25369 results about "Amino acid" patented technology

The invention relates to the technical field of antibacterial peptides, and particularly discloses a marine antibacterial peptide and application thereof, and the amino acid sequence of the marine antibacterial peptide is as shown in SEQ ID NO.1: MWKLPKWRNGRRRGFKIPRW. The marine antibacterial peptide CD109 provided by the invention has an inhibition effect on staphylococcus aureus, acinetobacter baumannii, pseudomonas aeruginosa and klebsiella pneumoniae, and has extremely low cytotoxicity.

The present application relates to the field of biotechnology, and in particular to an epimerase for synthesizing D-tagatose and its application, wherein the epimerase produces a mutation at position 100, or at position 125, or at position 127, or at position 131, or at position 268, or at position 270, or at position 271, or at position 308, or at position 339, or at position 340, or at position 342, or at position 366, or at position 402, or at position 437, or at position 440 in the amino acid sequence shown in SEQ ID NO. 142; through the above-mentioned method, the epimerase exhibits excellent epimerization activity at the 4th carbon position of D-fructose, can efficiently convert D-fructose into D-tagatose, and is beneficial to improving the synthesis efficiency of D-tagatose.

The invention discloses an identification method and system of a short antibacterial peptide sequence, a terminal and a storage medium. Relates to the technical field of bioinformatics. A short antibacterial peptide data set is obtained in advance, a training set is obtained through division according to the short antibacterial peptide data set, and a pre-trained protein language model is finely adjusted according to the training set; obtaining sequence features of a to-be-classified sequence through the fine-tuned protein language model; obtaining physicochemical characteristics of the to-be-classified sequences through an analysis method based on pseudo amino acid components; inputting the sequence features and the physicochemical features into an attention model for feature fusion to obtain fusion features of the to-be-classified sequence; and inputting the fusion features into a classifier to obtain a prediction category of the to-be-classified sequence. According to the method, the pre-training model is finely adjusted by establishing a more perfect short antibacterial peptide data set, the sequence features and the physicochemical features of the to-be-classified sequences are fused, and the sequences are classified through the fused features, so that the recognition accuracy of the short antibacterial peptides can be effectively improved.

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

The invention relates to the field of biological medicine, in particular to a stapled peptide targeting RAS-Raf protein interaction and application of the stapled peptide, the stapled peptide is obtained in the mode that Ac-SLHDCLMKALKVR-NH2 and Ac-SLHDCLMKALKVRGL-NH2 serve as peptide chain templates, amino acid at the i site and amino acid at the (i + 4) site are replaced with S5 and cyclized, and the nitrogen terminal is further modified with stearic acid. The stapled peptide can effectively inhibit proliferation and migration of tumor cells; the serum stability is high, and meanwhile, the cell transmembrane capability is excellent, so that target protein in cells can be better targeted, and the biological function of the target protein can be exerted. Therefore, the alphaH helical conformation of the RBD of the RAF can be stabilized through the stapled peptide and a nitrogen-terminal fatty acid modification strategy, the membrane permeability and stability of the RAF are improved, the binding force of the RAF and RAS is further improved, and proliferation and migration of various tumor cells are inhibited.

The invention relates to the field of biotechnology and medicine, and more particularly to a polypeptide having the amino acid sequence SEQ ID NO: 1 and being capable of inhibiting RAS-GTPase activity, to the use of said polypeptide to produce a drug for treating stomach cancer or rectal cancer in a dose of 0.81-3.00 mg / kg, as well as to a drug based on said polypeptide for the treatment of stomach cancer or rectal cancer, and to a method for treating stomach cancer or rectal cancer by intraperitoneally administering said drug to a subject in an amount of 150 ml twice at an interval of 7 days.

