20303 results about "Amino acid" patented technology

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

The invention relates to the field of biological medicine, in particular to a stapled peptide targeting RAS-Raf protein interaction and application of the stapled peptide, the stapled peptide is obtained in the mode that Ac-SLHDCLMKALKVR-NH2 and Ac-SLHDCLMKALKVRGL-NH2 serve as peptide chain templates, amino acid at the i site and amino acid at the (i + 4) site are replaced with S5 and cyclized, and the nitrogen terminal is further modified with stearic acid. The stapled peptide can effectively inhibit proliferation and migration of tumor cells; the serum stability is high, and meanwhile, the cell transmembrane capability is excellent, so that target protein in cells can be better targeted, and the biological function of the target protein can be exerted. Therefore, the alphaH helical conformation of the RBD of the RAF can be stabilized through the stapled peptide and a nitrogen-terminal fatty acid modification strategy, the membrane permeability and stability of the RAF are improved, the binding force of the RAF and RAS is further improved, and proliferation and migration of various tumor cells are inhibited.

The invention relates to the field of biotechnology and medicine, and more particularly to a polypeptide having the amino acid sequence SEQ ID NO: 1 and being capable of inhibiting RAS-GTPase activity, to the use of said polypeptide to produce a drug for treating stomach cancer or rectal cancer in a dose of 0.81-3.00 mg / kg, as well as to a drug based on said polypeptide for the treatment of stomach cancer or rectal cancer, and to a method for treating stomach cancer or rectal cancer by intraperitoneally administering said drug to a subject in an amount of 150 ml twice at an interval of 7 days.

The invention belongs to the technical field of cosmetics, and discloses anti-aging recombinant collagen as well as a preparation method and application thereof. The amino acid sequence of the anti-aging recombinant collagen is as shown in SEQ ID NO.1, and the nucleotide sequence of the anti-aging recombinant collagen is as shown in SEQ ID NO.2. The recombinant collagen CaI1 is constructed and expressed by recombining the effective sequences of the I-type collagen, the III-type collagen and the XVII-type collagen, and the recombinant collagen CaI1 is free of cytotoxicity, free of hidden danger of endotoxin and good in safety. The skin care product added with the recombinant collagen CaI1 can promote skin collagen absorption, inhibit skin aging and improve skin elasticity, and has a good application prospect.

The invention discloses a bovine serum albumin combined nano antibody and a preparation method and application thereof, the amino acid sequence of the bovine serum albumin combined nano antibody Nb1 is shown as SEQ.ID No.1, the nano antibody Nb not only has high affinity to bovine serum albumin, but also has good binding activity to both human serum albumin and mouse serum albumin, and the nano antibody Nb has high affinity to human serum albumin and mouse serum albumin. And the antibody has a relatively good broad-spectrum application range, and can be widely applied to the aspects of drug half-life period enhancement, tumor targeted therapy and imaging, immunodetection or diagnosis, recombinant albumin purification or enrichment and the like.

The invention belongs to the technical field of biology, and relates to an escherichia coli engineering strain for producing L-isoleucine through a methyl malic acid way as well as a construction method and application of the escherichia coli engineering strain. According to the invention, Escherichia coli BW25113 is used as a chassis strain, and a methyl malic acid synthase high-activity mutant gene cimA3.7, an isopropyl malic acid isomerase gene GsleuCD, a 3-isopropyl malic acid dehydrogenase gene AfleuB and a leucine dehydrogenase gene Lsleudh are over-expressed; a methyl malic acid absorption protein gene is over-expressed, and a branched chain amino acid transport system is modified to improve the exosome of the L-isoleucine; all methyl malic acid pathway related genes are integrated to a genome of a chassis strain, and a plasmid-free L-isoleucine production strain is constructed; the copy number of a key gene on a genome is optimized, and the yield of the engineering strain L-isoleucine is increased by introducing a non-oxidative glycolysis approach. The yield of the L-isoleucine after the engineering strain is fermented for 34 hours in a fermentation tank is 56.6 g / L.

The invention relates to the technical field of biology, in particular to a verticillium dahliae virulence gene, a verticillium dahliae virulence protein and application. The invention discloses a verticillium dahliae virulence gene VdPHO23like. The verticillium dahliae virulence gene VdPHO23like comprises a polynucleotide sequence for coding an amino acid sequence of SEQ ID NO: 3. According to the invention, expression of the gene is inhibited in a targeted manner through an RNA interference mediated gene silencing technology so as to weaken virulence of pathogenic bacteria, and an efficient, specific and environment-friendly comprehensive prevention and control strategy is provided for verticillium wilt of crops such as cotton.

