35944results about "Digestive system" patented technology

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

Antibody formulations are described comprising a mixture of an anti-α4β7 antibody, an antioxidant or chelator, and at least one free amino acid. The disclosed formulations may have improved stability, reduced aggregate formation, or both. The present invention further provides a safe dosing regimen of these antibody formulations that is easy to follow, and which results in a therapeutically effective amount of the anti-α4β7 antibody in vivo.

The disclosure provides methods for treating a subject in need thereof comprising administering to the subject a therapeutically-effective dose of psilocybin. The methods described herein may be used to treat a variety of diseases, disorders, and conditions. For example, the methods may be used to treat anxiety disorders, eating disorders, and headache disorders.

The invention discloses an amorphous tigorasone solid dispersion which has excellent stability and dissolvability, by adding copovidone, a powerful hydrogen bond is formed between tigorasone and copovidone, and by adjusting the type of an adhesive and the proportion of the adhesive to tigorasone, the problems of easy crystal transformation of amorphous tigorasone, poor solubility and the like are solved. And the technical problem is solved. The tigorazan tablet prepared from the amorphous solid dispersion provided by the invention does not generate crystal transformation after being placed for 30 days under the conditions of 60 DEG C and 75% RH, and the dissolution curve in a standard medium is consistent with that of a reference preparation.

To provide a compound which is a novel proline derivative, and to provide a pharmaceutical composition comprising the compound for the treatment of, for example, systemic sclerosis (SSc) and non-alcoholic steatohepatitis (NASH).SOLUTION: A pharmaceutical composition comprises, as a cGAS inhibitor, a compound which is a novel proline derivative encompassed by formula (I), or a prodrug, a pharmaceutically acceptable salt, or a stereoisomer of the compound.SELECTED DRAWING: None

The invention belongs to the technical field of biology, and discloses a reagent combination or kit for constructing intestinal organs and application of the reagent combination or kit. According to the reagent combination or the kit, intestinal organs can be obtained from cell-derived epithelial cells obtained from a donor in a non-invasive manner, and the obtained intestinal organs can be cryopreserved and recovered and can be amplified in vitro for a long time; transcriptome characteristics are similar to those of real human small intestine tissues, and typical marker genes of various small intestine pedigree cell types are highly expressed; compared with intestinal organs obtained through induction of pluripotent stem cells, the intestinal organs have more intestinal pedigree characteristics, and the intestinal function development is more mature; after being promoted to be mature, the intestinal organ also highly expresses genes related to drug absorption and metabolism, has drug absorption capability similar to that of an immortalized intestinal cell line, but more prominently shows intestinal cell lineage characteristics, is closer to an intestinal environment in a real human body, and can be used for screening intestinal disease drugs; the intestinal barrier function is realized.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The disclosure provides methods for treating a subject in need thereof comprising administering to the subject a therapeutically-effective dose of psilocybin. The methods described herein may be used to treat a variety of diseases, disorders, and conditions. For example, the methods may be used to treat anxiety disorders, eating disorders, and headache disorders.

The invention relates to lactobacillus rhamnosus CBBM005 and application thereof in products for balancing intestinal flora, improving immunity and improving oral cavity, and belongs to the technical field of microorganisms. The lactobacillus rhamnosus CBBM005 is separated from human intestinal secretion, the lactobacillus rhamnosus CBBM005 is preserved in the China General Microbiological Culture Collection Center (CGMCC), the preservation time is March 20, 2025, and the preservation number is CGMCC NO.33904. The lactobacillus rhamnosus CBBM005 has the characteristics of balancing intestinal flora, improving immunity and improving oral cavity.

Described herein are GLP-1R agonists and pharmaceutical compositions comprising said compounds. The subject compounds and compositions are useful for the treatment of a GLP-1 associated disease or disorder, including Type 2 diabetes or obesity.

The invention discloses a nano-enzyme as well as a preparation method and application thereof, and relates to the technical field of nano-enzymes. According to the preparation method, natural polyphenol, a cerium source and polyethylene glycol are mixed to prepare the novel polyphenol nano-enzyme, the preparation method is simple and easy to implement, the preparation cost is low, the prepared nano-enzyme has good biocompatibility, and a new way is provided for effective treatment of inflammatory diseases.