To provide VHH-containing polypeptides that bind CD123, and a method for treating cancer that includes administration of the VHH-containing polypeptides.SOLUTION: Provided is a polypeptide comprising at least one VHH domain that binds to CD123, comprising CDR1, CDR2, and CDR3, each comprising a specific amino acid sequence.SELECTED DRAWING: Figure 3A

The invention discloses a novel santalene synthase gene as well as an encoding protein and application thereof. The amino acid sequence of the santalene synthetase is as shown in SEQ ID NO. 2. The invention relates to a method for carrying out functional verification on a new sandalene synthase gene encoding enzyme from sandalwood and carrying out synthesis of sandalene and bergamoene in escherichia coli and tobacco leaves. According to the invention, the enzyme can be massively prepared by utilizing escherichia coli, is applied to synthesis of santalene and bergamoene, can be further applied to synthesis of bergamoene or santalene, and has important significance; the heterologous synthesis of the high-value santalene and the bergamoene in plants can also be realized, and the method has a wide industrial practical prospect and a large-scale development potential.

The invention relates to a nano antibody targeting cadherin 17 and application thereof, and relates to the technical field of immunology and molecular biology, the amino acid sequence of a complementary determining region of the nano antibody targeting cadherin 17 comprises CDR1 shown as any one of SEQ ID NO: 21-32, CDR2 shown as any one of SEQ ID NO: 34-45, and CDR3 shown as any one of SEQ ID NO: 47-58. According to the invention, an alpaca immune phage display library is constructed, a series of nano antibody molecules targeting cadherin 17 (CDH17) are screened from the alpaca immune phage display library, and functions and applications of the nano antibody are verified at various levels of CDH17 antigen protein, CDH17 target cells, CDH17 CAR-T cells and the like.

The invention discloses a glycosyl transferase mutant for synthesizing rebaudioside M and a synthesis method of rebaudioside M, and belongs to the technical field of gene engineering. The glycosyl transferase mutant for synthesizing the rebaudioside M is a glycosyl transferase UGT76G4 mutant and / or a glycosyl transferase UGT91C1 mutant, and the glycosyl transferase mutant is a glycosyl transferase UGT76G4 mutant. The glycosyl transferase UGT76G4 mutant is obtained by mutation of an amino acid sequence as shown in SEQ ID NO: 1: 85th amino acid is mutated into R from L, and 90th amino acid is mutated into G from I; the glycosyltransferase UGT91C1 mutant is obtained by mutating an amino acid sequence shown in SEQ ID NO: 3 as follows: the 204th amino acid is mutated into A from L, the 208th amino acid is mutated into A from F, and the 380th amino acid is mutated into D from G. The mutant can realize efficient catalytic synthesis of rebaudioside M, and the yield of rebaudioside M synthesized by an enzymic method is improved.

The invention belongs to the technical field of cosmetics, and discloses anti-aging recombinant collagen as well as a preparation method and application thereof. The amino acid sequence of the anti-aging recombinant collagen is as shown in SEQ ID NO.1, and the nucleotide sequence of the anti-aging recombinant collagen is as shown in SEQ ID NO.2. The recombinant collagen CaI1 is constructed and expressed by recombining the effective sequences of the I-type collagen, the III-type collagen and the XVII-type collagen, and the recombinant collagen CaI1 is free of cytotoxicity, free of hidden danger of endotoxin and good in safety. The skin care product added with the recombinant collagen CaI1 can promote skin collagen absorption, inhibit skin aging and improve skin elasticity, and has a good application prospect.

The invention relates to a high-activity recombinant XVII type collagen as well as a rapid preparation method and application thereof, and belongs to the technical field of bioengineering. The amino acid sequence of the high-activity recombinant XVII type collagen is as shown in SEQ ID NO. 1, and the nucleotide sequence of the high-activity recombinant XVII type collagen is as shown in SEQ ID NO. 2. The invention also provides a preparation method and application of the recombinant XVII type collagen. The high-activity recombinant XVII type collagen has good biological activity, has good effects of promoting cell adhesion, cell proliferation and cell migration, and can be compounded with other proteins to form raw materials of tissue engineering products, cosmetics, health care products or medicines. The high-activity recombinant XVII type collagen gene is integrated to different positions of a yeast genome through three different vectors, and the copy number of a target gene is increased, so that the expression quantity of the recombinant XVII type collagen is remarkably increased, and the yield of the high-activity recombinant XVII type collagen is effectively increased.

The invention belongs to the technical field of optimized coding genes, and discloses a recombinant human I-type collagen as well as a preparation method and application thereof, and the amino acid sequence of the recombinant human I-type collagen is shown as SEQ ID No.1. The recombinant I-type collagen provided by the invention is relatively high in expression quantity, has relatively good cell migration promoting, cell proliferation promoting and cell adhesion promoting properties, is high in safety, and can be widely applied to the fields of medicines, medical instruments, biological materials, tissue engineering, cosmetics and the like.

