprise between 0.1% and 15% (wt / vol) of one or more amphiphilic polymers (e.g., 0.5%, 1%, 2.5%, 5%, 10%, or 12.5% w / v).
[0436] The chemical properties of the LNP, LNP suspension, lyophilized LNP composition, or LNP formulation of the present disclosure may be characterized by a variety of methods. In some embodiments, fragment analyzer, electrophoresis (e.g., capillary electrophoresis) or chromatography (e.g., reverse phase liquid chromatography) may be used to examine the mRNA integrity.
[0437] In certain embodiments, the lipid nanoparticles and / or pharmaceutical compositions of the disclosure are refrigerated or frozen for storage and / or shipment (e.g., being stored at a temperature of about 5 °C or lower, such as a temperature between about -150 °C and about 5 °C or between about -150 °C and about 0 °C or between about -80 °C and about -20 °C (e.g., about 5 °C, 0 °C, -5 °C, -10 °C, -15 °C, -20 °C, -25 °C, -30 °C, -40 °C, -50 °C, -60 °C, -70 °C, -80 °C, -90 °C, -130 °C or -150 °C). For example, the pharmaceutical composition comprising one or more amphiphilic polymers and one or more lipid nanoparticles is a solution or solid (e.g., via lyophilization) that is refrigerated for storage and / or shipment at, for example, about -20 °C, -30 °C, -40 °C, -50 °C, -60 °C, -70 °C, or -80 °C. In certain embodiments, the disclosure also relates to a method of increasing stability of the lipid nanoparticles by adding an effective amount of an amphiphilic polymer and by storing the lipid nanoparticles and / or pharmaceutical compositions thereof at a temperature of 4 °C or lower, such as a temperature between about -150 °C and about 0 °C or between about -80 °C and about -20 °C, e.g., about -5 °C, -10 °C, -15 °C, -20 °C, -25 °C, -30 °C, -40 °C, -50 °C, -60 °C, -70 °C, -80 °C, -90 °C, -130 °C or -150 °C).
[0438] RNA ENCAPSULATION
[0439] In one aspect RNA is encapsulated in an LNP disclosed herein to produce lipid nanoparticle (LNP)-encapsulated RNA (RNA-LNPs). Without intending to be bound by any theory, it is believed that the cationic or cationically ionizable lipid or lipid-like material and / or the cationic polymer combine together with the nucleic acid to form aggregates, and this aggregation results in colloidally stable particles.
[0440] A lipid may be a naturally occurring lipid or a synthetic lipid. However, a lipid is usually a biological substance. Biological lipids are well known in the art, and include for example, neutral fats, phospholipids, phosphoglycerides, steroids, terpenes, lysolipids, glycosphingolipids, glucolipids, sulphatides, lipids with ether and ester-linked fatty acids and polymerizable lipids, and combinations thereof. A lipid is a substance that is insoluble in water and extractable with an organic solvent. Compounds other than those specifically described herein are understood by one of skill in the art as lipids and are encompassed by the compositions and methods of the present disclosure. A lipid component and a non-lipid may be attached to one another, either covalently or non-covalently.
[0441] In some aspects, LNPs may be designed to protect RNA molecules (e.g., saRNA, mRNA) from extracellular Rnases and / or may be engineered for systemic delivery of the RNA to target cells. In some aspects, such LNPs may be particularly useful to deliver RNA molecules (e.g., saRNA, mRNA) when RNA molecules are intravenously administered to a subject in need thereof. In some aspects, such LNPs may be particularly useful to deliver RNA molecules (e.g., saRNA, mRNA) when RNA molecules are intramuscularly administered to a subject in need thereof. In some aspects, such LNPs may be particularly useful to deliver RNA molecules (e.g., saRNA, mRNA) when RNA molecules are intradermally administered to a subject in need thereof. In some aspects, such LNPs may be particularly useful to deliver RNA molecules (e.g., saRNA, mRNA) when RNA molecules are intranasally administered to a subject in need thereof.
[0442] The “efficiency of encapsulation” of a therapeutic and / or prophylactic (e.g., RNA or TLR 7 / 8 modulating compound) describes the amount of therapeutic and / or prophylactic (e.g., RNA or TLR 7 / 8 modulating compound) that is encapsulated or otherwise associated with an LNP after preparation, relative to the initial amount provided. The encapsulation efficiency is desirably high (e.g., close to 100%). The encapsulation efficiency may be measured, for example, by comparing the amount of therapeutic and / or prophylactic (e.g., RNA or TLR 7 / 8 modulating compound) in a solution containing the lipid nanoparticle before and after breaking up the lipid nanoparticle with one or more organic solvents or detergents. Fluorescence may be used to measure the amount of free therapeutic and / or prophylactic (e.g., RNA or TLR 7 / 8 modulating compound) in a solution. For example, if 97 mg of mRNA are encapsulated in a composition out of a total 100 mg of mRNA initially provided to the composition, the encapsulation efficiency may be given as 97%. For the lipid nanoparticle formulations described herein, the encapsulation efficiency of the RNA may be at least 50%, for example at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100%. In a preferred embodiment of the lipid nanoparticle formulations described herein, the encapsulation efficiency of the RNA is at least 60%. In another preferred embodiment of the lipid nanoparticle formulations described herein, the encapsulation efficiency of the RNA is at least 70%. In yet another preferred embodiment of the lipid nanoparticle formulations described herein, the encapsulation efficiency of the RNA is at least 80%.
[0443] For the lipid nanoparticle formulations described herein, the encapsulation efficiency of the TLR 7 / 8 modulating molecule may be at least 40%, for example at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100%. In a preferred embodiment of the lipid nanoparticle formulations described herein, the encapsulation efficiency of the TLR 7 / 8 modulating molecule is at least 50%. In another preferred embodiment of the lipid nanoparticle formulations described herein, the encapsulation efficiency of the TLR 7 / 8 modulating molecule is at least 60%. In yet another preferred embodiment of the lipid nanoparticle formulations described herein, the encapsulation efficiency of the TLR 7 / 8 modulating molecule is at least 70%.
[0444] In some embodiments, in an LNP formulation wherein the LNPs comprise a TLR 7 / 8 modulating molecule, the encapsulation efficiency of the RNA is within 20%, 15%, 10%, 5%, 4%, 3%, 2%, or 1% of the encapsulation efficiency of RNA within an LNP formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule. In a preferred embodiment, in an LNP formulation wherein the LNPs comprise a TLR 7 / 8 modulating molecule, the encapsulation efficiency of the RNA is within 10% of the encapsulation efficiency of RNA within an LNP formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule. In another preferred embodiment, in an LNP formulation wherein the LNPs comprise a TLR 7 / 8 modulating molecule, the encapsulation efficiency of the RNA is within 5% of the encapsulation efficiency of RNA within an LNP formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule.
[0445] In one aspect, a composition is provided herein wherein the composition comprises RNA-LNPs, and wherein the concentration of RNA in the composition is about 1 mg / mL, or more. For example, a composition is provided herein wherein the composition comprises RNA-LNPs, and wherein the concentration of RNA in the composition is about 1 mg / mL, about 10 mg / mL, about 50 mg / mL, about 75 mg / mL, about 100 mg / mL, about 150 mg / mL, about 200 mg / mL, about 250 mg / mL, about 300 mg / mL, about 400 mg / mL, or more. In one aspect, a composition is provided herein wherein the composition comprises RNA-LNPs, and wherein the concentration of RNA in the composition is < 1 mg / mL. In another aspect, a composition is provided herein wherein the composition comprises RNA-LNPs, and wherein the concentration of RNA in the composition is at least about 0.05 mg / mL. In another aspect, a composition is provided herein wherein the composition comprises RNA-LNPs, and wherein the concentration of RNA in the composition is between about 0.05 mg / mL and about 1 mg / mL. In another aspect, a composition is provided herein wherein the composition comprises RNA-LNPs, and wherein the concentration of RNA in the composition is between about 0.05 mg / mL and about 0.5 mg / mL. In some aspects, a composition is provided herein wherein the composition comprises RNA-LNPs, and wherein the concentration of RNA in the composition is at least, at most, exactly, between (inclusive or exclusive) any two of, or about 0.10 mg / mL, 0.11 mg / mL, 0.12 mg / mL, 0.13 mg / mL, 0.14 mg / mL, 0.15 mg / mL, 0.16 mg / mL, 0.17 mg / mL, 0.18 mg / mL, 0.19 mg / mL, 0.20 mg / mL, about 0.21 mg / mL, 0.22 mg / mL, 0.23 mg / mL, 0.24 mg / mL, 0.25 mg / mL, 0.26 mg / mL, 0.27 mg / mL, 0.28 mg / mL, 0.29 mg / mL, 0.30 mg / mL, 0.31 mg / mL, 0.32 mg / mL, 0.33 mg / mL, 0.34 mg / mL, or 0.35 mg / mL.
[0446] In a preferred embodiment, a composition is provided herein wherein the composition comprises RNA-LNPs, and wherein the concentration of RNA in the composition is about 0.1 mg / mL.
[0447] In one aspect, an LNP formulation is provided, wherein the concentration of TLR 7 / 8 modulating molecule in the LNP formulation is less than 1 mg / mL. In some embodiments, an LNP formulation is provided, wherein the concentration of TLR 7 / 8 modulating molecule in the LNP formulation is between about 1 μg / mL and about 1000 μg / mL. In some embodiments, an LNP formulation is provided, wherein the concentration of TLR 7 / 8 modulating molecule in the LNP formulation is between about 100 μg / mL and about 500 μg / mL, for example, about 100 μg / mL, about 150 μg / mL, about 200 μg / mL, about 250 μg / mL, about 300 μg / mL, about 350 μg / mL, about 400 μg / mL, about 450 μg / mL, or about 500 μg / mL. In some embodiments, an LNP formulation is provided, wherein the concentration of TLR 7 / 8 modulating molecule in the LNP formulation is between about 10 μg / mL and about 100 μg / mL, for example, about 10 μg / mL, about 15 μg / mL, about 20 μg / mL, about 25 μg / mL, about 30 μg / mL, about 35 μg / mL, about 40 μg / mL, about 45 μg / mL, about 50 μg / mL, about 55 μg / mL, about 60 μg / mL, about 65 μg / mL, about 70 μg / mL, about 75 μg / mL, about 80 μg / mL, about 85 μg / mL, about 90 μg / mL, about 95 μg / mL, or about 100 μg / mL.
[0448] In a preferred embodiment, an LNP formulation is provided, wherein the concentration of TLR 7 / 8 modulating molecule in the LNP formulation is about 17 μg / mL. In another preferred embodiment, an LNP formulation is provided, wherein the concentration of TLR 7 / 8 modulating molecule in the LNP formulation is about 86 μg / mL. In yet another preferred embodiment, an LNP formulation is provided, wherein the concentration of TLR 7 / 8 modulating molecule in the LNP formulation is about 344 μg / mL.
[0449] The efficacy of a product is dependent on expression of the delivered RNA, which requires a sufficiently intact RNA molecule. RNA integrity is a measure of RNA quality that quantitates intact RNA. The method is also capable of detecting potential degradation products. RNA integrity can be determined by capillary gel electrophoresis or fragment analyzer (FA). The initial specification is set to ensure sufficient RNA integrity in drug product preparations. In some embodiments, the RNA polynucleotides within an LNP formulation have an integrity of at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%. In a preferred embodiment, the RNA polynucleotides within an LNP formulation have an integrity of at least about 80%. In another preferred embodiment, the RNA polynucleotides within an LNP formulation have an integrity of at least about 85%. In yet another preferred embodiment, the RNA polynucleotides within an LNP formulation have an integrity of at least about 90%.
[0450] In some embodiments, in an LNP formulation wherein the LNPs comprise a TLR 7 / 8 modulating molecule, the RNA polynucleotides within the LNP formulation have an integrity within 20%, 15%, 10%, 5%, 4%, 3%, 2%, or 1% of the integrity of RNA polynucleotides within an LNP formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule. In a preferred embodiment, in an LNP formulation wherein the LNPs comprise a TLR 7 / 8 modulating molecule, the RNA polynucleotides within the LNP formulation have an integrity within 10% of the integrity of RNA polynucleotides within an LNP formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule. In another preferred embodiment, in an LNP formulation wherein the LNPs comprise a TLR 7 / 8 modulating molecule, the RNA polynucleotides within the LNP formulation have an integrity within 5% of the integrity of RNA polynucleotides within an LNP formulation wherein the LNPs do not comprise a TLR 7 / 8 modulating molecule.
[0451] In some embodiments, the LNP integrity of the LNP, LNP suspension, lyophilized LNP composition, or LNP formulation of the present disclosure is about 20% or higher, about 25% or higher, about 30% or higher, about 35% or higher, about 40% or higher, about 45% or higher, about 50% or higher, about 55% or higher, about 60% or higher, about 65% or higher, about 70% or higher, about 75% or higher, about 80% or higher, about 85% or higher, about 90% or higher, about 95% or higher, about 96% or higher, about 97% or higher, about 98% or higher, or about 99% or higher.
[0452] In some embodiments, the LNP integrity of the LNP, LNP suspension, lyophilized LNP composition, or LNP formulation of the present disclosure is higher than the LNP integrity of the LNP, LNP suspension, lyophilized LNP composition, or LNP formulation produced by a comparable method by about 5% or higher, about 10% or more, about 15% or more, about 20% or more, about 30% or more, about 40% or more, about 50% or more, about 60% or more, about 70% or more, about 80% or more, about 90% or more, about 1 folds or more, about 2 folds or more, about 3 folds or more, about 4 folds or more, about 5 folds or more, about 10 folds or more, about 20 folds or more, about 30 folds or more, about 40 folds or more, about 50 folds or more, about 100 folds or more, about 200 folds or more, about 300 folds or more, about 400 folds or more, about 500 folds or more, about 1000 folds or more, about 2000 folds or more, about 3000 folds or more, about 4000 folds or more, about 5000 folds or more, or about 10000 folds or more.
[0453] In some embodiments, the Txo% of the LNP, LNP suspension, lyophilized LNP composition, or LNP formulation of the present disclosure is about 12 months or longer, about 15 months or longer, about 18 months or longer, about 21 months or longer, about 24 months or longer, about 27 months or longer, about 30 months or longer, about 33 months or longer, about 36 months or longer, about 48 months or longer, about 60 months or longer, about 72 months or longer, about 84 months or longer, about 96 months or longer, about 108 months or longer, about 120 months or longer. As used herein, the term “Tx” refers to the amount of time lasted for the nucleic acid integrity (e.g., mRNA integrity) of a LNP, LNP suspension, lyophilized LNP composition, or LNP formulation to degrade to about X of the initial integrity of the nucleic acid (e.g., mRNA) used for the preparation of the LNP, LNP suspension, lyophilized LNP composition, or LNP formulation. For example, “T8o%” refers to the amount of time lasted for the nucleic acid integrity (e.g., mRNA integrity) of a LNP, LNP suspension, lyophilized LNP composition, or LNP formulation to degrade to about 80% of the initial integrity of the nucleic acid (e.g., mRNA) used for the preparation of the LNP, LNP suspension, lyophilized LNP composition, or LNP formulation. In other words, the time for a LNP, LNP suspension, lyophilized LNP composition, or LNP formulation, to lose 20% of its integrity.
[0454] In preferred embodiments, the RNA polynucleotide has a clinical grade purity. In some embodiments, the purity of the RNA polynucleotide is between about 60% and about 100%. In some embodiments, the purity of the RNA polynucleotide is between about 80% and 99%. In some embodiments, the purity of the RNA polynucleotide is between about 90% and about 99%. In some embodiments, wherein the purified mRNA has a clinical grade purity without further purification. In some embodiments, the clinical grade purity is achieved through a method including tangential flow filtration (TFF) purification. In some embodiments, the clinical grade purity is achieved without the further purification selected from high performance liquid chromatography (HPLC) purification, ligand or binding based purification, and / or ion exchange chromatography. In some embodiments, the method of producing the RNA polynucleotides removes long abortive RNA species, double-stranded RNA (dsRNA), residual plasmid DNA residual solvent and / or residual salt. In some embodiments, the short abortive transcript contaminants comprise less than 15 bases. In some embodiments, the short abortive transcript contaminants comprise about 8-12 bases. In some embodiments, the method of the invention also removes RNAse inhibitor.
[0455] In some embodiments, the purified RNA polynucleotide comprises 5% or less, 4% or less, 3% or less, 2% or less, 1 % or less or is substantially free of protein contaminants as determined by capillary electrophoresis. In some embodiments, the purified RNA polynucleotide comprises less than 5%, less than 4%, less than 3%, less than 2%, less than 1%, or is substantially free of salt contaminants determined by high performance liquid chromatography (HPLC). In some embodiments, the purified RNA polynucleotide comprises 5% or less, 4% or less, 3% or less, 2% or less, 1 % or less or is substantially free of short abortive transcript contaminants determined by known methods, such as, e.g., high performance liquid chromatography (HPLC). In some embodiments, the purified RNA polynucleotide has integrity of 60% or greater, 70% or greater, 80% or greater, 81% or greater, 82% or greater, 83% or greater, 84% or greater, 85% or greater, 86% or greater, 87% or greater, 88% or greater, 89% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, or 99% or greater as determined by a known method, such as, e.g., capillary electrophoresis.
[0456] The present disclosure provides for an RNA product solution and a lipid preparation mixture or compositions thereof comprising at least one RNA encoding, e.g., an immunogen complexed with, encapsulated in, and / or formulated with one or more lipids, and forming lipid nanoparticles (LNPs), liposomes, lipoplexes and / or nanoliposomes. In some aspects, the composition comprises a lipid nanoparticle.
[0457] A lipid nanoparticle or “LNP” refers to particles of any morphology generated when a cationic lipid and optionally one or more further lipids are combined, e.g., in an aqueous environment and / or in the presence of RNA. In some aspects, lipid nanoparticles are included in a formulation that may be used to deliver an active agent or therapeutic agent, such as a nucleic acid (e.g., mRNA) to a target site of interest (e.g., cell, tissue, organ, tumor, and the like). In some aspects, the lipid nanoparticles of the present disclosure comprise a nucleic acid (e.g., mRNA). Such lipid nanoparticles typically comprise a cationic lipid and one or more excipients, e.g., one or more neutral lipids, charged lipids, steroids, polymer conjugated lipids, or combinations thereof. In some aspects, the LNPs comprise at least one cationic (e.g., ionizable) lipid, at least one neutral (e.g., non-cationic) lipid, at least one structural lipid (e.g., a steroid), and / or at least one polymer conjugated lipid (e.g., a polyethylene glycol (PEG)-modified lipid). In some aspects, 1, 2, 3, or more of the foregoing excipients may be excluded from the LNPs.