The pediococcus acidilactici SWU-HX39 with the uricemia reducing function is classified and named as pediococcus acidilactici, and is preserved in the China General Microbiological Culture Collection Center (CGMCC), the preservation number is CGMCC No.33055, the preservation date is December 13, 2024, and the preservation address is No.3, Yard 1, Beichen West Road, Chaoyang District, Beijing. The pediococcus acidilactici SWU-HX39 disclosed by the invention can be used for relieving kidney injury caused by hyperuricemia; synthesis of uric acid can be reduced, the concentration of uric acid in blood can be reduced, the excretion capacity of the body to the uric acid is improved, reabsorption of the body to the uric acid is reduced, and the effect of reducing the uric acid is achieved through two ways; in addition, the SWU-HX39 can be used for reducing the expression of LPS (Lipopolysaccharide), and reducing the expression of inflammatory factors IL-1beta, IL-6 and TNF (Tumor Necrosis Factor) alpha at the same time. The traditional Chinese medicine composition not only has the effects of resisting inflammation and relieving liver inflammation, but also can improve the SCFAs content, especially propionic acid, in the body of a hyperuricemia patient, so that the uric acid level is reduced, and the abnormal uric acid content is improved.

The invention provides an application of a fermentation lactobacillus mucus strain A21196 in preparation of a product for resisting anxiety and improving memory and concentration, and belongs to the technical field of biological medicines. Animal experiments show that the fermented lactobacillus mucus strain A21196 has the effects of resisting anxiety, resisting depression, improving cognitive impairment function and improving memory concentration, and provides a new means for preventing and / or treating nerve diseases related to anxiety disorder, depression and cognitive impairment.

A dual-targeting siRNA agent, comprising two different siRNAs targeting two different genes or pharmaceutically acceptable salts thereof, the two different siRNAs or salts thereof being linked to each other by means of a pharmaceutically acceptable ligand, the siRNAs being dsRNAs consisting of sense strands and antisense strands, and the two different genes being two selected from angiotensinogen (AGT), proprotein convertase subtilisin / kexin type 9 (PCSK9) and human angiopoietin-like protein 3 (ANGPTL3). Also provided is the use of the dual-targeting siRNA agent in preparing a drug for preventing or treating diseases related to hypertension or / and lipid imbalance. The dual-targeting siRNA agent can simultaneously and effectively inhibit the expressions of the two target genes in vivo, and has the advantages of no mutual antagonism, high activity and high safety. Further provided are siRNAs of genes corresponding to the dual-targeting siRNA agent and the use thereof for preventing or treating diseases related to hypertension or / and lipid imbalance.

The invention relates to the field of microorganisms, and discloses lactobacillus plantarum with an antibacterial effect and application of the lactobacillus plantarum, and the preservation number of the lactobacillus plantarum is CGMCC (China General Microbiological Culture Collection Center) No.33151. The strain provided by the invention has relatively strong cholate resistance, gastric acid resistance, acid production and H2O2 production capabilities, and has a relatively strong bacteriostatic effect on common pathogenic bacteria such as staphylococcus aureus, candida albicans, escherichia coli, salmonella and helicobacter pylori; the compound can inhibit the activity of urease, interfere helicobacter pylori colonization and the like to inhibit helicobacter pylori infection or reduce the symptoms of helicobacter pylori infection and reduce the disease degree of mice with colitis, can be used for preparing microbial preparations, and has the potential of preparing drugs for preventing and / or treating diseases caused by helicobacter pylori infection.

The invention provides a modified TnpB-omega RNA gene editing system and application of the modified TnpB-omega RNA gene editing system. In particular, the present invention provides a modified TnpB related [omega] RNA skeleton. The modified omega RNA skeleton provided by the invention has at least three stem-loop structure fragments, and has a shorter length and a compact structure than a natural omega RNA skeleton, so that the modified omega RNA skeleton and TnpB can be jointly carried in a single AAV vector, the administration efficiency is improved, and high-efficiency gene editing is realized.

Described herein are novel and improved antibodies that bind Interleukin 13 (IL-13) and methods of use thereof. In certain aspects, described herein are methods of inhibiting IL-13 biological activity. In certain aspects, described herein are pharmaceutical compositions comprising the anti-IL-13 antibodies. In certain aspects, the antibodies and methods described herein are used for treatment of an inflammatory disease or disorder associated with elevated levels of IL-13 and / or IgE.