The invention discloses a bovine serum albumin combined nano antibody and a preparation method and application thereof, the amino acid sequence of the bovine serum albumin combined nano antibody Nb1 is shown as SEQ.ID No.1, the nano antibody Nb not only has high affinity to bovine serum albumin, but also has good binding activity to both human serum albumin and mouse serum albumin, and the nano antibody Nb has high affinity to human serum albumin and mouse serum albumin. And the antibody has a relatively good broad-spectrum application range, and can be widely applied to the aspects of drug half-life period enhancement, tumor targeted therapy and imaging, immunodetection or diagnosis, recombinant albumin purification or enrichment and the like.

The invention relates to a monoclonal antibody for detecting folic acid and a binding protein complex thereof or an antigen binding fragment thereof, and a preparation method and application thereof, the monoclonal antibody or the antigen binding fragment thereof comprises: (1) a heavy chain variable region having an amino acid sequence as shown in SEQ ID NO.1, SEQ ID NO.2 and SEQ ID NO.3, HCDR1, HCDR2 and HCDR3, and (2) a heavy chain variable region having an amino acid sequence as shown in SEQ ID NO.3; the light chain variable region is provided with an LCDR1, an LCDR2 and an LCDR3, and the amino acid sequences of the LCDR1, the LCDR2 and the LCDR3 are respectively shown as SEQ ID NO.4, SEQ ID NO.5 and SEQ ID NO.6. The monoclonal antibody or the antigen binding fragment thereof can bind folic acid and a protein compound thereof with high specificity and high affinity, so that the detection accuracy and sensitivity of folic acid are improved, the limitation that a traditional competition method detection reagent is low in sensitivity and poor in clinical correlation is broken through, and sandwich method immunodetection of folic acid is realized.

The invention discloses an antibacterial peptide and antibacterial application thereof. The amino acid sequence of the antibacterial peptide is as shown in SEQ ID No.1, and the C end of the antibacterial peptide is amidated. The antibacterial peptide provided by the invention has the activity of resisting staphylococcus aureus and escherichia coli, and plays a role in inhibiting bacteria by destroying cell membranes. The antibacterial peptide is excellent in antibacterial activity, good in stability and not prone to generating drug resistance, can be used for synthesizing and preparing antibacterial compositions, and has great potential in application in the fields of food and medicine.

The invention discloses a broad-spectrum antibacterial peptide SS-7 and application thereof, and belongs to the field of biological medicine. The amino acid sequence of the broad-spectrum antibacterial peptide SS-7 disclosed by the invention is VRRVRFVVLRRIKKWRRI, and the broad-spectrum antibacterial peptide SS-7 has a remarkable inhibition effect on various gram-positive bacteria and gram-negative bacteria such as drug-resistant strains such as methicillin-resistant staphylococcus aureus (ATCC43300) and shows low toxicity and no hemolytic toxicity on eukaryotic cells and red blood cells of mammals; lPS and lipoteichoic acid on the surfaces of bacteria can be combined to achieve the effect of neutralizing the bacteria, and a very good treatment and protection effect is achieved on animals infected by the bacteria. The antibacterial peptide SS-7 can be used for preparing an antibacterial agent and preparing a medicine for preventing or treating bacterial infection, has the advantages of being wide in antibacterial spectrum, low in drug-resistant mutation frequency, low in toxicity and low in production cost, can effectively solve the current bacterial drug resistance problem, and has wide application prospects and important clinical value.

The invention provides a recombinant humanized III-type collagen with a triple helix structure and preparation and application thereof, and belongs to the technical field of protein engineering, the amino acid sequence of the recombinant humanized III-type collagen comprises n core units, n is an integer of 1 or greater than 1, and the amino acid sequence of each core unit is as shown in SEQ ID NO: 1; the invention also provides a construction method of the expression system and a preparation method of the recombinant humanized III-type collagen. The invention also provides practical industrial application according to the characteristics of the protein. The recombinant humanized III-type collagen provided by the invention is high in purity, good in stability and high in biological activity, and experiments show that the recombinant humanized III-type collagen has various biological activities of promoting cell proliferation and migration and the like.