[0458] In some aspects, an LNP formulation described herein comprises 20-60 mole percent (mol%) cationic (e.g., ionizable) lipid(s) as a percentage of total lipid. For example, an LNP formulation described herein may comprise 20-50 mol%, 20-40 mol%, 20-30 mol%, 30-60 mol%, 30-50 mol%, 30-40 mol%, 40-60 mol%, 40-50 mol%, or 50-60 mol% cationic (e.g., ionizable) lipid(s) as a percentage of total lipid. In some aspects, an LNP formulation comprises 45-55 mol% cationic (e.g., ionizable) lipid(s) as a percentage of total lipid. For example, an LNP formulation may comprise at least, at most, or exactly, any one of 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, or 55 mol% cationic (e.g., ionizable) lipid(s) as a percentage of total lipid. In some embodiments, an LNP formulation may comprise at least, at most, or exactly, any one of 47, 47.1, 47.2, 47.3, 47.4, 47.5, 47.6, 47.7, 47.8, 47.9, or 48 mol% cationic (e.g., ionizable) lipid(s) as a percentage of total lipid.
[0459] In a preferred embodiment, an LNP formulation comprises between 47 mol% and 48 mol% cationic (e.g., ionizable) lipid(s) as a percentage of total lipid. In another preferred embodiment, an LNP formulation comprises 47.5 mol% cationic (e.g., ionizable) lipid(s) as a percentage of total lipid.
[0460] In a preferred embodiment, an LNP formulation comprises between 47 mol% and 48 mol% ALC-0315 cationic lipid as a percentage of total lipid. In another preferred embodiment, an LNP formulation comprises 47.5 mol% ALC-0315 cationic lipid as a percentage of total lipid.
[0461] In some aspects, an LNP formulation comprises 5-25 mol% neutral (e.g., non-cationic) lipid(s) as a percentage of total lipid. For example, an LNP formulation may comprise 5-20 mol%, 5-15 mol%, 5-10 mol%, 10-25 mol%, 10-20 mol%, 10-25 mol%, 15-25 mol%, 15-20 mol%, or 20-25 mol% neutral (e.g., non-cationic) lipid(s) as a percentage of total lipid. In some aspects, an LNP formulation comprises at least, at most, exactly, or between (inclusive or exclusive) any two of 5 mol%, 10 mol%, 15 mol%, 20 mol%, or 25 mol% neutral (e.g., non-cationic) lipid(s) as a percentage of total lipid. In some aspects, an LNP formulation comprises 5 to 15 mol% neutral (e.g., non-cationic) lipid(s) as a percentage of total lipid. For example, an LNP formulation may comprise at least, at most, exactly, or between (inclusive or exclusive) any two of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mol% neutral (e.g., non-cationic) lipid(s) as a percentage of total lipid.
[0462] In a preferred embodiment, an LNP formulation comprises 10 mol% neutral (e.g., noncationic) lipid(s) as a percentage of total lipid. In another preferred embodiment, an LNP formulation comprises 10 mol% DSPC neutral lipid as a percentage of total lipid.
[0463] In some aspects, an LNP formulation comprises 25-55 mol% structural lipid(s) (e.g., a steroid) as a percentage of total lipid. For example, an LNP formulation may comprise 25-50 mol%, 25-45 mol%, 25-40 mol%, 25-35 mol%, 25-30 mol%, 30-55 mol%, 30-50 mol%, 30-45 mol%, 30-40 mol%, 30-35 mol%, 35-55 mol%, 35-50 mol%, 35-45 mol%, 35-40 mol%, 40-55 mol%, 40-50 mol%, 40-45 mol%, 45-55 mol%, 45-50 mol%, or 50-55 mol% structural lipid(s) (e.g., a steroid) as a percentage of total lipid. In some aspects, an LNP formulation may comprise at least, at most, exactly, or between (inclusive or exclusive) any two of 25 mol%, 30 mol%, 35 mol%, 40 mol%, 45 mol%, 50 mol%, or 55 mol% structural lipid(s) as a percentage of total lipid. In some aspects, an LNP formulation comprises 35 to 45 mol% structural lipid(s) as a percentage of total lipid. For example, an LNP formulation may comprise at least, at most, exactly, or between (inclusive or exclusive) any two of 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, or 45 mol% structural lipid(s) as a percentage of total lipid. In some embodiments, an LNP formulation comprises between about 40 mol% and about 41 mol% structural lipid(s) as a percentage of total lipid. For example, an LNP formulation may comprise at least, at most, exactly, or between (inclusive or exclusive) any two of 40, 40.1, 40.2, 40.3, 40.4, 40.5, 40.6, 40.7, 40.8, 40.9, or 50 mol% structural lipid(s) as a percentage of total lipid.
[0464] In a preferred embodiment, an LNP formulation comprises between about 40 mol% and about 41 mol% structural lipid(s) as a percentage of total lipid. In another preferred embodiment, an LNP formulation comprises about 40.7 mol% structural lipid(s) as a percentage of total lipid.
[0465] In a preferred embodiment, an LNP formulation comprises between about 40 mol% and about 41 mol% cholesterol as a percentage of total lipid. In another preferred embodiment, an LNP formulation comprises about 40.7 mol% cholesterol as a percentage of total lipid.
[0466] In a preferred embodiment, an LNP formulation comprises between about 40 mol% and about 41 mol% structural lipids as a percentage of total lipid, wherein the structural lipids consist of cholesterol and β-Sitosterol. In another preferred embodiment, an LNP formulation comprises about 40.7 mol% structural lipids as a percentage of total lipid, wherein the structural lipids consist of cholesterol and β-Sitosterol. In some aspects, an LNP formulation comprises 0.5-15 mol% polymer conjugated lipid(s) (e.g., a polyethylene glycol (PEG)-modified lipid) as a percentage of total lipid. For example, an LNP formulation may comprise 0.5-10 mol%, 0.5-5 mol%, 1-15 mol%, 1-10 mol%, 1-5 mol%, 2-15 mol%, 2-10 mol%, 2-5 mol%, 5-15 mol%, 5-10 mol%, or 10-15 mol% polymer conjugated lipid(s) as a percentage of total lipid. In some aspects, an LNP formulation comprises at least, at most, exactly, or between (inclusive or exclusive) any two of 0.5 mol%, 1 mol%, 2 mol%, 3 mol%, 4 mol%, 5 mol%, 6 mol%, 7 mol%, 8 mol%, 9 mol%, 10 mol%, 11 mol%, 12 mol%, 13 mol%, 14 mol%, or 15 mol% polymer conjugated lipid(s) as a percentage of total lipid. In some aspects, an LNP formulation comprises 1 to 2 mol% polymer conjugated lipid(s) as a percentage of total lipid. For example, an LNP formulation may comprise at least, at most, exactly, or between (inclusive or exclusive) any two of 1, 1.5, or 2 mol% polymer conjugated lipid(s) as a percentage of total lipid.
[0467] In a preferred embodiment, an LNP formulation comprises between about 1.5 mol% and about 2 mol% polymer conjugated lipid(s) as a percentage of total lipid. In another preferred embodiment, an LNP formulation comprises about 1.8 mol% polymer conjugated lipid(s) as a percentage of total lipid.
[0468] In a preferred embodiment, an LNP formulation comprises between about 1.5 mol% and about 2 mol% ALC-0159 polymer conjugated lipid as a percentage of total lipid. In another preferred embodiment, an LNP formulation comprises about 1.8 mol% ALC-0159 polymer conjugated lipid as a percentage of total lipid.
[0469] In some aspects, the LNPs comprise 20-75 mol% cationic (e.g., ionizable) lipid(s) (e.g., at least, at most, exactly, or between (inclusive or exclusive) any two of 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, and 75%), 0.5-25 mol% neutral (e.g., non-cationic) lipid(s) (e.g., at least, at most, exactly, or between (inclusive or exclusive) of 0.5%, 2.25%, 4%, 5.75%, 7.5%, 9.25%, 10%, 11%, 12.75%, 14.5%, 16.25%, 18%, 19.75%, 21.5%, 23.25%, and 25%), 5-55 mol% structural lipid(s) (e.g., a sterol) e.g., non-cationic) lipid(s) (e.g., at least, at most, exactly, or between (inclusive or exclusive) of 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, and 55%), and 0.5-20 mol% polymer conjugated lipid(s) (e.g., a polyethylene glycol (PEG)-modified lipid) (e.g., at least, at most, exactly, or between (inclusive or exclusive) of 0.5%, 2%, 3.5%, 5%, 6.5%, 8%, 9.5%, 11%, 12.5%, 14%, 15.5%, 17%, 18.5%, and 20%). In some aspects, 1, 2, 3, or more of the lipids may be excluded from the LNPs.
[0470] In some non-limiting aspects, the molar lipid ratio is 50 / 10 / 38.5 / 1.5 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), 60 / 7.5 / 31 / 1.5 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), 57.5 / 7.5 / 31.5 / 3.5 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), 57.2 / 7.1 / 34.3 / 1.4 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), 40 / 15 / 40 / 5 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), 50 / 10 / 35 / 4.5 / 0.5 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), 50 / 10 / 35 / 5 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), 47.5 / 10 / 40.7 / 1.8 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), 40 / 10 / 40 / 10 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), 35 / 15 / 40 / 10 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid), or 52 / 13 / 30 / 5 (mol% cationic lipid / neutral lipid / structural lipid / polymer conjugated lipid).
[0471] In some aspects, the active agent or therapeutic agent, such as a nucleic acid (e.g., mRNA), may be encapsulated in the lipid portion of the lipid nanoparticle and / or an aqueous space enveloped by some or all of the lipid portion of the lipid nanoparticle, thereby protecting it from enzymatic degradation or other undesirable effects induced by the mechanisms of the host organism or cells, e.g., an adverse immune response. The nucleic acid (e.g., mRNA) or a portion thereof may also be associated and complexed with the lipid nanoparticle. A lipid nanoparticle may comprise any lipid capable of forming a particle to which the nucleic acids are attached, and / or in which the one or more nucleic acids are encapsulated.
[0472] In some embodiments, a polynucleotide includes 200 to 3,000 nucleotides. For example, a polynucleotide may include 200 to 500, 200 to 1000, 200 to 1500, 200 to 3000, 500 to 1000, 500 to 1500, 500 to 2000, 500 to 3000, 1000 to 1500, 1000 to 2000, 1000 to 3000, 1500 to 3000, or 2000 to 3000 nucleotides.
[0473] In some embodiments, a LNP includes one or more RNAs, and the one or more RNAs, lipids, and amounts thereof may be selected to provide a specific N: P ratio. The N: P ratio of the composition refers to the molar ratio of nitrogen atoms in one or more lipids to the phosphate groups in an RNA. In general, a lower N: P ratio is preferred. In one embodiment, the lipid is an ionizable lipid. In another embodiment, the lipid is an ionizable cationic lipid. The one or more RNA, lipids, and amounts thereof may be selected to provide an N: P ratio from about 2:1 to about 30:1, such as 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1, 21:1, 22:1, 23:1, 24:1, 25:1, 26:1, 27:1, 28:1, 29:1 or 30:1. In certain embodiments, the N: P ratio may be from about 2:1 to about 8:1. In other embodiments, the N: P ratio is from about 5:1 to about 8:1. For example, the N: P ratio may be about 5.0:1, about 5.5:1, about 5.67:1, about 6.0:1, about 6.5:1, or about 7.0:1. For example, the N: P ratio may be about 5.67:1. In a preferred embodiment, the N: P ratio refers to the molar ratio of nitrogen atoms in the cationic lipid to the phosphate groups in an RNA, and the N: P ratio is about 6:1. In a preferred embodiment, the N: P ratio refers to the molar ratio of nitrogen atoms in the cationic lipid to the phosphate groups in an RNA, and the N: P ratio is about 5.67:1.
[0474] In some aspects, an LNP of the disclosure comprises a wt / wt ratio of the cationic lipid component to the RNA of or of from about 5:1 to about 100:1, e.g., at least, at most, exactly, or between (inclusive or exclusive) of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1, 21:1, 22:1, 23:1, 24:1, 25:1, 26:1, 27:1, 28:1, 29:1, 30:1, 31:1, 32:1, 33:1, 34:1, 35:1, 36:1, 37:1, 38:1, 39:1, 40:1, 41:1, 42:1, 43:1, 44:1, 45:1, 46:1, 47:1, 48:1, 49:1, 50:1, 51:1, 52:1, 53:1, 54:1, 55:1, 56:1, 57:1, 58:1, 59:1, 60:1, 61:1, 62:1, 63:1, 64:1, 65:1, 66:1, 67:1, 68:1, 69:1, 70:1, 71:1, 72:1, 73:1, 74:1, 75:1, 76:1, 77:1, 78:1, 79:1, 80:1, 81:1, 82:1, 83:1, 84:1, 85:1, 86:1, 87:1, 88:1, 89:1, 90:1, 91:1, 92:1, 93:1, 94:1, 95:1, 96:1, 97:1, 98:1, 99:1, or 100:1. In some aspects, an LNP of the disclosure comprises a wt / wt ratio of the ionizable cationic lipid component to the RNA of or of about 20:1. In some aspects, an LNP of the disclosure comprises a wt / wt ratio of the ionizable cationic lipid component to the RNA of or of about 10: 1.
[0475] In certain aspects, nucleic acids (e.g., RNA molecules), when present in provided LNPs, are resistant in aqueous solution to degradation with a nuclease. In some aspects, LNPs are livertargeting lipid nanoparticles. In some aspects, LNPs are cationic lipid nanoparticles comprising one or more cationic lipids (e.g., those described herein). In some aspects, cationic LNPs may comprise at least one cationic lipid, at least one polymer conjugated lipid, and at least one helper lipid (e.g., at least one neutral lipid).
[0476] In certain aspects, the RNA solution and lipid preparation mixture or compositions thereof may have at least, at most, exactly, between (inclusive or exclusive) of, or about 1%, 2%, 3%, 4% 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% of a particular lipid, lipid type, or nonlipid component such as lipid-like materials and / or cationic polymers and / or an adjuvant, antigen, peptide, polypeptide, sugar, nucleic acid or other material disclosed herein or as would be known to one of skill in the art.
[0477] LNPs described herein can be generated using components, compositions, and methods as are generally known in the art, see, e.g., PCT / US2016 / 052352; PCT / US2016 / 068300; PCT / US2017 / 037551; PCT / US2015 / 027400; PCT / US2016 / 047406; PCT / US2016000129; PCT / US2016 / 014280; PCT / US2016 / 014280; PCT / US2017 / 038426; PCT / US2014 / 027077; PCT / US2014 / 055394; PCT / US2016 / 052117; PCT / US2012 / 069610; PCT / US2017 / 027492; PCT / US2016 / 059575 and PCT / US2016 / 069491, all of which are incorporated by reference herein in their entirety. Other non-limiting examples of methods for preparing LNPs can be found in, e.g., WO 2022 / 032154, the disclosure of which is incorporated by reference herein in its entirety. For example, methods of preparing LNPs may involve obtaining a colloid from at least one cationic or cationically ionizable lipid or lipid-like material and / or at least one cationic polymer and mixing the colloid with nucleic acid to obtain nucleic acid particles. The term “colloid” as used herein relates to a type of homogeneous mixture in which dispersed particles do not settle out. The insoluble particles in the mixture are microscopic, with particle sizes between 1 and 1000 nanometers. The mixture may be termed a colloid or a colloidal suspension. Sometimes the term “colloid” refers only to the particles in the mixture and not the entire suspension.
[0478] For the preparation of colloids comprising at least one cationic or cationically ionizable lipid or lipid-like material and / or at least one cationic polymer, methods are applicable herein that are conventionally used for preparing liposomal vesicles and are appropriately adapted. The most commonly used methods for preparing liposomal vesicles share the following fundamental stages: (i) lipids dissolution in organic solvents, (ii) drying of the resultant solution, and (iii) hydration of dried lipid (using various aqueous media).
[0479] In the film hydration method, lipids are first dissolved in a suitable organic solvent and dried down to yield a thin film at the bottom of the flask. The obtained lipid film is hydrated using an appropriate aqueous medium to produce a liposomal dispersion. Furthermore, an additional downsizing step may be included.
[0480] Reverse phase evaporation is an alternative method to film hydration for preparing liposomal vesicles that involves formation of a water-in-oil emulsion between an aqueous phase and an organic phase containing lipids. A brief sonication of this mixture is required for system homogenization. The removal of the organic phase under reduced pressure yields a milky gel that subsequently turns into a liposomal suspension.
[0481] The term “ethanol injection technique” refers to a process in which an ethanol solution comprising lipids is rapidly injected into an aqueous solution through a needle. This action disperses the lipids throughout the solution and promotes lipid structure formation, for example, lipid vesicle formation such as liposome formation. Generally, the RNA lipoplex particles described herein are obtainable by adding RNA to a colloidal liposome dispersion. Using the ethanol injection technique, such colloidal liposome dispersion is, in some aspects, formed as follows: an ethanol solution comprising lipids, such as cationic lipids and additional lipids, is injected into an aqueous solution under stirring. In some aspects, the RNA lipoplex particles described herein are obtainable without a step of extrusion. The term “extruding” or “extrusion” refers to the creation of particles having a fixed, cross-sectional profile. In particular, it refers to the downsizing of a particle, whereby the particle is forced through filters with defined pores.
[0482] Other methods for preparing a colloid having organic solvent free characteristics may also be used according to the present disclosure. In some aspects, LNP-encapsulated RNA may be produced by rapid mixing of an RNA solution described herein (e.g., the RNA product solution) and a lipid preparation described herein (comprising, e.g., at least one cationic lipid and optionally one or more other lipid components, in an organic solvent) under conditions such that a sudden change in solubility of lipid component(s) is triggered, which drives the lipids towards self-assembly in the form of LNPs. In some aspects, suitable buffering agents comprise tris, histidine, citrate, acetate, phosphate, and / or succinate. In some aspects, 1, 2, 3, or more of the foregoing buffering agents are excluded. The pH of a liquid formulation relates to the pKa of the encapsulating agent {e.g., cationic lipid). The pH of the acidifying buffer may be at least half a pH scale less than the pKa of the encapsulating agent e.g., cationic lipid), and the pH of the final buffer may be at least half a pH scale greater than the pKa of the encapsulating agent {e.g., cationic lipid). In some aspects, properties of a cationic lipid are chosen such that nascent formation of particles occurs by association with an oppositely charged backbone of a nucleic acid (e.g., RNA). In this way, particles are formed around the nucleic acid, which, for example, in some aspects, may result in much higher encapsulation efficiency than is achieved in the absence of interactions between nucleic acids and at least one of the lipid components. In certain aspects, nucleic acids, when present in the lipid nanoparticles, are resistant in aqueous solution to degradation with a nuclease.
[0483] Lipid nanoparticles comprising nucleic acids and their method of preparation are disclosed in, e.g., U. S. Patent Publication Nos. 2004 / 0142025, 2007 / 0042031 and PCT Pub. Nos. WO 2013 / 016058 and WO 2013 / 086373, the full disclosures of which are herein incorporated by reference in their entirety for all purposes.