The disclosure provides methods for treating a subject in need thereof comprising administering to the subject a therapeutically-effective dose of psilocybin. The methods described herein may be used to treat a variety of diseases, disorders, and conditions. For example, the methods may be used to treat neurocognitive disorders (e.g., Alzheimer's disease, Parkinson's disease), ADHD, Epilepsy, Autism, Sleep-wake disorders, Chronic pain, Inflammatory Disorders, IBD, Stroke, ALS, and / or Multiple Sclerosis.

The invention provides application of polygonatum cyrtonema polysaccharide in preparation of medicines for treating ulcerative colitis or reducing blood glucose. A main chain of a sugar chain structure of the homogeneous polysaccharide PCP2 in polygonatum cyrtonema is mainly composed of-> 1)-beta-D-Fur-(2->,-> 1, 6)-beta-D-Fur-(2-> and-> 6)-alpha-D-Glcp-(1-> and beta-D-Fur-(2->), a side chain is mainly composed of beta-D-Fur-(2-> and-> 2)-beta-D-Fur-(6-> at a C-6 position of-> 1, 6)-beta-D-Fur-(2->), Fur represents furanose, Glcp represents glucopyranose, Glcp represents glucopyranose, and Glcp represents glucopyranose. The novel polysaccharide compound can relieve intestinal injury of mice, increase expression of tight nectin and mucoprotein, relieve oxidative stress reaction, promote production of short-chain fatty acid and improve composition of intestinal flora, and can be applied to the field of medicine as a medicine for treating ulcerative colitis. Meanwhile, the homogeneous polysaccharide PCP2 in polygonatum cyrtonema can significantly inhibit the activity of alpha-amylase and alpha-glucosidase, can also promote the ability of insulin resistance 3T3-L1 fat cells to uptake and consume glucose, shows a significant hypoglycemic effect, and has a good development prospect in the aspect of preparation of hypoglycemic drugs.

The invention belongs to the technical field of medicines, and provides a cassia twig granular preparation as well as a preparation method and a product thereof. The cassia twig granule preparation is prepared from the following components in parts by weight: 35 to 50 parts of cassia twig granule extract dry paste and 50 to 105 parts of auxiliary materials, the auxiliary materials comprise lactose, beta-cyclodextrin and derivatives thereof, and citric acid. According to the invention, beta-cyclodextrin and derivatives thereof are used for replacing dextrin as an auxiliary material in the cassia twig granules, so that the interference problem of dextrin in drug detection is avoided, the formability, solubility and hygroscopicity of the cassia twig granule preparation are ensured, the stability of the preparation is improved, and the comprehensive performance is excellent.

The disclosure provides methods for treating a subject in need thereof comprising administering to the subject a therapeutically-effective dose of psilocybin. The methods described herein may be used to treat a variety of diseases, disorders, and conditions. For example, the methods may be used to treat neurocognitive disorders (e.g., Alzheimer's disease, Parkinson's disease), ADHD, Epilepsy, Autism, Sleep-wake disorders, Chronic pain, Inflammatory Disorders, IBD, Stroke, ALS, and / or Multiple Sclerosis.

The invention belongs to the field of new application of medicines, and particularly relates to gastrodia elata polysaccharide and application thereof. The gastrodia elata polysaccharide component GEP-2 is separated from crude gastrodia elata polysaccharide, structural characterization detection is conducted on the GEP-2, the result shows that the gastrodia elata polysaccharide GEP-2 is prepared from, by mass, 89.08% of glucose, 2.40% of galactose, 7.12% of galacturonic acid, 0.86% of arabinose and 0.54% of rhamnose, and the animal experiment result shows that the GEP-2 relieves the symptoms of mouse colitis, relieves weight loss and shortens the colon length; the traditional Chinese medicine composition has the advantages of reducing serum TNF-alpha, IL-1beta and IL-6 proinflammatory cytokine levels, improving the intestinal barrier function, reducing inflammatory cell infiltration, regulating the intestinal flora composition structure of mice and relieving ulcerative colitis.

The present application relates to animal bifidobacterium lactis Ca360 and its application. The present application also provides the application of animal bifidobacterium lactis in promoting the absorption and transport of minerals, improving osteoporosis, iron deficiency anemia and zinc deficiency. The animal bifidobacterium lactis of the present application can promote the absorption and transport of minerals, improve osteoporosis, iron deficiency anemia and zinc deficiency.

