24152results about "Metabolism disorder" patented technology

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

The present invention provides a compound as shown in formula (I), and a pharmaceutically acceptable salt of the compound. The compound in the present invention exhibits a strong inhibitory effect on Lp(a) assembly, and can be used for treating cardiovascular diseases (CVD).

The disclosure provides methods for treating a subject in need thereof comprising administering to the subject a therapeutically-effective dose of psilocybin. The methods described herein may be used to treat a variety of diseases, disorders, and conditions. For example, the methods may be used to treat anxiety disorders, eating disorders, and headache disorders.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention provides a plant lactobacillus capable of promoting mineral absorption and transport and application of the plant lactobacillus. The invention provides a plant lactobacillus of which the preservation number is CGMCC (China General Microbiological Culture Collection Center) No.32404. The invention also provides a culture, a sterilized solution, a supernatant, a filtrate, a diluent, a precipitate or freeze-dried powder, a composition and a probiotic preparation containing the plant lactobacillus, and related applications and methods thereof.

The disclosure provides methods for treating a subject in need thereof comprising administering to the subject a therapeutically-effective dose of psilocybin. The methods described herein may be used to treat a variety of diseases, disorders, and conditions. For example, the methods may be used to treat anxiety disorders, eating disorders, and headache disorders.

Described herein are GLP-1R agonists and pharmaceutical compositions comprising said compounds. The subject compounds and compositions are useful for the treatment of a GLP-1 associated disease or disorder, including Type 2 diabetes or obesity.

The invention discloses a nano-enzyme as well as a preparation method and application thereof, and relates to the technical field of nano-enzymes. According to the preparation method, natural polyphenol, a cerium source and polyethylene glycol are mixed to prepare the novel polyphenol nano-enzyme, the preparation method is simple and easy to implement, the preparation cost is low, the prepared nano-enzyme has good biocompatibility, and a new way is provided for effective treatment of inflammatory diseases.

Compositions for inducing and maintaining a state of flow in a subject include optically pure S-beta-hydroxybutyrate or non-racemic mixtures enriched with the S-enantiomer. The S-beta-hydroxybutyrate enantiomer modulates the effect of ketone bodies in the subject and controls the rate at which ketosis is achieved. Beta-hydroxybutyric acid is more rapidly absorbed and utilized by the body than salts or esters, enhances taste, and reduces the need to include citric acid or other edible acids. Beta-hydroxybutyrate salts are more slowly absorbed and utilized by the body and can provide one or more electrolytes. Compositions for controlling ketone body level in a subject may contain a dietetically or pharmaceutically acceptable carrier and optically pure S-beta-hydroxybutyrate or non-racemic mixture enriched with S-beta-hydroxybutyrate, wherein the compositions contain from about 50.5% to 100% by enantiomeric equivalents of S-beta-hydroxybutyrate and from about 49.5% to 0% by enantiomeric equivalents of R-beta-hydroxybutyrate.

The present invention belongs to the technical field of chemical pharmaceuticals. Provided in the present invention are an aldosterone synthetase inhibitor, and a preparation method therefor and the use thereof.

The present application relates to a GLP-1 receptor agonist, which is a compound of formula (II) or a pharmaceutically acceptable salt thereof, and a method for treating or preventing a GLP-1 receptor-mediated disease or disorder or regulating a GLP-1 receptor.

The invention provides an artificial nucleic acid molecule which is used for improving the expression quantity of target amino acid, polypeptide or protein. The artificial nucleic acid molecule at least comprises a target 5'untranslated region (UTR), a target coding region (CDS) and a target 3 'untranslated region (UTR). Wherein the sequence of the target 5 'UTR is one of the following sequences: 5' UTR of a high-expression gene and a 5 'UTR variant of the high-expression gene. The sequence of the target 3 'UTR is one of the following sequences: 3' UTR of a high-expression gene and a 3 'UTR variant of the high-expression gene. Optionally, the artificial nucleic acid molecule may further comprise, for example, a 5 '-end cap structure (Cap), a PolyA tail. The 5 'UTR and the 3' UTR have regulating effects on translation and stability of nucleic acid molecules, so that the 5 'UTR, the 3' UTR and variants thereof are selected from high-expression genes, the nucleic acid molecules can be further stabilized and are not easy to degrade, and the amount of protein or polypeptide obtained by translation of the nucleic acid molecules can be increased. The invention also provides methods for making, delivering, and using such artificial nucleic acid molecules, as well as the use of the artificial nucleic acid molecules for the treatment and / or prevention of related diseases or disorders.

Provided in the present invention are a tetrahydropyridopyrazole derivative and use thereof in medicine. Specifically provided is a compound as shown in general formula (I) or a racemate, stereoisomer, tautomer, deuterated substance, solvate, prodrug, metabolite, pharmaceutically acceptable salt or eutectic crystal thereof, an intermediate thereof, a preparation method therefor, and use thereof in the preparation of a related drug for treating diabetes or obesity.