[0484] Some aspects described herein relate to compositions, methods and uses involving more than one, e.g., 2, 3, 4, 5, 6 or even more nucleic acid species, such as RNA species. In an LNP formulation, it is possible that each nucleic acid species is separately formulated as an individual LNP formulation. In that case, each individual LNP formulation will comprise one nucleic acid species. The individual LNP formulations may be present as separate entities, e.g., in separate containers. Such formulations are obtainable by providing each nucleic acid species separately (typically each in the form of a nucleic acid-containing solution) together with suitable cationic or cationically ionizable lipids or lipid-like materials and cationic polymers that allow the formation of LNPs. Respective particles will contain exclusively the specific nucleic acid species that is being provided when the particles are formed (individual particulate formulations).
[0485] In some aspects, a composition such as a pharmaceutical composition comprises more than one individual LNP formulation. Respective pharmaceutical compositions are referred to as mixed LNP formulations. Mixed LNP formulations according to the invention are obtainable by forming, separately, individual LNP formulations, as described above, followed by a step of mixing of the individual LNP formulations. By the step of mixing, a formulation comprising a mixed population of nucleic acid-containing LNPs is obtainable. Individual LNP populations may be together in one container, comprising a mixed population of individual LNP formulations.
[0486] Alternatively, it is possible that different nucleic acid species are formulated together as a combined LNP formulation. Such formulations are obtainable by providing a combined formulation (typically combined solution) of different RNA species together with suitable cationic or cationically ionizable lipids or lipid-like materials and cationic polymers that allow the formation of LNPs. As opposed to a mixed LNP formulation, a combined LNP formulation will typically comprise LNPs that comprise more than one RNA species. In a combined LNP composition, different RNA species are typically present together in a single particle.
[0487] Cationic Polymeric Materials
[0488] Given their high degree of chemical flexibility, polymeric materials are commonly used for nanoparticle-based delivery. Typically, cationic materials are used to electrostatically condense the negatively charged nucleic acid into nanoparticles. These positively charged groups often consist of amines that change their state of protonation in the pH range between 5.5 and 7.5, thought to lead to an ion imbalance that results in endosomal rupture. Polymers such as poly-L-lysine, polyamidoamine, protamine and polyethyleneimine, as well as naturally occurring polymers such as chitosan have all been applied to nucleic acid delivery and are suitable as cationic materials useful in some aspects herein. In addition, some investigators have synthesized polymeric materials specifically for nucleic acid delivery. Poly(P-amino esters), in particular, have gained widespread use in nucleic acid delivery owing to their ease of synthesis and biodegradability. In some aspects, such synthetic materials may be suitable for use as cationic materials herein.
[0489] A “polymeric material,” as used herein, is given its ordinary meaning, e.g., a molecular structure comprising one or more repeat units (monomers), connected by covalent bonds. In some aspects, such repeat units may all be identical; alternatively, in some cases, there may be more than one type of repeat unit present within the polymeric material. In some cases, a polymeric material is biologically derived, e.g., a biopolymer such as a protein. In some cases, additional moieties may also be present in the polymeric material, for example targeting moieties such as those described herein.
[0490] Those skilled in the art are aware that, when more than one type of repeat unit is present within a polymer (or polymeric moiety), then the polymer (or polymeric moiety) is said to be a “copolymer.” In some aspects, a polymer (or polymeric moiety) utilized in accordance with the present disclosure may be a copolymer. Repeat units forming the copolymer may be arranged in any fashion. For example, in some aspects, repeat units may be arranged in a random order; alternatively or additionally, in some aspects, repeat units may be arranged in an alternating order, or as a “block” copolymer, e.g., comprising one or more regions each comprising a first repeat unit (e.g., a first block), and one or more regions each comprising a second repeat unit (e.g., a second block), etc. Block copolymers may have two (a diblock copolymer), three (a triblock copolymer), or more numbers of distinct blocks.
[0491] In certain aspects, a polymeric material for use in accordance with the present disclosure is biocompatible. Biocompatible materials are those that typically do not result in significant cell death at moderate concentrations. In certain aspects, a biocompatible material is biodegradable, e.g., is able to degrade, chemically and / or biologically, within a physiological environment, such as within the body. In certain aspects, a polymeric material may be or comprise protamine or polyalkyleneimine, in particular protamine.
[0492] As those skilled in the art are aware term “protamine” is often used to refer to any of various strongly basic proteins of relatively low molecular weight that are rich in arginine and are found associated especially with DNA in place of somatic histones in the sperm cells of various animals (as fish). In particular, the term “protamine” is often used to refer to proteins found in fish sperm that are strongly basic, are soluble in water, are not coagulated by heat, and yield chiefly arginine upon hydrolysis. In purified form, they are used in a long-acting formulation of insulin and to neutralize the anticoagulant effects of heparin.
[0493] In some aspects, the term “protamine” as used herein is refers to a protamine amino acid sequence obtained or derived from natural or biological sources, including fragments thereof and / or multimeric forms of said amino acid sequence or fragment thereof, as well as (synthesized) polypeptides which are artificial and specifically designed for specific purposes and cannot be isolated from native or biological sources.
[0494] In some aspects, a polyalkyleneimine comprises polyethylenimine and / or polypropylenimine. In some aspects, the polyalkyleneimine is polyethyleneimine (PEI). In some aspects, the polyalkyleneimine is a linear polyalkyleneimine, e.g., linear polyethyleneimine (PEI).
[0495] Cationic materials (e.g., polymeric materials, including polycationic polymers) contemplated for use herein include those which are able to electrostatically bind nucleic acid. In some aspects, cationic polymeric materials contemplated for use herein include any cationic polymeric materials with which nucleic acid may be associated, e.g. by forming complexes with the nucleic acid or forming vesicles in which the nucleic acid is enclosed or encapsulated.
[0496] In some aspects, particles described herein may comprise polymers other than cationic polymers, e.g., non-cationic polymeric materials and / or anionic polymeric materials.
[0497] Collectively, anionic and neutral polymeric materials are referred to herein as non-cationic polymeric materials.
[0498] Lipids and Lipid-Like Materials The terms “lipid” and “lipid-like material” are used herein to refer to molecules which comprise one or more hydrophobic moieties or groups and optionally also one or more hydrophilic moieties or groups. According to the disclosure, lipids and lipid-like materials may be cationic, anionic or neutral. Neutral lipids or lipid-like materials exist in an uncharged or neutral zwitterionic form at a selected pH.
[0499] The term “lipid” refers to a group of organic compounds that are characterized by being insoluble in water but soluble in many organic solvents. Generally, lipids may be divided into eight categories: fatty acids and their derivatives (including tri-, di-, monoglycerides, and phospholipids), glycerolipids, glycerophospholipids, sphingolipids, saccharolipids, polyketides, sterol lipids as well as sterol-containing metabolites such as cholesterol, and prenol lipids. Examples of fatty acids include, but are not limited to, fatty esters and fatty amides. Examples of glycerolipids include, but are not limited to, glycosylglycerols and glycerophospholipids (e.g., phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine). Examples of sphingolipids include, but are not limited to, ceramides phosphosphingolipids (e.g., sphingomyelins, phosphocholine), and glycosphingolipids (e.g., cerebrosides, gangliosides). Examples of sterol lipids include, but are not limited to, cholesterol and its derivatives and tocopherol and its derivatives. In some aspects, 1, 2, 3, 4, 5, or more of the lipids may be excluded from the LNPs of the present disclosure.
[0500] The term “lipid-like material,” “lipid-like compound,” or “lipid-like molecule” relates to substances that structurally and / or functionally relate to lipids but may not be considered as lipids in a strict sense. For example, the term includes compounds that are able to form amphiphilic layers as they are present in vesicles, multilamellar / unilamellar liposomes, or membranes in an aqueous environment and includes surfactants, or synthesized compounds with both hydrophilic and hydrophobic moieties. Generally speaking, the term refers to molecules, which comprise hydrophilic and hydrophobic moieties with different structural organization, which may or may not be similar to that of lipids.
[0501] In some aspects, the RNA solution and lipid preparation mixture or compositions thereof may comprise cationic lipids, neutral lipids, cholesterol, and / or polymer (e.g., polyethylene glycol) conjugated lipids which form lipid nanoparticles that encompass the RNA molecules. Therefore, in some aspects, the LNP may comprise a cationic lipid and one or more excipients, e.g., one or more neutral lipids, charged lipids, steroids or steroid analogs (e.g., cholesterol), polymer conjugated lipids (e.g. PEG-lipid), or combinations thereof. In some aspects, 1, 2, 3, or more of the foregoing excipients may be excluded from the LNPs of the present disclosure. In some aspects, the lipids are present in a composition in an amount that is effective to form a lipid nanoparticle and deliver a therapeutic agent, e.g., an RNA molecule, for treating a particular disease or condition of interest. In some aspects, the LNPs encompass, or encapsulate, the nucleic acid molecules.
[0502] Cationic Lipids
[0503] Cationic or cationically ionizable lipids or lipid-like materials refer to a lipid or lipid-like material capable of being positively charged and able to electrostatically bind nucleic acid. As used herein, a “cationic lipid” or “cationic lipid-like material” refers to a lipid or lipid-like material having a net positive charge. Cationic lipids or lipid-like materials bind negatively charged nucleic acid by electrostatic interaction. Generally, cationic lipids possess a lipophilic moiety, such as a sterol, an acyl chain, a diacyl, or more acyl chains, and the head group of the lipid typically carries the positive charge. Exemplary cationic lipids include one or more amine group(s) which bear the positive charge. Cationic lipids may encapsulate negatively charged RNA.
[0504] In some aspects, cationic lipids are ionizable such that they may exist in a positively charged or neutral form depending on pH. The ionization of the cationic lipid affects the surface charge of the lipid nanoparticle under different pH conditions. Without wishing to be bound by theory, this ionizable behavior is thought to enhance efficacy through helping with endosomal escape and reducing toxicity as compared with particles that remain cationic at physiological pH. For purposes of the present disclosure, such “cationically ionizable” lipids or lipid-like materials are comprised by the term “cationic lipid” or “cationic lipid-like material” unless contradicted by the circumstances.
[0505] Examples of cationic lipids include, but are not limited to: ((4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate), 1,2-dioleoyl-3-trimethylammonium propane (DOTAP), N, N-dimethyl-2,3-dioleyloxypropylamine (DODMA), 1,2-di-O-octadecenyl-3-trimethylammonium propane (DOTMA), 3-(N-( N', N'-dimethylaminoethane)-carbamoyl)cholesterol (DC-Chol), dimethyldioctadecylammonium (DDAB), 1,2-dioleoyl-3-dimethylammonium-propane (DODAP), 1,2-diacyloxy-3-dimethylammonium propanes, 1,2-dialkyloxy-3-dimethylammonium propanes; dioctadecyldimethyl ammonium chloride (DODAC), 1,2-distearyloxy-N, N-dimethyl-3-aminopropane (DSDMA), 2,3-di(tetradecoxy)propyl-(2-hydroxyethyl)-dimethylazanium (DMRIE), 1,2-dimyristoyl-sn-glycero-3-ethylphosphocholine (DMEPC), 1,2-dimyristoyl-3-trimethylammonium propane (DMTAP), 1,2-dioleoyloxypropyl-3-dimethyl-hydroxyethyl ammonium bromide (DORIE), 2,3-dioleoyloxy-N-[2(spermine carboxamide)ethyl]-N, N-dimethyl-1-propanamium trifluoroacetate (DOSPA), 1,2-dilinoleyloxy-N, N-dimethylaminopropane (DLinDMA), 1,2-dilinolenyloxy-N, N-dimethylaminopropane (DLenDMA), dioctadecylamidoglycyl spermine (DOGS), 3-dimethylamino-2-(cholest-5-en-3-beta-oxybutan-4-oxy)-1-(cis,cis-9,12-oc-tadecadienoxy)propane (CLinDMA), 2-[5'-(cholest-5-en-3-beta-oxy)-3'-oxapentoxy)-3-dimethyl-l-(cis,cis-9',12'-octadecadienoxy)propane (CpLinDMA), N, N-dimethyl-3,4-dioleyloxybenzylamine (DMOBA), 1,2-N, N'-dioleylcarbamyl-3-dimethylaminopropane (DOcarbDAP), 2,3-dilinoleoyloxy-N, N-dimethylpropylamine (DLinDAP), 1.2-N, N'-dilinoleylcarbamyl-3-dimethylaminopropane (DLincarbDAP), 1,2-Dilinoleoylcarbamyl-3-dimethylaminopropane (DLinCDAP), 2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA), 2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-K-XTC2-DMA), 2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane (DLin-KC2-DMA), heptatriaconta-6,9,28,31-tetraen-19-yl-4-(dimethylamino)butanoate (DLin-MC3-DMA), N-(2-Hydroxyethyl)-N, N-dimethyl- 2.3-bis(tetradecyloxy)-1-propanaminium bromide (DMRIE), (±)-N-(3-aminopropyl)-N, N-dimethyl- 2.3-bis(cis-9-tetradecenyloxy)-1-propanaminium bromide (GAP-DMORIE), (±)-N-(3-aminopropyl)-N, N-dimethyl-2,3-bis(dodecyloxy)-1-propanaminium bromide (GAP-DLRIE), (±)-N-(3-aminopropyl)-N, N-dimethyl-2,3-bis(tetradecyloxy)-1-propanaminium bromide (GAP- DMRIE), N-(2-Aminoethyl)-N, N-dimethyl-2,3-bis(tetradecyloxy)-1-propanaminium bromide (bAE-DMRIE), N-(4-carboxybenzyl)-N, N-dimethyl-2,3-bis(oleoyloxy)propan-1-aminium (DOBAQ), 2-({8-[(3b)-cholest-5-en-3-yloxy]octyl}oxy)-N, N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA), 1,2-dimyristoyl-3-dimethylammonium-propane (DMDAP), 1,2-dipalmitoyl-3-dimethylammonium-propane (DPDAP), N1-[2-((1S)-1-[(3-aminopropyl)amino]-4-[di(3-amino-propyl)amino]butylcarboxamido)ethyl]-3,4-di[oleyloxy]-benzamide (MVL5), 1,2-dioleoyl-sn-glycero-3-ethylphosphocholine (DOEPC), 2,3-bis(dodecyloxy)-N-(2-hydroxyethyl)-N, N-dimethylpropan-1-amonium bromide (DLRIE), N-(2-aminoethyl)-N, N-dimethyl-2,3-bis(tetradecyloxy)propan-1-aminium bromide (DMORIE), di((Z)-non-2-en-l-yl) 8,8'-((((2(dimethylamino)ethyl)thio)carbonyl)azanediyl)dioctanoate (ATX), N, N-dimethyl-2,3-bis(dodecyloxy)propan-1 -amine (DLDMA), N, N-dimethyl-2,3-bis(tetradecyloxy)propan-1 -amine (DMDMA), Di((Z)-non-2-en-l-yl)-9-((4-(dimethylaminobutanoyl)oxy)heptadecanedioate (L319), N-dodecyl-3-((2-dodecylcarbamoyl-ethyl)-{2-[(2-dodecylcarbamoyl-ethyl)-2-{(2-dodecylcarbamoyl-ethyl)-[2-(2-dodecylcarbamoyl-ethylamino)-ethyl]-amino}-ethylamino)propionamide (lipidoid 98N12-5), 1-[2-[bis(2-hydroxydodecyl)amino]ethyl-[2-[4-[2-[bis(2 hydroxydodecyl)amino]ethyl]piperazin-1-yl]ethyl]amino]dodecan-2-ol (lipidoid 02-200); C 12-200; or heptadecan-9-yl 8-((2-hydroxyethyl) (6-oxo-6-(undecyloxy)hexyl) amino) octanoate (SM-102). In some aspects, 1, 2, 3, 4, 5, or more of the foregoing cationic lipids may be excluded from the LNPs of the present disclosure.
[0506] In some aspects, an ionizable cationic lipid of the disclosure comprises a compound of Formula (I):
[0507]
[0508] or a pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof, wherein:
[0509] Ri is a C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, or -R”M’R’;
[0510] R2 and R3 are independently a H, C1-14 alkyl, C2-14 alkenyl, -R*YR”, -YR”, or-R*OR”, and / or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
[0511] R4 is a C3-6 carbocycle, -(CH2)nQ, -(CH2)nCHQR, -CHQR, -CQ(R)2, or unsubstituted Ci-e alkyl, where Q is a carbocycle, heterocycle, -OR, -O(CH2)nN(R)2, -C(O)OR, -OC(O)R, -CX3, -CX2H, -CXH2, -CN, -N(R)2, -C(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)C(O)N(R)2, -N(R)C(S)N(R)2, -N(R)R8, -O(CH2)nOR, -N(R)C(=NR9)N(R)2, -N(R)C(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, -N(OR)C(O)R, -N(OR)S(O)2R, -N(OR)C(O)OR, -N(OR)C(O)N(R)2, - N(OR)C(S)N(R)2, -N(OR)C(=NR9)N(R)2, -N(OR)C(=CHR9)N(R)2, -C(=NR9)N(R)2, -C(=NR9)R, -C(O)N(R)OR, or -C(R)N(R)2C(O)OR, and / or each n is independently a 1, 2, 3, 4, or 5;
[0512] each R5 is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0513] each Re is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0514] M and M’ are independently a -C(O)O-, -OC(O)-, -C(O)N(R’)-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -S-S-, an aryl group, or a heteroaryl group;
[0515] R? is a C1.3 alkyl, C2-3 alkenyl, or H;
[0516] Rs is a C3-6 carbocycle or heterocycle;
[0517] Rg is a H, CN, NO2, Ci-e alkyl, -OR, -S(O)2R, -S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle, or heterocycle;
[0518] each R is a C1.3 alkyl, C2-3 alkenyl, or H;
[0519] each R' is a C1-18 alkyl, C2-18 alkenyl, -R*YR”, -YR”, or H;
[0520] each R” is a C3-14 alkyl or C3-14 alkenyl;
[0521] each R* is independently a C1-12 alkyl or C2-12 alkenyl;
[0522] each Y is independently a C3-6 carbocycle;
[0523] each X is independently a F, Cl, Br, or I; and
[0524] m is a 5, 6, 7, 8, 9, 10, 11, 12, or 13.