The invention provides recombinant human III-type collagen which is of a triple-helix structure and assembled into collagenous fibers and application of the recombinant human III-type collagen, and belongs to the technical field of bioengineering. Collagen fragments capable of forming a triple helix structure are screened out through a bioinformatics algorithm, the fragments are connected in series, a key C-terminal structural domain and a specific amino acid sequence are combined, and formation of a stable triple helix advanced structure and assembly of collagenous fibers are effectively promoted. The recombinant human III type collagen is efficiently expressed through a eukaryotic expression system, and shows excellent stability, low immunogenicity and good biocompatibility. Experimental results show that the prepared recombinant human III-type collagen not only has a natural triple helix structure, but also can be further assembled into macromolecular collagen fibers, is suitable for multiple fields such as medical beauty, bioengineering and tissue repair, and has wide application prospects and market values.

Systems, methods, and apparatus for generating a DNA / gene sequence output, given a protein sequence input. In one aspect, the protein-to-DNA mapping system includes a protein language model (embedder) that generates a high-dimensional protein embedding from a low-dimensional protein sequence input; and the system includes a protein-to-DNA translator that processes the protein embedding and generates a DNA sequence output, based on the protein embedding. The protein-to-DNA translator is a neural network (e.g., a Seq2Seq model) and is configured with translation coefficients that may be trained with a training dataset, comprising the training protein and DNA embeddings. Training the translation coefficients can include supervised learning that maps the protein embedding (input) to a DNA sequence (target). The systems, methods, and apparatus may increase protein yield / expression, improve protein functionality, enhance gene therapy efficacy, streamline synthetic biology design, and / or broaden functional genomics studies, all leading to reduced costs, better performance, and increased accessibility.

The invention belongs to the technical field of biology, and relates to an escherichia coli engineering strain for producing L-isoleucine through a methyl malic acid way as well as a construction method and application of the escherichia coli engineering strain. According to the invention, Escherichia coli BW25113 is used as a chassis strain, and a methyl malic acid synthase high-activity mutant gene cimA3.7, an isopropyl malic acid isomerase gene GsleuCD, a 3-isopropyl malic acid dehydrogenase gene AfleuB and a leucine dehydrogenase gene Lsleudh are over-expressed; a methyl malic acid absorption protein gene is over-expressed, and a branched chain amino acid transport system is modified to improve the exosome of the L-isoleucine; all methyl malic acid pathway related genes are integrated to a genome of a chassis strain, and a plasmid-free L-isoleucine production strain is constructed; the copy number of a key gene on a genome is optimized, and the yield of the engineering strain L-isoleucine is increased by introducing a non-oxidative glycolysis approach. The yield of the L-isoleucine after the engineering strain is fermented for 34 hours in a fermentation tank is 56.6 g / L.

A method for predicting one or more features of an antigen-binding protein is provided, comprising: providing the amino acid sequence of at least part of one or more chains of the antigen-binding protein or an encoded sequence derived therefrom as input to a deep learning model comprising a sequence encoding module configured to take as input an amino acid sequence and to produce as output an embedding corresponding to the input sequence, and predicting the one or more features of the antigen-binding protein using the embedding produced by the sequence encoding module The sequence encoding module has been trained as part of a machine learning model comprising a structure encoding module, and using training sequence data and structure data from a plurality of antigen-binding proteins. Related methods, systems and products are also described.

The present disclosure relates to compositions of matter, methods, and systems for analyzing polymeric macromolecules, including polymeric macromolecules such as peptides, polypeptides, and proteins.

Provided are a protein language model training method, a method for extracting an amino acid sequence representation by using a protein language model, a method for obtaining a new amino acid sequence by using a protein language model, a method for obtaining a related amino acid sequence by using a protein language model, a method for predicting an amino acid sequence perplexity by using a protein language model, an electronic device, a computer-readable medium, and a program product. The protein language model training method comprises: during a training process, executing at least one training sub-task amongst two training sub-tasks included in a first type of training task and a second type of training task; and, on the basis of a first loss value corresponding to the first type of training task and a loss value corresponding to the second type of training task, adjusting parameters of a protein language model to obtain a trained protein language model.