The invention provides a traditional Chinese medicine composition and an application thereof in preparing a product for preventing, alleviating or treating acute hepatopancreatic necrosis of shrimp, belonging to the field of veterinary medicine. The active ingredients of the traditional Chinese medicine composition include isatis root, artificial bezoar, liquorice, borneol, pig gall powder and xuanming powder. The traditional Chinese medicine composition has a good therapeutic effect on preventing, alleviating or treating acute hepatopancreatic necrosis of shrimp, with a cure rate of more than 70%, has antibacterial and liver-protecting effects, can effectively improve the degree of liver damage, improve the survival rate of shrimp and reduce losses.

The invention discloses an active polypeptide Tigerin-OL1 capable of promoting healing of oral ulcer and application of the active polypeptide Tigerin-OL1. The active polypeptide Tigerin-OL1 capable of promoting healing of the oral ulcer has an amino acid sequence ICTMIPISRCY as shown in SEQ ID No.1 (sequence identifier number 1). The application of the polypeptide Tigerin-OL1 is the application of the polypeptide Tigerin-OL1 in preparation of drugs for promoting healing of oral ulcer. The polypeptide Tigerin-OL1 provided by the invention has excellent oral ulcer healing promoting activity in vivo and in vitro, only contains 11 amino acids and is easy to synthesize, and a new way is provided for development of drugs for promoting oral ulcer healing.

Building on U.S. Provisional Patent Application No. 63 / 693,803, paragraphs for 2D-to-3D conversion and [0023]-[0024] for secure content verification, the Matrix 3D AI Polygon Mesh Hash Key System revolutionizes transforming 2D content into secure, interactive 3D AR / VR assets. Integrating AI and LiDAR, it enables real-time 3D mesh generation with precise geospatial anchoring. Users can reshape 3D content instantly via natural language commands, enhancing interactivity. Quantum-resistant encryption, using AES-256 and CRYSTALS-Kyber, ensures robust asset security. The system excels in gaming, surveillance, content verification, military operations, space exploration, deepfake detection, and pharmaceutical research, offering unmatched precision and scalability. Its multi-stage rendering pipeline, powered by distributed AI-driven bots, supports efficient real-time 3D mesh generation, achieving 95% accuracy and 1 cm resolution. This AR / VR technology advancement transforms industries with scalable, secure solutions for interactive 3D content creation and management, setting a new standard for precision and versatility.

The invention relates to the technical field of microorganisms, in particular to application of lactobacillus rhamnosus KF7 in improving intestinal barrier injury and regulating intestinal flora and functional food containing the lactobacillus rhamnosus KF7. The invention provides application of lactobacillus rhamnosus KF7 in preparation of a product for improving intestinal barrier injury and / or regulating intestinal flora. The preservation number of the lactobacillus rhamnosus KF7 is CGMCC (China General Microbiological Culture Collection Center) NO.6430. The invention further provides application of the lactobacillus rhamnosus KF7 in preparation of a product for improving intestinal barrier injury and / or regulating intestinal flora. The invention discloses the novel application of the caseus rhamnosus KF7 in the aspects of improving the normal intestinal epithelial barrier function, protecting the normal intestinal epithelial barrier from lipopolysaccharide induced barrier injury, recovering animal intestinal barrier injury caused by rhythm disorder, regulating intestinal flora disorder and improving growth, development and metabolic states for the first time. The method can be used for producing functional food products such as fermented milk, lactic acid bacteria beverages, probiotic powder, viable bacteria water, milk powder and cheese.

The invention relates to the technical field of pharmaceutical preparations, and discloses a composition with liver protection and antioxidation effects and a preparation method thereof.The composition is prepared from galactosamine modified astragalus membranaceus exosome, schisandra chinensis nanocrystals, liquorice-chitosan nanoparticles, lactobacillus acidophilus freeze-dried powder, beta-(1, 3) / (1, 3, 4-tetramethyl-1, 3-pentanediol monoisobutyrate) sourced from saccharomyces cerevisiae, and beta-(1, 3, 4-tetramethyl-1, 3-pentanediol monoisobutyrate). And (6) a dextran, grape exosome-curcumin hybrid vesicle freeze-dried powder, a curcumin-mitochondrial targeting peptide compound, a resveratrol-hydroxypropyl-beta-cyclodextrin inclusion compound and reduced panthenol. According to the liver-protecting and anti-oxidation composition disclosed by the invention, multi-dimensional intervention on liver protection is realized through an elaborately designed ternary system. The system is composed of a traditional Chinese medicine extract, a microorganism-plant exosome combination and a high-bioavailability antioxidant, all the parts have a synergistic effect, and the liver protection effect is remarkably improved.