[0525] In some aspects, a subset of compounds of Formula (I) includes those in which when R4 is -(CH2)nQ, -(CH2)nCHQR, -CHQR, or -CQ(R)2, then (i) Q is not -N(R)2 when n is 1, 2, 3, 4, or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2. In some aspects, another subset of compounds of Formula (I) includes those in which Ri is a C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, or -R”M’R’;
[0526] R2 and R3 are independently an H, C1-14 alkyl, C2-14 alkenyl, -R*YR”, -YR”, or -R*OR”, and / or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
[0527] R4 is a C3-6 carbocycle, -(CH2)nQ, -(CH2)nCHQR, -CHQR, -CQ(R)2, or unsubstituted Ci-e alkyl, where Q is a C3-6 carbocycle, a 5- to 14-membered heteroaryl having one or more heteroatoms comprising N, O, or S, -OR, -O(CH2)nN(R)2, -C(O)OR, -OC(O)R, -CX3, -CX2H, -CXH2, -CN, -C(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)C(O)N(R)2, -N(R)C(S)N(R)2, -CRN(R)2C(O)OR, -N(R)R8, -O(CH2)nOR, -N(R)C(=NR9)N(R)2, -N(R)C(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, -N(OR)C(O)R, -N(OR)S(O)2R, -N(OR)C(O)OR, -N(OR)C(O)N(R)2, -N(OR)C(S)N(R)2, -N(OR)C(=NR9)N(R)2, -N(OR)C(=CHR9)N(R)2, -C(=NR9)N(R)2, -C(=NR9)R, -C(O)N(R)OR, or a 5- to 14-membered heterocycloalkyl having one or more heteroatoms comprising N, O, and S which is substituted with one or more substituents comprising oxo (=0), OH, amino, mono- or di- alkylamino, or C1.3 alkyl, and / or each n is independently 1, 2, 3, 4, or 5;
[0528] each R5 is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0529] each Re is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0530] M and M' are independently a -0(0)0-, -00(0)-, -C(O)N(R’)-, -N(R’)C(O)-, -0(0)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(0)2-, -S-S-, an aryl group, or a heteroaryl group;
[0531] R? is a C1.3 alkyl, C2-3 alkenyl, or H;
[0532] Rs is a C3-6 carbocycle or heterocycle;
[0533] Rg is a H, CN, NO2, Ci-e alkyl, -OR, -S(O)2R, -S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle or heterocycle;
[0534] each R is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0535] each R’ is independently a C1.18 alkyl, C2-18 alkenyl, -R* YR”, -YR”, or H;
[0536] each R” is independently a C3-14 alkyl or C3-14 alkenyl;
[0537] each R* is independently a C1-12 alkyl or C2-12 alkenyl;
[0538] each Y is independently a C3-6 carbocycle;
[0539] each X is independently a F, Cl, Br, or I; and
[0540] m is 5, 6, 7, 8, 9, 10, 11, 12, or 13, and / or pharmaceutically acceptable salts, tautomers, prodrugs, or stereoisomers thereof.
[0541] In some aspects, another subset of compounds of Formula (I) includes those in which: R1 is a C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, or -R”M’R’;
[0542] R2 and R3 are independently an H, C1-14 alkyl, C2-14 alkenyl, -R*YR”, -YR”, or -R*0R”, and / or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle; R4 is a C3-6 carbocycle, -(CH2)nQ, -(CH2)nCHQR, -CHQR, -CQ(R)2, or unsubstituted Ci-e alkyl, where Q is a C3-6 carbocycle, a 5- to 14-membered heterocycle having one or more heteroatoms comprising N, O, or S, -OR, -O(CH2)nN(R)2, -C(O)OR, -OC(O)R, -CX3, -CX2H, -CXH2, -CN, -C(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)C(O)N(R)2, -N(R)C(S)N(R)2, -CRN(R)2C(O)OR, -N(R)R8, -O(CH2)nOR, -N(R)C(=NR9)N(R)2, -N(R)C(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, -N(OR)C(O)R, -N(OR)S(O)2R, -N(OR)C(O)OR, -N(OR)C(O)N(R)2, -N(OR)C(S)N(R)2, -N(OR)C(=NR9)N(R)2, -N(OR)C(=CHR9)N(R)2, -C(=NR9)R, -C(O)N(R)OR, or -C(=NR9)N(R)2, and / or each n is independently 1, 2, 3, 4, or 5; and / or when Q is a 5- to 14-membered heterocycle and (i) R4 is -(CH2)nQ in which n is 1 or 2, or (ii) R4 is -(CH2)nCHQR in which n is 1, or (iii) R4 is -CHQR, and -CQ(R)2, then Q is either a 5- to 14-membered heteroaryl or 8- to 14-membered heterocycloalkyl;
[0543] each R5 is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0544] each Re is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0545] M and M' are independently a -C(O)O-, -OC(O)-, -C(O)N(R')-, -N(R')C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -S-S-, an aryl group, or a heteroaryl group;
[0546] R? is a C1.3 alkyl, C2-3 alkenyl, or H;
[0547] Rs is C3-6 carbocycle or heterocycle;
[0548] R9is H, CN, NO2, C1.6 alkyl, -OR, -S(O)2R, -S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle, or heterocycle;
[0549] each R is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0550] each R’ is independently a C1.18 alkyl, C2-18 alkenyl, -R*YR”, -YR”, or H;
[0551] each R” is independently a C3-14 alkyl or C3-14 alkenyl;
[0552] each R* is independently a C1-12 alkyl or C2-12 alkenyl;
[0553] each Y is independently a C3-6 carbocycle;
[0554] each X is independently a F, Cl, Br, or I; and
[0555] m is 5, 6, 7, 8, 9, 10, 11, 12, or 13, and / or pharmaceutically acceptable salts, tautomers, prodrugs, or stereoisomers thereof.
[0556] In some aspects, another subset of compounds of Formula (I) includes those in which: R1 is a C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, or -R”M’R’;
[0557] R2 and R3 are independently an H, C1-14 alkyl, C2-14 alkenyl, -R*YR”, -YR”, or -R*OR”, and / or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
[0558] R4 is a C3-6 carbocycle, -(CH2)nQ, -(CH2)nCHQR, -CHQR, -CQ(R)2, or unsubstituted Ci-e alkyl, where Q is a C3-6 carbocycle, a 5- to 14-membered heteroaryl having one or more heteroatoms comprising N, O, or S, -OR, -O(CH2)nN(R)2, -C(O)OR, -OC(O)R, -CX3, -CX2H, -CXH2, -CN, -C(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)C(O)N(R)2, -N(R)C(S)N(R)2, - CRN(R)2C(O)OR, -N(R)R8, -O(CH2)nOR, -N(R)C(=NR9)N(R)2, -N(R)C(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, -N(OR)C(O)R, -N(OR)S(O)2R, -N(OR)C(O)OR, -N(OR)C(O)N(R)2, -N(OR)C(S)N(R)2, -N(OR)C(=NR9)N(R)2, -N(OR)C(=CHR9)N(R)2, -C(=NR9)R, -C(O)N(R)OR, or -C(=NR9)N(R)2, and / or each n is independently 1, 2, 3, 4, or 5;
[0559] each R5 is independently a C1-3 alkyl, C2-3 alkenyl, or H;
[0560] each R6 is independently a C1-3 alkyl, C2-3 alkenyl, or H;
[0561] M and M' are independently a -C(O)O-, -OC(O)-, -C(O)N(R')-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR')O-, -S(O)2-, -S-S-, an aryl group, or a heteroaryl group;
[0562] R7 is a C1-3 alkyl, C2-3 alkenyl, or H;
[0563] Rs is a C3-6 carbocycle or heterocycle;
[0564] R9is an H, CN, NO2, C1-6 alkyl, -OR, -S(O)2R, -S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle, or heterocycle;
[0565] each R is independently a C1-3 alkyl, C2-3 alkenyl, or H;
[0566] each R' is independently a C1.18 alkyl, C2-is alkenyl, -R*YR”, -YR”, or H;
[0567] each R” is independently a C3-14 alkyl or C3-14 alkenyl;
[0568] each R* is independently a C1-12 alkyl or C2-12 alkenyl;
[0569] each Y is independently a C3-6 carbocycle;
[0570] each X is independently a F, Cl, Br, or I; and
[0571] m is 5, 6, 7, 8, 9, 10, 11, 12, or 13, and / or pharmaceutically acceptable salts, tautomers, prodrugs, or stereoisomers thereof.
[0572] In some aspects, another subset of compounds of Formula (I) includes those in which: R1 is a C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, or -R”M’R’;
[0573] R2and R3 are independently an H, C2.14 alkyl, C2.14 alkenyl, -R*YR”, -YR”, or -R*OR”, and / or R2and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
[0574] R4 is -(CH2)nQ or -(CH2)nCHQR, where Q is -N(R)2, and / or n is 3, 4, or 5;
[0575] each R5 is independently a C1.3 alkyl, C2.3 alkenyl, or H;
[0576] each R6 is independently a C1-3 alkyl, C2-3 alkenyl, or H;
[0577] M and M’ are independently a -C(O)O-, -OC(O)-, -C(O)N(R')-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR')O-, -S(O)2-, -S-S-, an aryl group, or a heteroaryl group;
[0578] R7 is a C1-3 alkyl, C2-3 alkenyl, or H;
[0579] each R is independently a C1-3 alkyl, C2-3 alkenyl, or H;
[0580] each R’ is independently a C1.18 alkyl, C2-ie alkenyl, -R*YR”, -YR”, or H;
[0581] each R” is independently a C3-14 alkyl or C3-14 alkenyl;
[0582] each R* is independently a C1-12 alkyl or C1-12 alkenyl;
[0583] each Y is independently a C3-6 carbocycle; each X is independently a F, Cl, Br, or I; and
[0584] m is 5, 6, 7, 8, 9, 10, 11, 12, or 13, and / or pharmaceutically acceptable salts, tautomers, prodrugs, or stereoisomers thereof.
[0585] In some aspects, another subset of compounds of Formula (I) includes those in which: Ri is a C5-30 alkyl, C5-20 alkenyl, -R*YR”, -YR”, or -R”M’R’;
[0586] R2 and R3 are independently a C1-14 alkyl, C2-14 alkenyl, -R*YR”, -YR”, or -R*OR”, and / or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
[0587] R4 is a -(CH2)nQ, -(CH2)nCHQR, -CHQR, or -CQ(R)2, where Q is -N(R)2, and / or n is 1, 2, 3, 4, or 5;
[0588] each R5 is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0589] each Re is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0590] M and M' are independently a -C(O)O-, -OC(O)-, -C(O)N(R')-, -N(R’)C(O)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(O)(OR’)O-, -S(O)2-, -S-S-, an aryl group, or a heteroaryl group;
[0591] R7 is a C1.3 alkyl, C2-3 alkenyl, or H;
[0592] each R is independently a C1.3 alkyl, C2-3 alkenyl, or H;
[0593] each R' is independently a C1.18 alkyl, C2-18 alkenyl, -R*YR”, -YR”, or H;
[0594] each R” is independently a C3-14 alkyl or C3-14 alkenyl;
[0595] each R* is independently a C1-12 alkyl or C1-12 alkenyl;
[0596] each Y is independently a C3-6 carbocycle;
[0597] each X is independently a F, Cl, Br, or I; and
[0598] m is 5, 6, 7, 8, 9, 10, 11, 12, or 13, and / or pharmaceutically acceptable salts, tautomers, prodrugs, or stereoisomers thereof.
[0599] In some aspects, a subset of compounds of Formula (I) includes those of Formula (IA):
[0600]
[0601] (IA),
[0602] or a pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof, wherein I is 1, 2, 3, 4, or 5; m is 5, 6, 7, 8, or 9; Mi is a bond or M’; R4 is unsubstituted C1.3 alkyl, or -(CH2)nQ, in which Q is OH, -NHC(S)N(R)2, -NHC(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)R8, -NHC(=NR9)N(R)2, -NHC(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M’ are independently a -C(O)O-, -OC(O)-, -C(O)N(R’)-, -P(O)(OR’)O-, -S-S-, an aryl group, or a heteroaryl group; and R2 and R3 are independently a H, C1-14 alkyl, or C2-14 alkenyl.
[0603] In some aspects, a subset of compounds of Formula (I) includes those of Formula (II):
[0604]
[0605] or a pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof, wherein I is 1, 2, 3, 4, or 5; Mi is a bond or M’; R4 is unsubstituted C1.3 alkyl, or -(CH2)nQ, in which n is 2, 3, or 4, and Q is OH, -NHC(S)N(R)2, -NHC(O)N(R)2, -N(R)C(O)R, -N(R)S(O)2R, -N(R)R8, -NHC(=NR9)N(R)2, -NHC(=CHR9)N(R)2, -OC(O)N(R)2, -N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M’ are independently a -C(O)O-, -OC(O)-, -C(O)N(R')-, -P(O)(OR’)O-, -S-S-, an aryl group, or a heteroaryl group; and R2and R3 are independently a H, C1-14 alkyl, or C2-14alkenyl. In some aspects, a subset of compounds of Formula (I) includes those of Formula (Ila), (lib), (lie), or (lie):
[0606]
[0607] or a pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof, wherein R4 is as described herein.
[0608] In some aspects, a subset of compounds of Formula (I) includes those of Formula (lid): (nd):
[0609]
[0610] or a pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof, wherein n is 2, 3, or 4; and m, R’, R”, and R2 through Re are as described herein. For example, each of R2 and R3 may be independently a C5-14 alkyl or C5-14 alkenyl.
[0611] In some aspects, an ionizable cationic lipid of the disclosure comprises a compound having structure:
[0612]
[0613] (Compound 1).
[0614] In some aspects, an ionizable cationic lipid of the disclosure comprises a compound having structure:
[0615]
[0616] (Compound II).
[0617] LNPs described herein can also be generated using the cationic lipids and compositions comprising them as are known in the art, see, e.g., PCT Publication Nos. WO2015 / 199952, WO2017 / 004143, WO2017 / 075531, WO2017 / 117528, WO2016 / 176330, WO2018 / 191657, WO2018 / 081480, WO2018 / 107026, WO2018 / 200943, WO2018 / 078053, WO2019 / 036000, WO2019 / 036028, WO2019 / 036030, WO2019 / 036008, W02020 / 061426, W02020 / 081938, W02020 / 146805, WO2021 / 030701, W02022 / 016070, WO2023 / 114944, WO2023 / 114937, WO2023 / 114943, WO2024 / 054843, and WO2023 / 250427, all of which are incorporated by reference herein in their entirety for all purposes.
[0618] In some aspects, an ionizable cationic lipid of the disclosure comprises a compound having structure:
[0619]
[0620] or a pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof, wherein: one of L1or L2is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)X-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O) =NRa-, NRaC(=O)NRa-, -OC(=O)NRa- or -NRaC(=O)O-, and the other of L1or L2is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, NRaC(=O)NRa-, -OC(=O)NRa- or -NRaC(=O)O- oradirect bond;
[0621] G1and G2are each independently unsubstituted C1-C12 alkylene or Ci- C12 alkenylene; G is C1-C24 alkylene, C1-C24 alkenylene, C3-C8 cycloalkylene, C3-C8 cycloalkenylene;
[0622] Rais H or C1-C12 alkyl;
[0623] R1and R2are each independently C6-C24 alkyl or C6-C24 alkenyl;
[0624] R3is H, OR5, CN, -C(=O)OR4, -OC(=O)R4or -NR5C(=O)R4;
[0625] R4is C1-C12 alkyl;
[0626] R5is H or Ci-Ce alkyl; and
[0627] x is 0, 1, or 2.
[0628] In some of the foregoing aspects, the ionizable cationic lipid comprises a compound having one of the following structures:
[0629]
[0630] or a pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof, wherein:
[0631] A is a 3 to 8-membered cycloalkyl or cycloalkylene ring;
[0632] R6is, at each occurrence, independently H, OH or C1-C24 alkyl; and
[0633] n is an integer ranging from 1 to 15.
[0634] In some of the foregoing aspects, the ionizable cationic lipid comprises a compound having one of the following structures:
[0635]
[0636] or a pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof, wherein y and z are each independently integers ranging from 1 to 12.
[0637] In any of the foregoing aspects, one of L1or L2is -O(C=O)-. For example, in some aspects, each of L1and L2are -O(C=O)-. In some aspects of any of the foregoing, L1and L2are each independently -(C=O)O- or -O(C=O)-. For example, in some aspects, each of L1and L2is -(C=O)O-.
[0638] In some of the foregoing aspects, the ionizable cationic lipid comprises a compound having one of the following structures:
[0639]
[0640] or a pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof.
[0641] In some of the foregoing aspects, the ionizable cationic lipid comprises a compound having one of the following structures:
[0642]
[0643] Ora pharmaceutically acceptable salt, tautomer, prodrug, or stereoisomer thereof. In some of the foregoing aspects, n is an integer ranging from 2 to 12, for example from 2 to 8 or from 2 to 4. For example, in some aspects, n is 3, 4, 5, or 6. In some aspects, n is 3. In some aspects, n is 4. In some aspects, n is 5. In some aspects, n is 6.
[0644] In some of the foregoing aspects, y and z are each independently an integer ranging from 2 to 10. For example, in some aspects, y and z are each independently an integer ranging from 4 to 9 or from 4 to 6.
[0645] In some of the foregoing aspects, R6is H. In other of the foregoing embodiments, R6is C1-C24 alkyl. In other aspects, R6is OH. In some embodiments, G is unsubstituted. In other aspects, G3is substituted. In various different aspects, G3is linear C1-C24 alkylene or linear Ci-024 alkenylene.
[0646] In some other foregoing embodiments, R1or R2, or both, is C6-C24 alkenyl. For example, in some embodiments, R1and R2each, independently have the following structure:
[0647]
[0648] wherein:
[0649] R7aand R7bare, at each occurrence, independently H or C1-C12 alkyl; and a is an integer from 2 to 12,
[0650] wherein R7a, R7b, and a are each selected such that R1and R2each independently comprise from 6 to 20 carbon atoms. For example, in some embodiments a is an integer ranging from 5 to 9 or from 8 to 12.
[0651] In some of the foregoing aspects, at least one occurrence of R7ais H. For example, in some aspects, R7ais H at each occurrence. In other different aspects of the foregoing, at least one occurrence of R7bis Ci-Cs alkyl. For example, in some embodiments, Ci-Cs alkyl is methyl, ethyl, n-propyl, iso-propyl, n- butyl, iso-butyl, tert-butyl, n-hexyl, or n-octyl.
[0652] In different aspects, R1or R2, or both, has one of the following:
[0653]
[0654] In some of the foregoing aspects, R3is OH, CN, -C(=O)OR4-OC(=O)R4or -NHC(=O)R4. In some aspects, R4is methyl or ethyl.
[0655] It is understood that any aspect of the compounds set forth above, and any specific substituent and / or variable in the compounds set forth above, may be independently combined with other aspects and / or substituents and / or variables of compounds to form aspects of the inventions not specifically set forth above. In addition, in the event that a list of substituents and / or variables is listed for any particular substituent and / or variable in a particular embodiment and / or claim, it is understood that each individual substituent and / or variable may be deleted from the particular aspect and / or claim and that the remaining list of substituents and / or variables will be considered to be within the scope of the disclosure. It is understood that in the present description, combinations of substituents and / or variables of the depicted formulae are permissible only if such contributions result in stable compounds.