The invention relates to the technical field of biology, in particular to a verticillium dahliae virulence gene, a verticillium dahliae virulence protein and application. The invention discloses a verticillium dahliae virulence gene VdPHO23like. The verticillium dahliae virulence gene VdPHO23like comprises a polynucleotide sequence for coding an amino acid sequence of SEQ ID NO: 3. According to the invention, expression of the gene is inhibited in a targeted manner through an RNA interference mediated gene silencing technology so as to weaken virulence of pathogenic bacteria, and an efficient, specific and environment-friendly comprehensive prevention and control strategy is provided for verticillium wilt of crops such as cotton.

The invention discloses a xanthine oxidase inhibitory peptide with a kidney improving function and application thereof, and belongs to the technical field of biological medicines.The xanthine oxidase inhibitory peptide is screened out by conducting enzymolysis, separation and purification on litopenaeus vannamei processing by-products and utilizing a molecular docking technology, the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Leu-Gly-Pro-Pro-Pro, and the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Leu-Gly-Pro-Pro-Pro. And the half inhibition concentration of the polypeptide is 2.356 + / -0.2448 mM. The xanthine oxidase inhibitory peptide is proved to have an improvement effect on hyperuricemia mice, the improvement effect is mainly characterized by reducing the content of serum uric acid, creatinine and urea nitrogen of the hyperuricemia mice, inhibiting the activity of xanthine oxidase (XOD) in serum and livers of the mice, inhibiting synthesis of uric acid and improving kidney injury of the mice, and Toxinpred prediction shows that the xanthine oxidase inhibitory peptide has the effect of inhibiting the activity of xanthine oxidase (XOD) in the serum and livers of the mice. The xanthine oxidase inhibitory peptide is free of toxic and side effects, so that the xanthine oxidase inhibitory peptide has a wide application prospect in preparation of food or drugs for improving renal functions.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The present disclosure relates to compositions of matter, methods, and systems for analyzing polymeric macromolecules, including polymeric macromolecules such as peptides, polypeptides, and proteins.

The invention provides a broad-spectrum antibacterial peptide, an antibacterial agent and application, and belongs to the technical field of biological medicine. The invention provides a broad-spectrum antibacterial peptide. The broad-spectrum antibacterial peptide comprises an amino acid sequence as shown in SEQ ID No. 1. The minimum inhibitory concentration of the antibacterial peptide to gram-positive bacteria, gram-negative bacteria and fungi proves that the antibacterial peptide has obvious antibacterial activity to the gram-positive bacteria, the gram-negative bacteria and the fungi. The invention also verifies the minimum inhibitory concentration of the antibacterial peptide to clinical drug-resistant bacteria. The cytotoxicity of the SL-12 disclosed by the invention is relatively weak, the SL-12 only shows obvious cytotoxicity at 200 [mu] g / ml, and the minimum inhibitory concentration of the SL-12 is 6.25-12.5 [mu] g / ml; the SL-12 has no obvious hemolytic activity when the concentration is 100 [mu] g / ml or lower, and is high in safety.

The invention provides a carbonyl reductase mutant. The carbonyl reductase mutant is obtained by performing single-point mutation or multi-point combined mutation on the 17th site, the 40th site and the 64th site of an amino acid sequence as shown in SEQ ID NO.1. The invention also provides a coding gene, a recombinant vector containing the coding gene, a co-expression engineering bacterium and an application of the co-expression engineering bacterium. Compared with a wild type enzyme, the carbonyl reductase mutant has high activity and high stereoselectivity, the enzyme activity can reach more than two times that of the wild type enzyme, the catalytic efficiency on a substrate precursor ketone is remarkably improved, the yield of a statin drug intermediate and chiral alcohol synthesized by an enzyme method of the carbonyl reductase mutant is remarkably improved, and the yield of a rosuvastatin intermediate (3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R) is remarkably improved. The highest yields of the (3R, 5R)-6-chloro-3, 5-dihydroxyhexanoic acid tert-butyl ester and the atorvastatin intermediate (3R, 5R)-6-cyano-3, 5-dihydroxyhexanoic acid tert-butyl ester reach 99% and 97.6% respectively, e.e. Is larger than 99%, and the method has high industrial application value.