The disclosure provides methods for treating a subject in need thereof comprising administering to the subject a therapeutically-effective dose of psilocybin. The methods described herein may be used to treat a variety of diseases, disorders, and conditions. For example, the methods may be used to treat neurocognitive disorders (e.g., Alzheimer's disease, Parkinson's disease), ADHD, Epilepsy, Autism, Sleep-wake disorders, Chronic pain, Inflammatory Disorders, IBD, Stroke, ALS, and / or Multiple Sclerosis.

The invention provides application of polygonatum cyrtonema polysaccharide in preparation of medicines for treating ulcerative colitis or reducing blood glucose. A main chain of a sugar chain structure of the homogeneous polysaccharide PCP2 in polygonatum cyrtonema is mainly composed of-> 1)-beta-D-Fur-(2->,-> 1, 6)-beta-D-Fur-(2-> and-> 6)-alpha-D-Glcp-(1-> and beta-D-Fur-(2->), a side chain is mainly composed of beta-D-Fur-(2-> and-> 2)-beta-D-Fur-(6-> at a C-6 position of-> 1, 6)-beta-D-Fur-(2->), Fur represents furanose, Glcp represents glucopyranose, Glcp represents glucopyranose, and Glcp represents glucopyranose. The novel polysaccharide compound can relieve intestinal injury of mice, increase expression of tight nectin and mucoprotein, relieve oxidative stress reaction, promote production of short-chain fatty acid and improve composition of intestinal flora, and can be applied to the field of medicine as a medicine for treating ulcerative colitis. Meanwhile, the homogeneous polysaccharide PCP2 in polygonatum cyrtonema can significantly inhibit the activity of alpha-amylase and alpha-glucosidase, can also promote the ability of insulin resistance 3T3-L1 fat cells to uptake and consume glucose, shows a significant hypoglycemic effect, and has a good development prospect in the aspect of preparation of hypoglycemic drugs.

The invention provides a preparation method of mitochondria-targeted antioxidant hybrid vesicles. The preparation method comprises the following steps: S1, preparing and separating adipose-derived stem cell nano-vesicles; s2, preparing a liposome loaded with dihydromyricetin and distearoyl phosphatidyl ethanolamine-polyethylene glycol 2000-triphenylphosphine targeting peptide by an ethanol injection method; and S3, preparing the hybrid nano vesicles loaded with the dihydromyricetin and the distearoyl phosphatidyl ethanolamine-polyethylene glycol 2000-triphenylphosphine targeting peptide. The invention also provides the hybrid vesicles prepared by the method and application of the hybrid vesicles in preparation of refractory diabetes wound treatment drugs. The lipidosome and the adipose-derived stem cell nano-vesicles are hybridized to prepare the hybridized vesicles capable of targeting mitochondria and resisting oxidation, the hybridized vesicles are applied to wound treatment for the first time, the problem of oxidative stress of diabetic wounds is solved, wound healing is accelerated, and a new strategy is provided for optimizing mitochondrial function defects and oxidative stress of the diabetic wounds.

The disclosure provides methods for treating a subject in need thereof comprising administering to the subject a therapeutically-effective dose of psilocybin. The methods described herein may be used to treat a variety of diseases, disorders, and conditions. For example, the methods may be used to treat neurocognitive disorders (e.g., Alzheimer's disease, Parkinson's disease), ADHD, Epilepsy, Autism, Sleep-wake disorders, Chronic pain, Inflammatory Disorders, IBD, Stroke, ALS, and / or Multiple Sclerosis.

The present invention relates to heterocyclic derivatives and the use thereof in medicine, in particular to compounds represented by general formula (I) or stereoisomers, pharmaceutically acceptable salts or cocrystals and intermediates thereof, a preparation method therefor, and the use thereof in the preparation of drugs for treating autoimmune diseases or inflammatory diseases.

The invention discloses a method for promoting dissolution of eggshell membrane protein and preparing chelated calcium through high-pressure crushing. Comprising the following steps: separating and drying eggshells and eggshell membranes of egg shells, and respectively carrying out superfine grinding to obtain eggshell powder and eggshell membrane powder; adding water into the eggshell membrane powder, carrying out high-pressure homogenization, and centrifuging to obtain an eggshell membrane solution; adding eggshell powder into the eggshell membrane solution, adjusting the pH value to 1-3, and adding pepsase for reaction; after the reaction, adjusting the pH value of the eggshell membrane solution to 6.5-7.5, and adding trypsin for reaction; and after the reaction, inactivating the enzyme, centrifuging to take a supernatant, adding absolute ethyl alcohol into the supernatant for alcohol precipitation, and centrifuging to obtain a precipitate, namely the chelated calcium. The technical problem that the eggshell membrane protein is difficult to dissolve out is solved, and a new way is provided for industrial extraction of the eggshell membrane soluble protein.