[0656] In some embodiments, the cationic lipid is
[0657]
[0658] In some embodiments, the cationic lipid is
[0659]
[0660] In some aspects, the lipid nanoparticles comprise one or more cationic lipids. In one aspect, the lipid nanoparticles comprise (4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate) (ALC-0315), having the formula:
[0661]
[0662] Exemplary cationic lipids are disclosed in, e.g., U. S. 10,166,298, the full disclosure of which is herein incorporated by reference in its entirety for all purposes. Representative cationic lipids include:
[0663]
[0664]
[0665]
[0666]
[0667]
[0668]
[0669]
[0670] In yet another aspect, the ionizable cationic lipid is described in PCT Publication No. WO2015 / 199952, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of Formula (I):
[0671]
[0672] or a pharmaceutically acceptable salt, tautomer, prodrug or stereoisomer thereof, wherein:
[0673] L1and L2are each independently -O(C=O)-, -(C=O)O- or a carbon- carbon double bond; R1aand R1bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0674] R2aand R2bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0675] R3aand R3bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0676] R4aand R4bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R4ais H or C1-C12 alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0677] R5and R6are each independently methyl or cycloalkyl;
[0678] R7is, at each occurrence, independently H or C1-C12 alkyl;
[0679] R8and R9are each independently unsubstituted C1-C12 alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7- membered heterocyclic ring comprising one nitrogen atom;
[0680] a and d are each independently an integer from 0 to 24;
[0681] b and c are each independently an integer from 1 to 24; and
[0682] e is 1 or 2.
[0683] In other embodiments, the lipid compounds have the following Structure
[0684] (la):
[0685]
[0686] In another embodiment, the lipid compounds have the following Structure (lb):
[0687]
[0688] (lb).
[0689] In yet other embodiments, the lipid compounds have the following Structure (Ic):
[0690]
[0691] (Ic).
[0692] Compound Nos. 1-41 as specifically exemplified in Table 1 of PCT Publication No. WO2015 / 199952, and falling within the generic scope of Structures (I), (la), (lb) or (Ic) described above, are hereby incorporated herein by reference for all purposes.
[0693] In yet another aspect, the ionizable cationic lipid is described in PCT Publication No. WO2016 / 176330, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of Formula (I):
[0694]
[0695] or a pharmaceutically acceptable salt, tautomer, prodrug or stereoisomer thereof, wherein:
[0696] L1and L2are each independently -O(C=O)-, -(C=O)O- or a carbon carbon double bond; R1aand R1bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond; R2aand R2bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond; R3aand R3bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond; R4aand R4bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R4ais H or C1-C12 alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond; R5and R6are each independently methyl or cycloalkyl;
[0697] R7is, at each occurrence, independently H or C1-C12 alkyl;
[0698] R8and R9are each independently unsubstituted C1-C12 alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring comprising one nitrogen atom;
[0699] a and d are each independently an integer from 0 to 24;
[0700] b and c are each independently an integer from 1 to 24; and e is 1 or 2.
[0701] In one embodiment, the ionizable cationic lipid comprises a compound having a structure of
[0702] Formula (II):
[0703]
[0704] or a pharmaceutically acceptable salt, tautomer, prodrug or stereoisomer thereof, wherein: L1and L2are each independently -O(C=O)-, -(0=0)0-, -C(=0)-, -0-,
[0705] -S(0)x-, -S-S-, -C(=0)S-, -SC(=0)-, -NRaC(=O)-, -C(=O)NRa-, -NRaC(=O)NRa-, -OC(=O)NRa-, -NRaC(=O)O-, or a direct bond;
[0706] G1is C1-C2 alkylene, -(C=O)-, -O(C=O)-, -SC(=O)-, -NRaC(=O)- or a direct bond;
[0707] G2is -C(=O)-, -(C=O)O-, -C(=O)S-, -C(=O)NRaor a direct bond;
[0708] G3is Ci-Ce alkylene;
[0709] Rais H or C1-C12 alkyl;
[0710] R1aand R1bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond; R2aand R2bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond; R3aand R3bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond; R4aand R4bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R4ais H or C1-C12 alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond; R5and R6are each independently H or methyl;
[0711] R7is C4-C20 alkyl;
[0712] R8and R9are each independently C1-C12 alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring;
[0713] a, b, c and d are each independently an integer from 1 to 24; and x is 0, 1 or 2.
[0714] In one embodiment, the ionizable cationic lipid comprises a compound having a structure of Formula (III):
[0715]
[0716] or a pharmaceutically acceptable salt, tautomer, prodrug or stereoisomer thereof, wherein: one of L1or L2is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)X-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, NRaC(=O)NRa-, -OC(=O)NRa- or -NRaC(=O)O-, and the other of L1or L2is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O)NRa-,, NRaC(=O)NRa-, -OC(=O)NRa- or -NRaC(=O)O- or a direct bond;
[0717] G1and G2are each independently unsubstituted C1-C12 alkylene or C1-C12 alkenylene;
[0718] G3is C1-C24 alkylene, C1-C24 alkenylene, C3-C8 cycloalkylene, C3-C8 cycloalkenylene;
[0719] Rais H or C1-C12 alkyl;
[0720] R1and R2are each independently C6-C24 alkyl or C6-C24 alkenyl; R3is H, OR5, CN, -C(=O)OR4, -OC(=O)R4or -NR5C(=O)R4;
[0721] R4is C1-C12 alkyl;
[0722] R5is H or Ci-Ce alkyl; and
[0723] x is 0, 1 or 2.
[0724] Compound Nos. 1-1 to 1-41 as specifically exemplified in Table 1, Compound Nos. 11-1 to II-34 as specifically exemplified in Table 2, and Compound Nos. 111-1 to HI-36 as specifically exemplified in Table 3, of PCT Publication No. WO2016 / 176330, and falling within the generic scope of Structures (I), (II) or (III) described above, are hereby incorporated herein by reference for all purposes.
[0725] In yet another aspect, the ionizable cationic lipid is described in PCT Publication No. WO2017 / 004143, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of Formula (I):
[0726]
[0727] or a pharmaceutically acceptable salt, tautomer, prodrug or stereoisomer thereof, wherein:
[0728] L1and L2are each independently -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)X-, -S-S-, -C(=O)S-, -SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, -NRaC(=O)NRa-, -OC(=O)NRa-, -NRaC(=O)O- or a direct bond;
[0729] G1is C1-C2 alkylene, - (C=O)-, -O(C=O)-, -SC(=O)-, -NRaC(=O)- or a direct bond;
[0730] G2is -C(=O)-, -(C=O)O-, -C(=O)S-, -C(=O)NRa- or a direct bond;
[0731] G3is Ci-Ce alkylene;
[0732] Rais H or C1-C12 alkyl;
[0733] R1aand R1bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0734] R2aand R2bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0735] R3aand R3bare, at each occurrence, independently either (a): H or C1-C12 alkyl; or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R and the carbon atom to which it is bound to form a carbon-carbon double bond;
[0736] R4aand R4bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R4ais H or C1-C12 alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0737] R5and R6are each independently H or methyl;
[0738] R7is C4-C20 alkyl;
[0739] R8and R9are each independently C1-C12 alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring;
[0740] a, b, c and d are each independently an integer from 1 to 24; and x is 0, 1 or 2.
[0741] In one embodiment, the cationic lipid comprises a compound having a structure of Formula (IA), (IB), (IC) or (ID):
[0742]
[0743] wherein e, f, g and h are each independently an integer from 1 to 12.
[0744] In different aspects, Rbis branched C1-C15 alkyl. For
[0745] example, in some embodiments Rbhas one of the following structures:
[0746]
[0747] Compound Nos. 1-46 as specifically exemplified in Table 1 of PCT Publication No. W02017 / 004143 described above, are hereby incorporated herein by reference for all purposes. In another aspect, the cationic lipid is described in PCT Publication No. WO2017 / 117528, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, a cationic lipid of the disclosure comprises a compound of Formula (I):
[0748]
[0749] or a pharmaceutically acceptable salt, prodrug or stereoisomer thereof.
[0750] Compound Nos. 1-3 as specifically exemplified in Table 1 of PCT Publication No. WO2017 / 117528 described above, are hereby incorporated herein by reference for all purposes.
[0751] In another aspect, the cationic lipid is described in PCT Publication No. WO2018 / 191657, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, a cationic lipid of the disclosure comprises a compound of Formula (I):
[0752]
[0753] or a pharmaceutically acceptable salt, prodrug or stereoisomer thereof, wherein:
[0754] G1is -OH, -NR3R4, -(C=O)NR5or -NR3(C=O)R5;
[0755] G2is -CH2- or -(C=O)-;
[0756] R is, at each occurrence, independently H or OH;
[0757] R1and R2are each independently optionally substituted branched, saturated or unsaturated C12-C36 alkyl;
[0758] R3and R4are each independently H or optionally substituted straight or branched, saturated or unsaturated Ci-Ce alkyl;
[0759] R5is optionally substituted straight or branched, saturated or unsaturated Ci-Ce alkyl; and n is an integer from 2 to 6.
[0760] In one embodiment, the cationic lipid comprises a compound having a structure of Formula (IA):
[0761]
[0762] R6and R7are, at each occurrence, independently H or straight or branched, saturated or unsaturated C1-C14 alkyl;
[0763] a and b are each independently an integer ranging from 1 to 15, provided that R6and a, and R7and b, are each independently selected such that R1and R2, respectively, are each independently branched, saturated or unsaturated C12-C36 alkyl.
[0764] In one embodiment, the cationic lipid comprises a compound having a structure of Formula (IB):
[0765]
[0766] wherein R8, R9, R10and R11are each independently straight or branched, saturated or unsaturated C4-C12 alkyl, provided that R8and R9, and R10and R11, are each independently selected such that R1and R2, respectively, are each independently branched, saturated or unsaturated C12-C36alkyl.
[0767] In different aspects, R1and R2have the following structure:
[0768]
[0769] Compound Nos. 1-17 as specifically exemplified in Table 1 of PCT Publication No. WO2018 / 191657 described above, are hereby incorporated herein by reference for all purposes.
[0770] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2018 / 081480, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, a cationic lipid of the disclosure comprises a compound of Structure (I), (II), (III), (IV) or (IV), or a pharmaceutically acceptable salt, prodrug or stereoisomer thereof. Compound Nos. 1-1 to 1-41 as specifically exemplified in Table 1, Compound Nos. 11-1 to II-46 as specifically exemplified in Table 2, Compound Nos. 111-1 to HI-49 as specifically exemplified in Table 3, and Compound Nos. IV-1 to IV-3 as specifically exemplified in Table 4 of PCT Publication No. WO2018 / 081480 described above, are hereby incorporated herein by reference for all purposes.
[0771] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2018 / 107026, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, a cationic lipid of the disclosure is selected from compounds having the following Formulas (I, H, III and IV):
[0772]
[0773] or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein, for Formula (I):
[0774] L1and L2are each independently -O(C=O)-, (C=O)O- or a carbon-carbon double bond; R1aand R1bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0775] R2aand R2bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0776] R3aand R3bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0777] R4aand R4bare, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R4ais H or C1-C12 alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0778] R5and R6are each independently methyl or cycloalkyl; R7is, at each occurrence, independently H or C1-C12 alkyl;
[0779] R8and R9are each independently unsubstituted C1-C12 alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring comprising one nitrogen atom; a and d are each independently an integer from 0 to 24; b and c are each independently an integer from 1 to 24; and e is 1 or 2,
[0780] for Formula (II):
[0781] L1and L2are each independently -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, -SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, -NRaC(=O)NRa-, -OC(=O)NRa-, -NRaC(=O)O- ora direct bond;
[0782] G1is C1-C2 alkylene, -(C=O)-, -O(C=O)-, -SC(=O)-, -NRaC(=O)- or a direct bond;
[0783] G2is -C(=O)-, -(C=O)O-, -C(=O)S-, -C(=O)NRa- or a direct bond;
[0784] G3is C1-C6alkylene;
[0785] Rais H or C1-C12 alkyl; R1aand R1bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0786] R2aand R2bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0787] R3aand R3bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0788] R4aand R4bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R4ais H or C1-C12 alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0789] R5and R6are each independently H or methyl;
[0790] R7is C4-C20 alkyl;
[0791] R8and R9are each independently C1-C12 alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring;
[0792] a, b, c and d are each independently an integer from 1 to 24; and
[0793] x is 0, 1 or 2;
[0794] for Formula (III):
[0795] one of L1or L2is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, NRaC(=O)NRa-, -OC(=O)NRa-, -NRaC(=O)O-, and the other of L1or L2is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, -NRaC(=O)NRa-, -OC(=O)NRa- or -NRaC(=O)O- or a direct bond;
[0796] G1and G2are each independently unsubstituted C1-C12 alkylene or C1-C12 alkenylene; G3is 01-024 alkylene, 01-024 alkenylene, 03-08 cycloalkylene, 03-08 cycloalkenylene; Rais H or C1-C12 alkyl;
[0797] R1and R2are each independently 06-024 alkyl or 06-024 alkenyl;
[0798] R3is H, OR5, ON, -C(=O)OR4, -OC(=O)R4or -NR5C(=O)R4;
[0799] R4is 01-012 alkyl;
[0800] R5is H or 01-06 alkyl; and
[0801] x is 0, 1 or 2; and
[0802] for Formula (IV): one of L1or L2is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, NRaC(=O)NRa-, -OC(=O)NRa-, -NRaC(=O)O-, and the other of L1or L2is -O(C=O)-, -(C=O)O-, -C(=O)-, -O-, -S(O)x-, -S-S-, -C(=O)S-, SC(=O)-, -NRaC(=O)-, -C(=O)NRa-, -NRaC(=O)NRa-, -OC(=O)NRa- or -NRaC(=O)O- or a direct bond;
[0803] G1and G2are each independently unsubstituted 01-012 alkylene or 01-012 alkenylene; G3is 01-024 alkylene, 01-024 alkenylene, 03-08 cycloalkylene, 03-08 cycloalkenylene; Rais H or C1-C12 alkyl;
[0804] R1and R2are each independently 06-024 alkyl or 06-024 alkenyl;
[0805] R3is H, OR5, ON, -0(=0)0R4, -0C(=0)R4or -NR5C(=O)R4;
[0806] R4is 01-012 alkyl;
[0807] R5is H or 01-06 alkyl; and
[0808] x is 0, 1 or 2.
[0809] In one embodiment, the cationic lipid is selected from any one of Compound Nos. 1-1 to I-41 as specifically exemplified in Table 1, Compound Nos. 11-1 to II-36 as specifically exemplified in Table 2, Compound Nos. 111-1 to HI-49 as specifically exemplified in Table 3, and Compound Nos. 1 to 17 as specifically exemplified in Table 4, of PCT Publication No. WO2018 / 107026, which Tables and compounds listed therein are hereby incorporated herein by reference for all purposes.
[0810] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2018 / 200943, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, a cationic lipid of the disclosure is selected from compounds having the following Structures (I) or (II):
[0811]
[0812] 0) (H)
[0813] or a pharmaceutically acceptable salt, prodrug or stereoisomer thereof, wherein:
[0814] L1is -O(C=O)R1, -(C=O)OR1, -C(=O)R1, -OR1, -S(O)xR1, -S-SR1, -C(=O)SR1, -SC(=O)R1, -NRaC(=O)R1, -C(=O)NRbRc, -NRaC(=O)NRbRc, -OC(=O)NRbRcor -NRaC(=O)OR1;
[0815] L2is -O(C=O)R2, -(C=O)OR2, -C(=O)R2, -OR2, -S(O)xR2, -S-SR2, -C(=O)SR2, -SC(=O)R2, -NRdC(=O)R2, -C(=O)NReRf, -NRdC(=O)NReRf, -OC(=O)NReRf; -NRdC(=O)OR2or a direct bond to R2;
[0816] G1aand G2aare each independently C2-C12 alkylene or C2-C12 alkenylene;
[0817] G1band G2bare each independently C1-C12 alkylene or C2-C12 alkenylene; G3is C1-C24 alkylene, C2-C24 alkenylene, C3-C8 cycloalkylene or Cs-Cg cycloalkenylene;
[0818] Ra, Rb, Rdand Reare each independently H or C1-C12 alkyl or C2-C12 alkenyl;
[0819] Rcand Rfare each independently C1-C12 alkyl or C2-C12 alkenyl;
[0820] R1and R2are each independently branched C6-C24alkyl or branched C6-C24alkenyl;
[0821]
[0822] R4ais C1-C12 alkyl;
[0823] R4bis H, C1-C12 alkyl or C2-C12 alkenyl;
[0824] R5ais H, C1-C8 alkyl or C2-Cg alkenyl;
[0825] R5bis C2-C12 alkyl or C2-C12 alkenyl when R4bis H; or R5bis C1-C12 alkyl or C2-C12 alkenyl when R4bis C1-C12 alkyl or C2-C12 alkenyl;
[0826] R6is H, aryl or aralkyl; and
[0827] x is 0, 1 or 2, and
[0828] wherein each alkyl, alkenyl, alkylene, alkenylene, cycloalkylene, cycloalkenylene, aryl and aralkyl is independently substituted or unsubstituted.
[0829] In one embodiment, a cationic lipid of the disclosure is selected from compounds having the following Structures (I A.) or (HA):
[0830]
[0831] (I A) (HA)
[0832] wherein y1 and z1 are each independently integers ranging from 2 to 12, and y2 and z2 are each independently integers ranging from 1 to 12.
[0833] In another embodiment, a cationic lipid of the disclosure is selected from compounds having the following Structures (IB), (IC), (ID), (IE), (I IB) or (IIC):
[0834]
[0835] (JIB) (liC)
[0836] In another embodiment, a cationic lipid of the disclosure is selected from compounds having the following Structures (IF). (IG), (IH), (I J), (HD) or (HE):
[0837]
[0838] (HD) (HE)
[0839] In different aspects, R or R2, or both, independently has one of the following structures:
[0840]
[0841] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. I-1 to 1-19 as specifically exemplified in Table 1, or Compound Nos. 11-1 to II-20 as specifically exemplified in Table 2, of PCT Publication No. WO2018 / 200943, which Tables and compounds listed therein are hereby incorporated herein by reference for all purposes.
[0842] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2018 / 078053, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, a cationic lipid of the disclosure is a compound having Formula (I):
[0843]
[0844] or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein:
[0845] L1and L2are each independently —O(C=O)—, —(C=O)O— or a carbon-carbon double bond;
[0846] R1aand R1bare, at each occurrence, independently either (a) H or C1-C12, alkyl, or (b) R1ais H or C1-C12, alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0847] R2aand R2bare, at each occurrence, independently either (a) H or C1-C12, alkyl, or (b) R2ais H or C1-C12, alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0848] R3aand R3bare, at each occurrence, independently either (a) H or C1-C12, alkyl, or (b) R3ais H or C1-C12, alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond; R4aand R4bare, at each occurrence, independently either (a) H or C1-C12, alkyl, or (b) R4ais H or Ci-Ci?, alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0849] R5and R6are each independently methyl or cycloalkyl;
[0850] R7is, at each occurrence, independently H or C1-C12, alkyl;
[0851] R8and R9are each independently C1-C12, alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring comprising one nitrogen atom;
[0852] a and d are each independently an integer from 0 to 24;
[0853] b and c are each independently an integer from 1 to 24; and
[0854] e is 1 or 2.
[0855] In another embodiment, a cationic lipid of the disclosure is a compound having Formula
[0856]
[0857] (ID
[0858] or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein:
[0859] L1and L2are each independently — O(C==O) —, — (0=0)0 —, — C(=O) —, — O —, — S — S—, — C(=O)S— — SC(=O)—, — NRaC(=O)—, — C(=O)NRa—, — NRaC(=O)NRa—, — OC(=O)NRa—, — NRaC(=O)O —, or a direct bond;
[0860] G1is C1-C2alkylene, — (C=O)—, — O(C=O)—, — SC(=O)—, — NRaC(=O)— or a direct bond
[0861] G2is — C(— O) —, —(0=0)0—, — C(=O)S —, — C(=O)NRa— or a direct bond;
[0862] G3is Ci-Ce alkylene;
[0863] Rais, at each occurrence, independently H or C1-C12 alkyl;
[0864] R1aand R13are, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) Rlais H or C1-C12, aikyi, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1bnd the carbon atom to which it is bound to form a carbon-carbon double bond; R2aand R2bare, at each occurrence, independently either: (a) H or C1-C12, alkyl; or (b) R2ais H or C1-C12, alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0865] R3aand R3bare, at each occurrence, independently either: (a) H or C1-C12, alkyl; or (b) R3ais H or C1-C12, alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0866] R4aand R4bare, at each occurrence, independently either: (a) H or C1-C12, alkyl; or (b) R4ais H or C1-C12, alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0867] R5and R6are each independently H or methyl;
[0868] R7is C4-C20 alkyl;
[0869] R8and R9are each independently C1-C12, alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring;
[0870] a, b, c and d are each independently an integer from 1 to 24; and
[0871] x is 0, 1 or 2.
[0872] In another embodiment, a cationic lipid of the disclosure is a compound having Formula (Hi):
[0873]
[0874] or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein:
[0875] L1and L2are each independently — O(C=O)—, — (C=O)O—, — C(=O) —, — O —, — S(O)x—, — S— S—, — C(=O)S—, — SC(=O)—, — NRaC(=O)—, — C(=O)NRa—, — NRaC(=O)NRa—, — OC(=O)NRa— or — NRaC(=O)O—;
[0876] G1and G2are each independently unsubstituted C1-C12alkylene or C1-C12alkenylene; G3is C1-C24alkylene, C1-C24alkenylene, C3-C8cycloalkylene, or C3-C8cycloalkenylene; Rais, at each occurrence, independently H or C1-C12, alkyl;
[0877] R1and R2are each independently C5-C24 alkyl or C5-C24 alkenyl;
[0878] R3is OR5, CN, — C(=O)OR4, — OC(=O)R4or — NR5C(=O)R4;
[0879] R4is C1-C12 alkyl;
[0880] R5is H or Ci-Ce alkyl; and x is 0, 1 or 2.
[0881] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. I-1 to 1-41 as specifically exemplified in Table 7, or Compound Nos. 11-1 to II-36 as specifically exemplified in Table 8, or Compound Nos. 111-1 to III-36 as specifically exemplified in Table 9, of PCT Publication No. WO2018 / 078053, which Tables and compounds listed therein are hereby incorporated herein by reference for all purposes.
[0882] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2019 / 036000, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of Formula (I):
[0883]
[0884] or a pharmaceutically acceptable salt, tautomer, prodrug or stereoisomer thereof, wherein:
[0885] L1and L2are each independently — O(C=O) —, — (C=O)O —, — C(=O) —, — O —, — S(O)x—, — S— S—, — C(=O)S—, — SC(=O)—, — NRaC(=O)—, — C(=O)NRa—, — NRaC(=O)NRa—, — OC(=O)NRa—, — NRaC(=O)O— or a direct bond;
[0886] G1is C1-C2 alkylene, — (C=O)—, — O(C=O)—, — SC(=O)—, — NRaC(=O)— or a direct bond;
[0887] G2is — C(=O)—, — (C=O)O—, — C(=O)S—, — C(=O)NRa— or a direct bond;
[0888] G3is Ci-Ce alkylene;
[0889] Rais H or C1-C12 alkyl;
[0890] R1aand R1bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R'b and the carbon atom to which it is bound to form a carbon-carbon double bond;
[0891] R2aand R2bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond; R3aand R3bare, at each occurrence, independently either (a): H or C1-C12 alkyl; or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0892] R4aand R4bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R4ais H or C1-C12 alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond;
[0893] R5and R6are each independently H or methyl;
[0894] R7is H or C1-C20 alkyl;
[0895] R8is OH, — N(R9)(C=O)R10, — (C=O)NR9R10, — NR9R10, — (C=O)OR11or — O(C=O)R11, provided that G3is C4-C6 alkylene when R8is — NR9R10,
[0896] R9and R10are each independently H or C1-C12 alkyl;
[0897] R11is aralkyl;
[0898] a, b, c and d are each independently an integer from 1 to 24; and
[0899] x is 0, 1 or 2,
[0900] wherein each alkyl, alkylene and aralkyl is optionally substituted.
[0901] In another embodiment, a cationic lipid of the disclosure is a compound having the following structures (IA) or (IB):
[0902] (IA)
[0903]
[0904] In another embodiment, a cationic lipid of the disclosure is a compound having the following structures (IC) or (ID):
[0905]
[0906] wherein e, f, g and h are each independently an integer from 1 to 12.
[0907] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. 1-37 as specifically exemplified in Table 1 of PCT Publication No. WO2019 / 036000, which Table and compounds listed therein are hereby incorporated herein by reference for all purposes.
[0908] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2019 / 036028, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of structure (I):
[0909] (0
[0910]
[0911] or a pharmaceutically acceptable salt or stereoisomer thereof, wherein:
[0912] X and X' are each independently N or CR;
[0913] Y and Y' are each independently absent, — O(C=O) —, — (C=O)O — or NR, provided that: a) Y is absent when X is N;
[0914] b) Y' is absent when X' is N;
[0915] c) Y is — O(C=O) —, — (C=O)O — or NR when X is CR; and
[0916] d) Y' is — O(C=O)—, — (C=O)O— or NR when X' is CR,
[0917] L1and L1' are each independently — O(C=O)R1, — (C=O)OR1, — C(=O)R1, — OR1, — S(O)zR1, — S— SR1, — C(=O)SR1, — SC(=O)R1, — NRaC(=O)R1, — C(=O)NRbRc, — N RaC(=O) N RbRc, — OC(=O) N RbRcor — N RaC(=O)OR1; L2and L2' are each independently — O(C=O)R2, — (C=O)OR2, — C(=O)R2, — OR2, — S(O)zR2, — S— SR2, — C(=O)SR2, — SC(=O)R2, — NRdC(=O)R2, — C(=O)NReRf, — NRdC(=O)NReRf, — OC(=O)NReRf; — NRdC(=O)OR2or a direct bond to R2;
[0918] G1, G1', G2and G2' are each independently C4-C8 alkylene or C2-C8 alkenylene;
[0919] G3is C2-C24 heteroalkylene or C2-C24 heteroalkenylene;
[0920] Ra, Rb, Rdand Reare, at each occurrence, independently H, C1-C12 alkyl or C2-C12 alkenyl; Rcand Rfare, at each occurrence, independently C1-C12alkyl or C2-C12alkenyl;
[0921] R is, at each occurrence, independently H or C1-C12 alkyl;
[0922] R1and R2are, at each occurrence, independently branched C6-C24 alkyl or branched Ce-C24 alkenyl;
[0923] z is 0, 1 or 2, and
[0924] wherein each alkyl, alkenyl, alkylene, alkenylene, heteroalkylene and heteroalkenylene is independently substituted or unsubstituted unless otherwise specified.
[0925] In another embodiment, a cationic lipid of the disclosure is a compound having any one of the following structures (IA), (IB), (IC), (ID), (IE), (IF), (IG) or (IH):
[0926]
[0927] wherein Rdis, at each occurrence, independently H or optionally substituted Ci-Ce alkyl.
[0928] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. 1-11 as specifically exemplified in Table 1 of PCT Publication No. WO2019 / 036028, which Table and compounds listed therein are hereby incorporated herein by reference for all purposes.
[0929] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2019 / 036030, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of structure (I): (I)
[0930]
[0931] or a pharmaceutically acceptable salt, prodrug or stereoisomer thereof, wherein: one of L1or L2is — O (C=O)—, — (C=O)O—, — C(=O)—, — O—, — S— S—, — C(=O)S—, — SC(=O)—, — NRaC(=O)—, — C(=O)NRa—, NRaC(=O)NRa—, — OC(=O)NRa— or — NRaC(=O)O—, and the other of L1or L2is — O(C=O)—, — (C=O)O—, — C(=O)—, — O—, — S(O)x—, — S— S—, — C(=O)S—, SC(=O)—, — NRaC(=O)—, — C(=O)NRa— NRaC(=O)NRa—, — OC(=O)NRa— or — NRaC(=O)O — or a direct bond;
[0932] G1and G2are each independently unsubstituted C1-C12 alkylene or C1-C12 alkenylene; G3is C1-C24 alkylene, C1-C24 alkenylene, C3-C8 cycloalkylene, C3-C8 cycloalkenylene; Rais H or C1-C12 alkyl;
[0933] R1and R2are each independently C6-C24 alkyl or C6-C24 alkenyl;
[0934] R3is H, OR5, CN, — C(=O)OR4, — OC(=O)R4or — NR5C(=O)R4;
[0935] R4is C1-C12 alkyl;
[0936] R5is H or Ci-Ce alkyl; and
[0937] x is 0, 1 or 2.
[0938] In another embodiment, a cationic lipid of the disclosure is a compound having any one of the following structures (IA), (IB), (IC) or (ID):
[0939]
[0940] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. 1- 12 as specifically exemplified in Table 1 of PCT Publication No. WO2019 / 036030, which Table and compounds listed therein are hereby incorporated herein by reference for all purposes.
[0941] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2019 / 036008, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of structure (I):
[0942]
[0943] or a pharmaceutically acceptable salt or stereoisomer thereof, wherein: L1is — O(C=O)R1, — (C=O)OR1, — C(=O)R1, —OR1, — S(O)XR1, — S— SR1, — C(=O)SR1, — SC(=O)R1, — NRaC(=O)R1, — C(=O)NRbRc, — NRaC(=O)NRbRc, — OC(=O)NRbRcor — NRaC(=O)OR1;
[0944] L2is — O(C=O)R2, — (C=O)OR2, — C(=O)R2, —OR2, — S(O)XR2, — S— SR2, — C(=O)SR2, — SC(=O)R2, — NRdC(=O)R2, — C(=O)NReRf, — NRdC(=O)NReRf, — OC(=O)NReRf; — NRdC(=O)OR2or a direct bond to R2;
[0945] G1and G2are each independently C2-C12 alkylene or C2-C12 alkenylene;
[0946] G3is C1-C24 alkylene, C2-C24 alkenylene, C3-C8 cycloalkylene or C3-C8 cycloalkenylene; Ra, Rb, Rdand Reare each independently H, C1-C12 alkyl or C1-C12 alkenyl;
[0947] Rcand Rfare each independently C1-C12 alkyl or C2-C12 alkenyl;
[0948] R1and R2are each independently branched C6-C24 alkyl or branched C6-C24 alkenyl; R3is — N(R4)R5;
[0949] R4is C1-C12 alkyl;
[0950] R5is substituted C1-C12 alkyl, wherein R5is substituted with one or more substituents selected from the group consisting of — OR9, — NR9C(=O)Rh, — C(=O)NR9Rh, — C(=O)Rh, — OC(=O)Rh, — C(=O)ORhand — OR'OH, wherein:
[0951] R9is, at each occurrence independently H or Ci-Ce alkyl;
[0952] Rhis at each occurrence independently Ci-Ce alkyl; and
[0953] R' is, at each occurrence independently Ci-Ce alkylene; and
[0954] x is 0, 1 or 2, and
[0955] wherein each alkyl, alkenyl, alkylene, alkenylene, cycloalkylene and cycloalkenylene is independently substituted or unsubstituted unless otherwise specified.
[0956] In another embodiment, a cationic lipid of the disclosure is a compound having the following structures (IA),
[0957]
[0958] wherein y and z are each independently integers ranging from 2 to 12.
[0959] In another embodiment, a cationic lipid of the disclosure is a compound having any one of the following structures (IB), (IC), (ID) or (IE):
[0960]
[0961] In another embodiment, a cationic lipid of the disclosure is a compound having any one of the following structures (IF), (IG), (IH) or (IJ): GF)
[0962]
[0963] wherein y and z are each independently integers ranging from 2-12.
[0964] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. 1-18 as specifically exemplified in Table 1 of PCT Publication No. WO2019 / 036008, which Table and compounds listed therein are hereby incorporated herein by reference for all purposes.
[0965] In yet another aspect, the cationic lipid is described in PCT Publication No. W02020 / 081938, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of structure (I):
[0966] a:
[0967]
[0968] or a pharmaceutically acceptable salt, tautomer, or stereoisomer thereof, wherein:
[0969] G1is — N(R3)R4or —OR';
[0970] R1is optionally substituted branched, saturated or unsaturated C12-C36 alkyl; R2is optionally substituted branched or unbranched, saturated or unsaturated C12-C36 alkyl when L is — C(=O) —; or R2is optionally substituted branched or unbranched, saturated or unsaturated C4-C36 alkyl when L is C6-C12 alkylene, C6-C12 alkenylene, or C2-Cealkynylene;
[0971] R3and R4are each independently H, optionally substituted branched or unbranched, saturated or unsaturated Ci-Ce alkyl; or R3and R4are each independently optionally substituted branched or unbranched, saturated or unsaturated Ci-Ce alkyl when L is C6-C12 alkylene, Ce-C12 alkenylene, or C2-Cealkynylene; or R3and R4, together with the nitrogen to which they are attached, join to form a heterocyclyl;
[0972] R5is H or optionally substituted Ci-Ce alkyl;
[0973] L is — C(=O) —, C6-C12 alkylene, C6-C12 alkenylene, or C2-Cealkynylene; and
[0974] n is an integer from 1 to 12.
[0975] In another embodiment, a cationic lipid of the disclosure is a compound having the following structure (IA):
[0976] OA;
[0977]
[0978] wherein
[0979] R8and R9are each independently H or optionally substituted branched or unbranched, saturated or unsaturated C2-C12 alkyl, provided that R8and R9are each independently selected such that R1is optionally substituted branched, saturated or unsaturated C12-C36 alkyl; and R10and R11are each independently H or optionally substituted branched or unbranched, saturated or unsaturated C2-C12 alkyl, provided that R10and R11are each independently selected such that: R2is optionally substituted branched or unbranched, saturated or unsaturated C12-C36 alkyl when L is — C(=O) —; and R2is optionally substituted branched or unbranched, saturated or unsaturated C4-C36 alkyl when L is C6-C12 alkylene, C6-C12 alkenylene, or C2-Cealkynylene.
[0980] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. I-1 to I-22 as specifically exemplified in Table 1 of PCT Publication No. W02020 / 081938, which Table and compounds listed therein are hereby incorporated herein by reference for all purposes.
[0981] In yet another aspect, the cationic lipid is described in PCT Publication No. W02020 / 146805, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of structure (I):
[0982]
[0983] or a pharmaceutically acceptable salt, tautomer, or stereoisomer thereof, wherein:
[0984] R1is optionally substituted C1-C24 alkyl or optionally substituted C2-C24 alkenyl;
[0985] R2and R3are each independently optionally substituted C1-C36 alkyl;
[0986] R4and R5are each independently optionally substituted C1-C6 alkyl, or R4and R5join, along with the N to which they are attached, to form a heterocyclyl or heteroaryl;
[0987] L1, L2, and L3are each independently optionally substituted C1-C1xalkylene;
[0988] G1is a direct bond, -(CH2)n0(C=0)-, -(CH2)n(C=0)0-, or -(0=0)-;
[0989] G2and G3are each independently -(C=O)O- or -O(C=O)-; and n is an integer greater than 0.
[0990] In another embodiment, a cationic lipid of the disclosure is a compound having the following structure (IA):
[0991]
[0992] In another embodiment, a cationic lipid of the disclosure is a compound having the following structure (IB):
[0993]
[0994] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. I-1 to I-40 as specifically exemplified in Table 1 of PCT Publication No. W02020 / 146805, which Table and compounds listed therein are hereby incorporated herein by reference for all purposes.
[0995] In yet another aspect, the cationic lipid is described in PCT Publication No. W02022 / 016070, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of structure (I):
[0996]
[0997] or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein:
[0998] G1and G2are each independently Ci-Ce alkylene;
[0999] L1and L2are each independently — O(C=O) — or — (C=O)O —;
[1000] R1aand R1bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R1ais H or C1-C12 alkyl, and R1btogether with the carbon atom to which it is bound is taken together with an adjacent R1band the carbon atom to which it is bound to form a carbon-carbon double bond;
[1001] R2aand R2bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R2ais H or C1-C12 alkyl, and R2btogether with the carbon atom to which it is bound is taken together with an adjacent R2band the carbon atom to which it is bound to form a carbon-carbon double bond;
[1002] R3aand R3bare, at each occurrence, independently either (a): H or C1-C12 alkyl; or (b) R3ais H or C1-C12 alkyl, and R3btogether with the carbon atom to which it is bound is taken together with an adjacent R3band the carbon atom to which it is bound to form a carbon-carbon double bond;
[1003] R4aand R4bare, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R4ais H or C1-C12 alkyl, and R4btogether with the carbon atom to which it is bound is taken together with an adjacent R4band the carbon atom to which it is bound to form a carbon-carbon double bond;
[1004] R5and R6are each independently H or methyl;
[1005] R7is — O(C=O)R10, — (C=O)OR10, — NR9(C=O)R10or— (C=O)NR9R10;
[1006] R8is OH, — N(R11)(C=O)R12, — (C=O)NR11R12, — NR11R12, — (C=O)OR'2or — O(C=O)R'2;
[1007] R9is H or C1-C15 alkyl;
[1008] R10is C1-C15 alkyl;
[1009] R11is H or Ci-C6alkyl; R12is Ci-C6alkyl;
[1010] X is — (C=0) — or a direct bond; and
[1011] a, b, c and d are each independently an integer from 1 to 24;
[1012] wherein each methyl, alkyl and alkylene is independently optionally substituted.