To provide a device and a method for treating at least one of hypertension, pulmonary arteries, diabetes, obesity, heart failure, end-stage renal disease, digestive disease, urological disease, cancers, tumors, pain, asthma or chronic obstructive pulmonary disease by delivering an effective amount of a formulation to a tissue.SOLUTION: In embodiments of the present invention, the formulation may include at least one of a gas, a vapor, a liquid, a solution, an emulsion or a suspension of one or more ingredients. In embodiments of the present invention, amounts of the formulation and / or energy are effective in injuring or damaging tissue, nerves and nerve endings in order to relieve disease symptoms.SELECTED DRAWING: Figure 3B

The invention relates to the technical field of food, in particular to diglyceride for reducing triglyceride, cholesterol and uric acid as well as a biological enzyme preparation method and application of the diglyceride. The preparation method comprises the following steps: (1) adding water and glycerol into vegetable oil, and then adding immobilized lipase to react to obtain a reactant; (2) centrifuging reactants, collecting a light-phase product, carrying out molecular distillation, and collecting a heavy-phase product to obtain diglyceride; the immobilized lipase comprises lipase and a carrier, the carrier comprises loofah sponge, soybean meal and bentonite, and the mass ratio of the loofah sponge to the soybean meal to the bentonite is 1: (2-4): (3-6). The method has the advantages that the effects of reducing triglyceride, total cholesterol and uric acid are relatively good, and the yield and the purity are relatively high.

The present application relates to animal bifidobacterium lactis Ca360 and its application. The present application also provides the application of animal bifidobacterium lactis in promoting the absorption and transport of minerals, improving osteoporosis, iron deficiency anemia and zinc deficiency. The animal bifidobacterium lactis of the present application can promote the absorption and transport of minerals, improve osteoporosis, iron deficiency anemia and zinc deficiency.

The invention discloses a vitamin K2 composite micro-capsule system with stomach protection and intestine slow release functions and a preparation method and application thereof, the vitamin K2 composite micro-capsule system with stomach protection and intestine slow release functions comprises three layers, namely a core layer, a middle layer and an outer layer from inside to outside in sequence; the core layer is formed by coating vitamin K2 with a zein-lac hydrophobic core, the middle layer is a pea protein-pectin electrostatic compound, and the outer layer is sodium alginate and chitosan double-network gel. The micro-capsule system provided by the invention can be tightly combined in a gastric acid environment after being orally taken, the release of active ingredients in the stomach is reduced, and then the micro-capsule system stays at intestinal mucosa for a long time and slowly releases contents, so that the functions of the micro-capsule system are slowly presented outside, the half-life period is prolonged, and the action effect is improved. Vitamin K2 directly or indirectly participates in and regulates various physiological processes related to health, and plays an important role in the aspects of maintaining bone health, preventing cardiovascular diseases, protecting nerves, improving metabolism and the like.

Compositions and methods for administering ketone bodies to a subject include beta-hydroxybutyrate complexed with or coupled to at least one amino acid. The compositions and methods cause one or more of: weight loss, weight maintenance, reduced blood glucose level, maintenance of blood glucose level, increased muscle and physical performance, enhanced metabolic and cellular repair, improved detoxification and gut health, targeted bioavailability, sustained release and controlled absorption, increased metabolic efficiency, enhanced cellular uptake, minimized side effects, multifunctional therapeutics, improved focus, improved energy, improved cognitive function, improved mental acuity, treatment of traumatic brain injury, treatment of diabetes, treatment of neurological disorder, treatment of cancer, treatment of inflammatory condition, appetite suppression, anti-aging effects, anti-glycation effects, treatment of epilepsy, treatment of depression, improved performance, improved muscle mass, improved motor function, increased strength, increased metabolism, increased fat loss, increased fat oxidation, improved body composition, and improved mood.

The invention provides a stem cell exosome vesicle induced by traditional Chinese medicine functional components as well as a preparation method and application thereof, and belongs to the technical field of biological medicines. According to the preparation method of the stem cell exosome vesicle, traditional Chinese medicine functional components serve as an exosome inducer, stem cells can be induced to proliferate and secrete exosome with the enhanced function, the yield of the exosome can be increased, bioactive molecules can be loaded, and the bioavailability of the exosome in diabetes treatment is remarkably improved. The stem cell exosome vesicle disclosed by the invention can be applied to treatment of diabetes and complications thereof, not only can improve functions of islet cells, but also can treat chronic inflammation, microangiopathy and other metabolic diseases related to diabetes, and has a wide clinical application prospect.

The present invention discloses a pharmaceutical composition comprising a circular RNA and a drug delivery carrier. Compared with traditional linear 1 * siRNA and annular 1 * siRNA, the number of repeated series connection of positive-sense strands is increased to include but not limited to two or more, it is accidentally found that the silence effect is remarkably enhanced, the expression level of the PCSK9 gene can be remarkably reduced, and degradation of mRNA of PCSK9 protein is mediated. The nano-particles are used for delivering oligonucleotide, so that the stability is improved, the immunogenicity is reduced, the effects of lowering cholesterol, reducing aortic plaque load and resisting atherosclerosis are improved, and the nano-particles are safe and free of obvious liver and kidney toxicity and have a wide application prospect in the aspect of preparing medicines for treating hypercholesterolemia and coronary heart disease.