[1013] In another embodiment, a cationic lipid of the disclosure is a compound having any one of the following structures (IA) or (IB):
[1014]
[1015] or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof.
[1016] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. I-1 to I-23 as specifically exemplified in Table 1 of PCT Publication No. W02022 / 016070, which Table and compounds listed therein are hereby incorporated herein by reference for all purposes.
[1017] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2023 / 114944, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of the disclosure comprises a compound of structure (I):
[1018]
[1019] or a pharmaceutically acceptable salt, tautomer, or stereoisomer thereof, wherein: L1is -O(C=O)R1a, -(C=O)OR1a, -C(=O)R1a, -OR1a, -S(O)xR1a, -S-SR1a, - C(=O)SR1a, -SC(=O)R1a, -NRaC(=O)R1a, -C(=O)NRaR1a, -NRaC(=O)NRaR1a, - OC(=O)NRaR1a, -NRaC(=O)OR1aor R1b; L2is -O(C=O)R4a, -(C=O)OR4a, -C(=O)R4a, -OR4a, -S(O)xR4a, -S-SR4a, - C(=O)SR4a, -SC(=O)R4a, -NRaC(=O)R4a, -C(=O)NRaR4a, -NRaC(=O)NRaR4a, - OC(=O)NRaR4a, -NRaC(=O)OR4a, or R4b; G1is C1-C2 alkylene, - (C=O)-, -O(C=O)-, -SC(=O)-, -NRaC(=O)- or a direct bond; G2is -C(=O)-, -(C=O)O-, -C(=O)S-, -C(=O)NRa- or a direct bond; G3is Ci-Ce alkylene; Rais H or C1-C12 alkyl; R1aand R4aare each independently branched C6-C24 alkyl, branched C6-C24 alkenyl, branched C6-C24 fluoroalkyl, branched C6-C24 fluoroalkenyl, C6-C24 alkylacetal or C6-C24 fluoroalkylacetal; R1band R4bare each independently -CH(0R)(0R), wherein each R is independently linear or branched Ce-Cis alkyl, linear or branched Ce-C18 alkenyl, linear or branched C6-C18 fluoroalkyl, or linear or branched C6-C18 fluoroalkenyl R2aand R2bare, at each occurrence, independently H, F, C1-C12 alkyl, or C1-C12 fluoroalkyl; R3aand R3bare, at each occurrence, independently H, F, C1-C12 alkyl, or C1-C12 fluoroalkyl; R7is H, C4-C20 alkyl, or C2-C10 fluoroalkyl; R8and R9are each independently C1-C12 alkyl; or R8and R9, together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring; b and c are each independently an integer from 1 to 24; and wherein at least one of R2a, R2b, R3a, and R3bis F or C1-C12 fluoroalkyl; at least one of R1aand R4ais present and selected from branched 06-024 fluoroalkyl, branched C6-C24 fluoroalkenyl and Ce-C24 fluoroalkylacetal; at least one of R1band R4bis present and selected from linear or branched 06-018 fluoroalkyl and linear or branched 06-018 fluoroalkenyl; G3is Ci-Ce fluoroalkylene; and / or R7is C2-C10 fluoroalkyl.
[1020] In another embodiment, a cationic lipid of the disclosure is a compound having any one of the following structures (IA) or (IB):
[1021]
[1022] In a further embodiment, the cationic lipid is selected from any one of Compound Nos. I-1 to I-25 as specifically exemplified in Table 1 of PCT Publication No. WO2023 / 114944, which Table and compounds listed therein are hereby incorporated herein by reference for all purposes.
[1023] In yet another aspect, the cationic lipid is described in PCT Publication No. WO2023 / 114937, the contents of which is hereby incorporated herein by reference in its entirety for all purposes. In one embodiment therein, an ionizable cationic lipid of...
Claims
1. CLAIMS1. A compound of Formula (I):
4. 6.or a pharmaceutically acceptable salt thereof, wherein:7.Y is -O- or -CH2-; and8.one of X1and X2is H, and the other of X1and X2has a formula selected from the group consisting of formula(a), formula(b), and formula(c):
10.
11. wherein:12.a is 0 or 1;13.r1 is an integer from 2 to 6;14.r2 is an integer from 10 to 20;15.r3 is an integer from 0 to 6; n1 is 0 or 1 and n2 is 0 or 1, wherein at least one of n1 and n2 is 1; n3 is 0 or 1; and16.p is an integer from 0 to 6.
2. The compound of claim 1, wherein X1has formula a.
3. The compound of claim 2, wherein a is 1, n1 is 0, and n2 is 1.
4. The compound of any one of claims 1-3, wherein r1 is 4.
5. The compound of any one of claims 1-4, wherein p is 0.
6. The compound of claim 2, wherein a is 1, n1 is 0, and n2 is 1.
7. The compound of claim 6, wherein r1 is 2 and p is 3.
8. The compound of claim 1, wherein X1has formula b.
9. The compound of claim 8, wherein n1 is 0 and n2 is 1.
10. The compound of claim 9, wherein r1 is 2 and p is 3.
11. The compound of claim 8, wherein n1 is 1 and n2 is 1.
12. The compound of claim 11, wherein r1 is 3 and p is 0.
13. The compound of claim 1, wherein X2has formula c.
14. The compound of claim 13, wherein n1 is 1, n2 is 0, and n3 is 0.
15. The compound of claim 14, wherein r1 is 3, r3 is 0, and p is 0.
16. The compound of claim 13, wherein n1 is 0, n2 is 1, and n3 is 1.
17. The compound of claim 16, wherein r1 is 3, r3 is 2, and p is 3.
18. The compound of any one of claims 1-17, or a pharmaceutically acceptable salt thereof, wherein r2 is 13, 14, or 15.
19. The compound of any one of claims 1-18, or a pharmaceutically acceptable salt thereof, wherein r2 is 14.
20. A compound, which is N5-(4-(N-(3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)sulfamoyl)butyl)-N2-palmitoyl-L-glutamine, or a pharmaceutically acceptable salt thereof.
21. A compound, which is (S)-1-(N-(3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)sulfamoyl)-13-oxo-16-palmitamido-3,6,9-trioxa-12-azaheptadecan-17-oic acid, or a pharmaceutically acceptable salt thereof.
22. A compound, which is (S)-1-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)-18-oxo-21-palmitamido-8,11,14-trioxa-4,17-diazadocosan-22-oic acid, or a pharmaceutically acceptable salt thereof.
23. A compound, which is (S)-5-(4-(2-((4-((3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)amino)butyl)amino)-2-oxoethyl)-4-hydroxypiperidin-1-yl)-5-oxo-2-palmitamidopentanoic acid, or a pharmaceutically acceptable salt thereof.
24. A compound, which is 1-(4-(2-(4-(3-(4-Amino-2-butyl-1-(3-hydroxy-2-(hydroxymethyl)-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-7-yl)propyl)piperazin-1-yl)-2-oxoethyl)-4-hydroxypiperidin-1-yl)hexadecan-1-one, or a pharmaceutically acceptable salt thereof.
25. A compound, which is (S)-1-(4-(3-(4-Amino-2-(ethoxymethyl)-1-(3-hydroxy-2-(hydroxymethyl)-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-7-yl)propyl)piperazin-1-yl)-1,14-dioxo-17-palmitamido-4,7,10-trioxa-13-azaoctadecan-18-oic acid, or a pharmaceutically acceptable salt thereof.
26. A pharmaceutical composition comprising the compound according to any one of claims 1 to 25, or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient.
27. A crystalline form of the compound according to any one of claims 1 to 25 or a pharmaceutically acceptable salt thereof.
28. A method of inducing an immune response to an antigen of interest in a subject, comprising administering to the subject the pharmaceutical composition of claim 26, wherein the composition further comprises the antigen of interest.
29. A method for immunizing a subject against a disease or disorder caused by or associated with an antigen of interest, comprising administering to the subject the pharmaceutical composition of claim 26, wherein the composition further comprises the antigen of interest.
30. A method for preventing a disease or disorder caused by or associated with an antigen of interest in a subject, comprising administering to the subject the pharmaceutical composition of claim 26, wherein the composition further comprises the antigen of interest.
31. A method for treating a disease or disorder caused by or associated with an antigen of interest in a subject, comprising administering to the subject the pharmaceutical composition of claim 26, wherein the composition further comprises the antigen of interest.
32. A method for increasing an immune response to an antigen of interest in a subject, comprising administering to the subject the pharmaceutical composition of claim 26, wherein the composition further comprises the antigen of interest.
33. The method of any one of claims 28 to 32, wherein the antigen of interest is an infectious disease antigen.
34. The method of any one of claims 28 to 33, wherein the antigen of interest is a viral antigen, a bacterial antigen, a fungal antigen, or a parasitic antigen.
35. The method of any one of claims 28 to 32, wherein the antigen of interest is a cancer antigen.
36. The method of any one of claims 28-35, wherein the method induces an immune response in the subject to the antigen of interest and the immune response is at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, atleast 90%, or at least 100%, higher than the immune response of the subject induced by a composition comprising the antigen of interest without the compound according to any one of claims 1 to 25.
37. The method of claim 36, wherein the immune response is measured by opsonophagocytic activity (OPA) geometric mean antibody titers.
38. The method of claim 36, wherein the immune response is measured by neutralization geometric mean antibody titers.
39. The method of any one of claims 28 to 38, wherein the subject is human.
40. A compound according to any one of claims 1 to 25 for use as a medicament.
41. A compound according to any one of claims 1 to 25 for use in inducing an immune response to an antigen of interest in a subject.
42. A compound according to any one of claims 1 to 25 for use in immunizing a subject against a disease or disorder caused by or associated with an antigen of interest in a subject.
43. A compound according to any one of claims 1 to 25 for use in preventing a disease or disorder caused by or associated with an antigen of interest in a subject.
44. A compound according to any one of claims 1 to 25 for use in treating a disease or disorder caused by or associated with an antigen of interest in a subject.
45. A compound according to any one of claims 1 to 25 for use in increasing an immune response to an antigen of interest in a subject.
46. The compound according to any one of claims 40-45, wherein the subject is a human.
47. Use of a compound according to any one of claims 1 to 25 for the manufacture of a medicament for inducing an immune response to an antigen of interest in a subject.
48. Use of a compound according to any one of claims 1 to 25 for the manufacture of a medicament for immunizing a subject against a disease or disorder caused by or associated with an antigen of interest.
49. Use of a compound according to any one of claims 1 to 25 for the manufacture of a medicament for use in preventing a disease or disorder caused by or associated with an antigen of interest in the subject.
50. Use of a compound according to any one of claims 1 to 25 for the manufacture of a medicament for treating a disease or disorder caused by or associated with an antigen of interest in the subject.
51. Use of a compound according to any one of claims 1 to 25 for the manufacture of a medicament for increasing an immune response to an antigen of interest in a subject.
52. The use according to any one of claims 47 to 51, wherein the subject is a human.
53. A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound of Formula (I):
67. 69.or a pharmaceutically acceptable salt thereof, wherein:70.Y is -O- or -CH2-; and71.one of X1and X2is H, and the other of X1and X2has a formula selected from the group consisting of formula(a), formula(b), and formula(c):
73.
76.
77. wherein:78.a is 0 or 1;79.r1 is an integer from 2 to 6;80.r2 is an integer from 10 to 20;81.r3 is an integer from 0 to 6;82.n1 is 0 or 1 and n2 is 0 or 1, wherein at least one of n1 and n2 is 1;83.n3 is 0 or 1; and84.p is an integer from 0 to 6.
54. The LNP formulation of claim 53, wherein X1has formula a.
55. The LNP formulation of claim 54, wherein a is 1, n1 is 0, and n2 is 1.
56. The LNP formulation of any one of claims 53-55, wherein r1 is 4.
57. The LNP formulation of any one of claims 53-56, wherein p is 0.
58. The LNP formulation of claim 54, wherein a is 1, n1 is 0, and n2 is 1.
59. The LNP formulation of claim 58, wherein r1 is 2 and p is 3.
60. The LNP formulation of claim 53, wherein X1has formula b.
61. The LNP formulation of claim 60, wherein n1 is 0 and n2 is 1.
62. The LNP formulation of claim 61, wherein r1 is 2 and p is 3.
63. The LNP formulation of claim 60, wherein n1 is 1 and n2 is 1.
64. The LNP formulation of claim 63, wherein r1 is 3 and p is 0.
65. The LNP formulation of claim 53, wherein X2has formula c.
66. The LNP formulation of claim 65, wherein n1 is 1, n2 is 0, and n3 is 0.
67. The LNP formulation of claim 66, wherein r1 is 3, r3 is 0, and p is 0.
68. The LNP formulation of claim 65, wherein n1 is 0, n2 is 1, and n3 is 1.
69. The LNP formulation of claim 68, wherein r1 is 3, r3 is 2, and p is 3.
70. The LNP formulation of any one of claims 53-69, wherein r2 is 13, 14, or 15.
71. The LNP formulation of any one of claims 53-70, wherein r2 is 14.
72. A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is N5-(4-(N-(3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)sulfamoyl)butyl)-N2-palmitoyl-L-glutamine, or a pharmaceutically acceptable salt thereof.
73. A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is (S)-1-(N-(3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)sulfamoyl)-13-oxo-16-palmitamido-3,6,9-trioxa-12-azaheptadecan-17-oic acid, or a pharmaceutically acceptable salt thereof.
74. A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is (S)-1-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)-18-oxo-21-palmitamido-8,11,14-trioxa-4,17-diazadocosan-22-oic acid, or a pharmaceutically acceptable salt thereof.
75. A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is (S)-5-(4-(2-((4-((3-(4-Amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)-2,2-bis(hydroxymethyl)propyl)amino)butyl)amino)-2-oxoethyl)-4-hydroxypiperidin-1-yl)-5-oxo-2-palmitamidopentanoic acid, or a pharmaceutically acceptable salt thereof.
76. A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is 1-(4-(2-(4-(3-(4-Amino-2-butyl-1-(3-hydroxy-2-(hydroxymethyl)-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-7-yl)propyl)piperazin-1-yl)-2-oxoethyl)-4-hydroxypiperidin-1-yl)hexadecan-1-one, or a pharmaceutically acceptable salt thereof.
77. A lipid nanoparticle (LNP) formulation, comprising a plurality of LNPs, wherein the LNPs comprise a compound, which is (S)-1-(4-(3-(4-Amino-2-(ethoxymethyl)-1-(3-hydroxy-2-(hydroxymethyl)-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-7-yl)propyl)piperazin-1-yl)-1,14-dioxo-17-palmitamido-4,7,10-trioxa-13-azaoctadecan-18-oic acid, or a pharmaceutically acceptable salt thereof.
78. The LNP formulation of any one of claims 53-77, wherein the LNPs further comprise:108.a) an ionizable cationic lipid;109.b) cholesterol, a cholesterol analog, or cholesterol and a cholesterol analog; c) a neutral lipid; and110.d) a polymer-conjugated lipid.
79. The LNP formulation of claim 78, wherein the LNPs further comprise RNA.
80. The LNP formulation of claim 79, wherein the RNA is modified RNA (modRNA) or selfamplifying RNA (saRNA).
81. The LNP formulation of claim 79 or 80, wherein the RNA comprises a 5’ cap, a 5’ UTR, a 3’ UTR, and a poly-A tail.
82. The LNP formulation of claim 81, wherein the 5’ cap is a 5’ cap analog.
83. The LNP formulation of any one of claims 79-82, wherein the RNA comprises a modified nucleotide selected from the group consisting of pseudouridine, 1 -methylpseudouridine, 2-thiouridine, 4 '-thiouridine, 5-methylcytosine, 2-thio-1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine, 2-thio-dihydropseudouridine, 2-thio-dihydrouridine, 2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine, 4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine, 4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine, 5-methoxyuridine, 2'-O-methyl uridine, and N1-Methylpseudourodine-5’-triphosphate (ml^PTP).
84. The LNP formulation of any one of claims 79-83, wherein the RNA comprises N1-Methylpseudourodine-5’-triphosphate (ml^PTP).
85. The LNP formulation of any one of claims 79-84, wherein the RNA comprises a codon-optimized open reading frame.
86. The LNP formulation of any one of claims 79-85, wherein the molar ratio of the nitrogen atoms in the ionizable cationic lipid to the phosphate groups in the RNA (N: P ratio) is between about 2:1 and about 20: 1.
87. The LNP formulation of claim 86, wherein the N: P ratio is about 6:1.
88. The LNP formulation of any one of claims 78-87, wherein the LNPs further comprise a saponin.
89. The LNP formulation of claim 88, wherein the saponin is QS-7, QS-18, QS-21, ora mixture thereof.
90. The LNP formulation of claim 89, wherein the saponin is QS-21.
91. The LNP formulation of any one of claims 78-90, wherein the ionizable cationic lipid is N, N-dimethyl-2,3-dioleyloxy)propylamine (DODMA), N, N-dioleyl-N, N-dimethylammonium chloride (DODAC), N, N-distearyl-N, N-dimethylammonium bromide (DDAB), N-(1-(2,3-dioleoyloxy)propyl)-N, N, N-trimethylammonium chloride (DOTAP), N-(1-(2,3-dioleyloxy)propyl)-N, N, N-trimethylammonium chloride (DOTMA), 1,2-dilinoleyloxy-N, N-dimethylaminopropane (DLinDMA), 1,2-dilinolenyloxy-N, N-dimethylaminopropane (DLenDMA), 2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane (DLin-KC2-DMA), 2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA), (4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate) (ALC-0315), 2-hexyldecyl 6-[(2-{[4-(heptylcarbonylamino)butyl]-N-methylamino}ethyl)[5-(2-hexyldecyloxycarbonyl)pentyl]amino]hexanoate (ALC-0515), 2-(7-(4-hydroxybutyl)-2,7-diazaspiro[3.5]nonan-2-yl)propane-1,3-diyl bis(2-heptylnonanoate) (PF-9032), heptadecane-9-yl 8-((2-hydroxyethyl) (6-oxo-6-(undecyloxy)hexyl) amino) octanoate (SM-102), or a mixture thereof.
92. The LNP formulation of any one of claims 78-91, wherein the ionizable cationic lipid is ALC-0315 (4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate) (ALC-0315) having the structure:
125.
93. The LNP formulation of any one of claims 78-91, wherein the ionizable cationic lipid is 2- hexyldecyl 6-[(2-{[4-(heptylcarbonylamino)butyl]-N-methylamino}ethyl)[5-(2- hexyldecyloxycarbonyl)pentyl]amino]hexanoate (ALC-0515) having the structure:
129.
94. The LNP formulation of any one of claims 78-91, wherein the ionizable cationic lipid is 2- (7-(4-hydroxybutyl)-2,7-diazaspiro[3.5]nonan-2-yl)propane-1,3-diyl bis(2-heptylnonanoate) (PF- 9032) having the structure:
133.
95. The LNP formulation of any one of claims 78-94, wherein the LNPs comprise a cholesterol analog selected from the group consisting of sitosterol, stigmasterol, campesterol, sitostanol, campestanol, brassicasterol, fucosterol, β-sitosterol, stigmastanol, β-sitostanol, ergosterol, fecosterol, lupeol, cycloartenol, A5-avenasterol, A7-avenasterol, A7-stigmasterol, tomatidine, ursolic acid, and alpha-tocopherol, including analogs, salts or esters thereof.
96. The LNP formulation of any one of claims 78-95, wherein the LNPs comprise cholesterol and a cholesterol analog, and wherein the cholesterol analog is β-sitosterol.
97. The LNP formulation of claim 96, wherein the molar ratio of β-sitosterol:cholesterol is between about 8:2 and about 1:9.
98. The LNP formulation of claim 96 or 97, wherein the molar ratio of β-sitosterol:cholesterol is about 6:4 or about 4:6.
99. The LNP formulation of any one of claims 78-98, wherein the neutral lipid is a phospholipid.
100. The LNP formulation of any one of claims 78-99, wherein the neutral lipid is distearoylphosphatidylcholine, 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC), dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG), dioleoylphosphatidylethanolamine (DOPE), palmitoyloleoylphosphatidylcholine (POPC), palmitoyl-oleoyl-phosphatidylethanolamine (POPE), dioleoyl- phosphatidylethanolamine 4-(N-maleimidomethyl)-cyclohexane-1 -carboxylate (DOPE-mal), dipalmitoylphosphatidylethanolamine (DPPE), dimyristoylphosphoethanolamine (DMPE), distearoylphosphatidylethanolamine (DSPE), 16-O-monomethyl PE, 16-O-dimethyl PE, 18-1-trans PE, 1-stearoyl-2-oleoylphosphatidyethanolamine (SOPE), 1,2-dielaidoyl-sn-glycero-3-phosphoethanolamine (transDOPE), hydrogenated soy phosphatidylcholine (HSPC), egg phosphatidylcholine (EPC), dioleoylphosphatidyl serine (DOPS), sphingomyelin (SM), dimyristoyl phosphatidylcholine (DMPC), dimyristoyl phosphatidylglycerol (DMPG), distearoylphosphatidylglycerol (DSPG), diemcoylphosphatidylcholine (DEPC), palmitoyloleyolphosphatidylglycerol (POPG), dielaidoyl-phosphatidylethanolamine (DEPE), 1, 2-dilauroyl-sn-glycero-3 -pho sphoethanolamine (DLPE); l,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (DPHyPE); lecithin, phosphatidylethanolamine, lysolecithin, lysophosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, sphingomyelin, egg sphingomyelin (ESM), cephalin, cardiolipin, phosphatidicacid, cerebrosides, dicetylphosphate, lysophosphatidylcholine, dilinoleoylphosphatidylcholine, or a mixture thereof.
101. The LNP formulation of any one of claims 78-100, wherein the neutral lipid is 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC).
102. The LNP formulation of any one of claims 78-101, wherein the polymer-conjugated lipid is a pegylated lipid.
103. The LNP formulation of claim 102, wherein the pegylated lipid is selected from the group consisting of 2-[(polyethylene glycol)-2000]-N, N-ditetradecylacetamide (ALC-0159), PEG dialkyoxypropylcarba PEGylated diacylglycerol (PEG-DAG), 1-(monomethoxy-polyethyleneglycol)-2,3-dimyristoylglycerol (PEG-DMG), PEGylated phosphatidylethanolamine (PEG-PE), PEG succinate diacylglycerol (PEG-S-DAG), 4-O-(2',3'-di(tetradecanoyloxy)propyl-1-O-((O-methoxy(polyethoxy)ethyl)butanedioate (PEG-S-DMG), PEG-ceramide, and a-(3’-[(1,2-di[myristyloxy]propanoxy) carbonylamino]propyl)-w-methoxy, polyoxyethylene (PEG-C-DMG).
104. The LNP formulation of claim 102 or 103, wherein the pegylated lipid is ALC-0159 (2-[(polyethylene glycol)-2000]-N, N-ditetradecylacetamide) having the structure:
144.
105. The LNP formulation of any one of claims 78-101, wherein the polymer-conjugated lipid is a terminally activated polyoxazoline (POZ)-conjugated lipid.
106. The LNP formulation of claim 105, wherein the POZ-conjugated lipid is polyethyloxazoline-dimyristoylamide (PEOZ-dma) having the structure:
149. 151.wherein n is an integer from 18-22.
107. The LNP formulation of any one of claims 78-106, wherein the LNPs comprise lipids from any one of the groups from a) to I):153.a) ALC-0315, beta-sitosterol, cholesterol, DSPC, and ALC-0159;154.b) ALC-0315, beta-sitosterol, cholesterol, ESM, and ALC-0159;155.c) ALC-0315, beta-sitosterol, cholesterol, DSPC, and PEOZ;156.d) ALC-0315, beta-sitosterol, cholesterol, ESM, and PEOZ;157.e) ALC-0515, beta-sitosterol, cholesterol, DSPC, and ALC-0159;158.f) ALC-0515, beta-sitosterol, cholesterol, ESM, and ALC-0159;159.g) ALC-0515, beta-sitosterol, cholesterol, DSPC, and PEOZ; h) ALC-0515, beta-sitosterol, cholesterol, ESM, and PEOZ;160.i) PF-9032, beta-sitosterol, cholesterol, DSPC, and ALC-0159;161.j) PF-9032, beta-sitosterol, cholesterol, ESM, and ALC-0159;162.k) PF-9032, beta-sitosterol, cholesterol, DSPC, and PEOZ; and163.l) PF-9032, beta-sitosterol, cholesterol, ESM, and PEOZ.
108. The LNP formulation of any one of claims 78-106, wherein the LNPs comprise lipids from any one of the groups from a) to I):165.a) ALC-0315, cholesterol, DSPC, and ALC-0159;166.b) ALC-0315, cholesterol, ESM, and ALC-0159;167.c) ALC-0315, cholesterol, DSPC, and PEOZ;168.d) ALC-0315, cholesterol, ESM, and PEOZ;169.e) ALC-0515, cholesterol, DSPC, and ALC-0159;170.f) ALC-0515, cholesterol, ESM, and ALC-0159;171.g) ALC-0515, cholesterol, DSPC, and PEOZ;172.h) ALC-0515, cholesterol, ESM, and PEOZ;173.i) PF-9032, cholesterol, DSPC, and ALC-0159;174.j) PF-9032, cholesterol, ESM, and ALC-0159;175.k) PF-9032, cholesterol, DSPC, and PEOZ; and176.l) PF-9032, cholesterol, ESM, and PEOZ.
109. The LNP formulation of any one of claims 78-92, 95-104, or 107, wherein the LNPs comprise the following lipids: ALC-0315, beta-sitosterol, cholesterol, DSPC, and ALC-0159.
110. The LNP formulation of any one of claims 53-109, wherein the LNPs have a mean diameter size between about 1 nm and about 500 nm.
111. The LNP formulation of any one of claims 53-110, wherein the LNPs have a mean diameter size that is less than about 150 nm.
112. The LNP formulation of any one of claims 53-111, wherein the LNPs have a mean diameter size between about 60 nm and about 140 nm.
113. The LNP formulation of any one of claims 53-112, wherein the LNPs have a mean diameter size selected from the group consisting of about 60 nm, about 65 nm, about 70 nm, about 75 nm, about 80 nm, about 85 nm, about 90 nm, about 95 nm, about 100 nm, about 105nm, about 110 nm, about 115 nm, about 120 nm, about 125 nm, about 130 nm, about 135 nm, and about 140 nm.
114. The LNP formulation of any one of claims 53-113, wherein the LNPs have a polydispersity index (PDI) that is less than about 0.15, about 0.2, about 0.25, or about 0.3.
115. The LNP formulation of any one of claims 53-114, wherein the LNPs have a PDI between about 0.05 and about 0.2.
116. The LNP formulation of any one of claims 78-115, wherein the ionizable cationic lipid comprises between about 30 mol % and about 60 mol % of the total lipid.
117. The LNP formulation of any one of claims 78-116, wherein the ionizable cationic lipid comprises between about 40 mol % and about 50 mol % of the total lipid.
118. The LNP formulation of any one of claims 78-117, wherein the ionizable cationic lipid comprises about 47.5 mol% of the total lipid.
119. The LNP formulation of any one of claims 78-118, wherein the cholesterol, the cholesterol analog, or the cholesterol and the cholesterol analog comprise between about 30 mol % and about 50 mol % of the total lipid.
120. The LNP formulation of any one of claims 78-119, wherein the cholesterol, the cholesterol analog, or the cholesterol and the cholesterol analog comprise between about 40 mol % and about 41 mol % of the total lipid.
121. The LNP formulation of any one of claims 78-120, wherein the cholesterol, the cholesterol analog, or the cholesterol and the cholesterol analog comprise about 40.7 mol % of the total lipid.
122. The LNP formulation of any one of claims 78-121, wherein the neutral lipid comprises between about 1 mol % and about 30 mol % of the total lipid.
123. The LNP formulation of any one of claims 78-122, wherein the neutral lipid comprises between about 5 mol % and about 15 mol % of the total lipid.
124. The LNP formulation of any one of claims 78-123, wherein the neutral lipid comprises about 10 mol % of the total lipid.
125. The LNP formulation of any one of claims 78-124, wherein the polymer-conjugated lipid comprises between about 0.5 mol % and about 10 mol % of the total lipid.
126. The LNP formulation of any one of claims 78-125, wherein the polymer-conjugated lipid comprises between about 1 mol % and about 2 mol % of the total lipid.
127. The LNP formulation of any one of claims 78-126, wherein the polymer-conjugated lipid comprises about 1.8 mol % of the total lipid.
128. An immunogenic composition comprising the LNP formulation of any one of claims 53-127, wherein the LNPs comprise RNA, and wherein the RNA comprises at least one open reading frame (ORF) encoding an immunogen of interest.
129. The immunogenic composition of claim 128, wherein the immunogen is derived from E. coli.
130. The immunogenic composition of claim 129, wherein the immunogen is a fimbrial adhesin (FimH) polypeptide, or a functional fragment thereof.
131. The immunogenic composition of claim 130, wherein the FimH polypeptide, or functional fragment thereof, comprises each of the mutations of G15A, G16A, and V27A, and wherein the amino acid positions are numbered according to SEQ ID NO: 1.
132. The immunogenic composition of any one of claims 128-131, wherein the RNA comprises or consists of the sequence of SEQ ID NO: 3.
133. The immunogenic composition of any one of claims 128-132, wherein the composition further comprises a fatty acid, a fatty acid derivative, or a salt thereof.
134. The immunogenic composition of claim 133, wherein the fatty acid is selected from the group consisting of oleic acid, arachidonic acid, eruric acid, linolenic acid, ricinoleic acid, palmitoleic acid, and linoleic acid.
135. The immunogenic composition of claim 133 or 134, wherein the salt is selected from the group consisting of sodium, potassium, magnesium, and calcium.
136. The immunogenic composition of any one of claims 128-135, wherein the composition comprises oleic acid or sodium oleate.
137. The immunogenic composition of claim 136, wherein the immunogenic composition has a oleic acid to RNA mass ratio (g / g) selected from the group consisting of about 1:1, about 2:1, about 3:1, about 4:1, about 5:1, about 6:1, about 7:1, about 8:1, about 9:1, about 10:1, about 11:1, about 12:1, and about 13:1.
138. The immunogenic composition of claim 137, wherein the immunogenic composition has a oleic acid to RNA mass ratio (g / g) of about 8:1.
139. The immunogenic composition of any one of claims 128-138, wherein the composition comprises a buffer and a cryoprotectant.
140. The immunogenic composition of claim 139, wherein the buffer is Tris and the cryoprotectant is sucrose.
141. The immunogenic composition of claim 139 or 140, wherein the composition comprises 10 mM Tris and 300 mM sucrose.
142. The immunogenic composition of any one of claims 128-141, wherein the percentage of intact RNA in the composition is at least about 80%, about 85%, or about 90%.
143. The immunogenic composition of any one of claims 128-142, wherein at least about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the total RNA in the composition is encapsulated in the plurality of LNPs.
144. The immunogenic composition of any one of claims 128-143, wherein at least about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the compound is encapsulated in the plurality of LNPs.
145. The immunogenic composition of any one of claims 128-144, wherein the concentration of the compound is between about 1 pg / mL and about 1000 pg / mL.
146. The immunogenic composition of any one of claims 128-145, wherein the concentration of the compound is between about 10 pg / mL and about 100 pg / mL.
147. The immunogenic composition of any one of claims 128-146, wherein the concentration of the compound is about 17 pg / mL or about 86 pg / mL.
148. The immunogenic composition of any one of claims 128-147, wherein the LNPs comprise QS-21, and wherein the concentration of QS-21 in the composition is between about 0.001 mg / mL and about 0.2 mg / mL.
149. The immunogenic composition of any one of claims 128-148, wherein the LNPs comprise QS-21, and wherein the concentration of QS-21 in the composition is about 0.009 mg / mL, about 0.023 mg / mL, about 0.045 mg / mL, or about 0.1 mg / mL.
150. The immunogenic composition of any one of claims 128-149, wherein the concentration of the RNA in the composition is less than about 1 mg / mL.
151. The immunogenic composition of any one of claims 128-150, wherein the concentration of the RNA in the composition is about 0.1 mg / mL.
152. The immunogenic composition of any one of claims 128-151, wherein the in-vitro expression (IVE) of the immunogen in a cell line treated with the immunogenic composition is at least about 40%, about 50%, about 60%, about 70%, about 80%, or about 90%.
153. A method of inducing an immune response in a subject against the immunogen of interest, comprising administering to the subject the immunogenic composition of any one of claims 128-152.
154. A method for immunizing a subject against a disease or disorder caused by or associated with the immunogen of interest, comprising administering to the subject the immunogenic composition of any one of claims 128-152.
155. A method for preventing a disease or disorder caused by or associated with the immunogen of interest in a subject, comprising administering to the subject the immunogenic composition of any one of claims 128-152.
156. A method for treating a disease or disorder caused by or associated with the immunogen of interest in a subject, comprising administering to the subject the immunogenic composition of any one of claims 128-152.
157. A method for increasing an immune response to the immunogen of interest in a subject, comprising administering to the subject the immunogenic composition of any one of claims 128-152.
158. The method of any one of claims 153-157, wherein the method induces an immune response in the subject to the immunogen of interest and the immune response is at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 100% higher than the immune response of the subject induced by a composition comprising the immunogen of interest without the LNP formulation of any one of claims 53-127.
159. The method of any one of claims 153-157, wherein the method induces an immune response in the subject to the immunogen of interest and the immune response is at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, or at least about 500% higher than the immune response of the subject induced by a composition comprising the immunogen of interest without the LNP formulation of any one of claims 53-127.
160. The method of any one of claims 153-157, wherein the method induces an immune response in the subject to the immunogen of interest and the immune response is at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 100% higher than the immune response of the subject induced by a composition comprising the immunogen of interest and an LNP formulation wherein the LNPs in the LNP formulation do not comprise the compound of any one of claims 1-25.
161. The method of any one of claims 153-157, wherein the method induces an immune response in the subject to the immunogen of interest and the immune response is at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, or at least about 500% higher than the immune response of the subject induced by a composition comprising the immunogen of interest and an LNP formulation wherein the LNPs in the LNP formulation do not comprise the compound of any one of claims 1-25.
162. The method of any one of claims 153 or 157-161, wherein the immune response is measured by opsonophagocytic activity (OPA) geometric mean antibody titers.
163. The method of any one of claims 153 or 157-161, wherein the immune response is measured by neutralization geometric mean antibody titers.
164. The method of any one of claims 153-163, wherein the subject is human.
165. The immunogenic composition of any one of claims 128-152, for use as a medicament.
166. The immunogenic composition of any one of claims 128-152, for use in inducing an immune response to the immunogen of interest in a subject.
167. The immunogenic composition of any one of claims 128-152, for use in immunizing a subject against a disease or disorder caused by or associated with the immunogen of interest.
168. The immunogenic composition of any one of claims 128-152, for use in preventing a disease or disorder caused by or associated with the immunogen of interest in a subject.
169. The immunogenic composition of any one of claims 128-152, for use in treating a disease or disorder caused by or associated with the immunogen of interest in a subject.
170. The immunogenic composition of any one of claims 128-152, for use in increasing an immune response to the immunogen of interest in a subject.
171. Use of the immunogenic composition of any one of claims 128-152, for the manufacture of a medicament for inducing an immune response to the immunogen of interest in a subject.
172. Use of the immunogenic composition of any one of claims 128-152, for the manufacture of a medicament for immunizing a subject against a disease or disorder caused by or associated with the immunogen of interest.
173. Use of the immunogenic composition of any one of claims 128-152, for the manufacture of a medicament for use in preventing a disease or disorder caused by or associated with the immunogen of interest in a subject.
174. Use of the immunogenic composition of any one of claims 128-152, for the manufacture of a medicament for treating a disease or disorder caused by or associated with the immunogen of interest in a subject.
175. Use of the immunogenic composition of any one of claims 128-152, for the manufacture of a medicament for increasing an immune response to the immunogen of interest in a subject.
176. The method or use of any one of claims 153-175, wherein the expression of TNF-α, IL-6, IL-8, and / or IFN-β in the subject is increased.
177. A method of making the LNP formulation of any one of claims 79-127 or the immunogenic composition of any one of claims 128-152, comprising the steps of:(i) dissolving the compound, ionizable cationic lipid, cholesterol and / or cholesterol analog, neutral lipid, and polymer-conjugated lipid in an organic solvent to form an organic phase;241.(ii) dissolving the RNA in water or buffer to form an aqueous phase; and242.(iii) mixing the organic phase and the aqueous phase to form the LNP formulation.
178. The method of claim 177, wherein in step (i) the organic solvent is ethanol or isopropyl alcohol.
179. The method of claim 177 or 178, wherein in step (ii) the aqueous phase comprises citrate buffer at pH 4.
180. The method of any one of claims 177-179, wherein in step (iii) the organic phase and the aqueous phase are mixed in a microfluidic mixer.
181. The method of claim 180, wherein the microfluidic mixer is a T-mixer.
182. The method of any one of claims 176-181, wherein in step (iii) the ratio of the aqueous phase to the organic phase by volume is 3:1.
183. The method of any one of claims 177-182, further comprising step (iv) dialyzing the LNP formulation against a buffer.
184. The method of claim 183, wherein the buffer of step (iv) is 10 mM Tris (pH 7.4).
185. The method of any one of claims 177-184, further comprising step (v) adding a cryoprotectant to the LNP formulation.
186. The method of claim 185, wherein the cryoprotectant is sucrose.
187. The method of claim 185 or 186, wherein step (v) further comprises adding sodium oleate to the LNP formulation.