The invention discloses a xanthine oxidase inhibitory peptide with a kidney improving function and application thereof, and belongs to the technical field of biological medicines.The xanthine oxidase inhibitory peptide is screened out by conducting enzymolysis, separation and purification on litopenaeus vannamei processing by-products and utilizing a molecular docking technology, the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Leu-Gly-Pro-Pro-Pro, and the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Leu-Gly-Pro-Pro-Pro. And the half inhibition concentration of the polypeptide is 2.356 + / -0.2448 mM. The xanthine oxidase inhibitory peptide is proved to have an improvement effect on hyperuricemia mice, the improvement effect is mainly characterized by reducing the content of serum uric acid, creatinine and urea nitrogen of the hyperuricemia mice, inhibiting the activity of xanthine oxidase (XOD) in serum and livers of the mice, inhibiting synthesis of uric acid and improving kidney injury of the mice, and Toxinpred prediction shows that the xanthine oxidase inhibitory peptide has the effect of inhibiting the activity of xanthine oxidase (XOD) in the serum and livers of the mice. The xanthine oxidase inhibitory peptide is free of toxic and side effects, so that the xanthine oxidase inhibitory peptide has a wide application prospect in preparation of food or drugs for improving renal functions.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention provides a carbonyl reductase mutant. The carbonyl reductase mutant is obtained by performing single-point mutation or multi-point combined mutation on the 17th site, the 40th site and the 64th site of an amino acid sequence as shown in SEQ ID NO.1. The invention also provides a coding gene, a recombinant vector containing the coding gene, a co-expression engineering bacterium and an application of the co-expression engineering bacterium. Compared with a wild type enzyme, the carbonyl reductase mutant has high activity and high stereoselectivity, the enzyme activity can reach more than two times that of the wild type enzyme, the catalytic efficiency on a substrate precursor ketone is remarkably improved, the yield of a statin drug intermediate and chiral alcohol synthesized by an enzyme method of the carbonyl reductase mutant is remarkably improved, and the yield of a rosuvastatin intermediate (3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R) is remarkably improved. The highest yields of the (3R, 5R)-6-chloro-3, 5-dihydroxyhexanoic acid tert-butyl ester and the atorvastatin intermediate (3R, 5R)-6-cyano-3, 5-dihydroxyhexanoic acid tert-butyl ester reach 99% and 97.6% respectively, e.e. Is larger than 99%, and the method has high industrial application value.

The invention discloses recombinant human XVII type collagen as well as a preparation method and application thereof. The recombinant human XVII type collagen is obtained by repeating an amino acid sequence from natural human XVII type collagen. The amino acid sequence of the recombinant human XVII type collagen is derived from natural human XVII type collagen, and the recombinant human XVII type collagen does not generate adverse immune response when being used for a human body. The recombinant human XVII type collagen can be secreted and expressed in a commercial yeast expression system, the expression quantity is greater than 10g / L, the preparation method is simple, and the high-yield recombinant human XVII type collagen can be obtained at low cost; in addition, the cell adhesion promoting activity of the recombinant human XVII type collagen is obviously superior to that of human collagen.

The invention discloses a xanthine oxidase inhibitory peptide with uric acid reducing activity and application thereof, and belongs to the technical field of biological medicines.The xanthine oxidase inhibitory peptide is obtained by conducting enzymolysis, separation and purification on processing byproducts such as litopenaeus vannamei heads and shells with xanthine oxidase inhibitory activity. The xanthine oxidase inhibitory peptide is screened by using a molecular docking technology, and the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Pro-Val-Pro-Pro-Pro. The xanthine oxidase inhibitory peptide has an XOD (X-Oxidase) half inhibitory concentration of 3.181 + / -0.1786 mM. The invention further proves that the xanthine oxidase inhibitory peptide has a certain improvement effect on hyperuricemia mice, and the xanthine oxidase inhibitory peptide mainly has the effects of reducing the content of serum uric acid, creatinine and urea nitrogen of the hyperuricemia mice, inhibiting the activity of xanthine oxidase (XOD) in serum and liver of the mice, inhibiting synthesis of uric acid and improving kidney injury of the mice, and the xanthine oxidase inhibitory peptide has a certain improvement effect on the hyperuricemia mice through Toxinpred prediction. The xanthine oxidase inhibitory peptide uric acid reducing peptide is free of toxic and side effects and has a wide market application prospect.

The invention provides humanized recombinant XVII collagen for promoting hair follicle stem cell repair and resisting aging as well as a preparation method and application thereof, and belongs to the technical field of biological medicines. The humanized recombinant XVII type collagen comprises polypeptide derived from the XVII type collagen or repeated protein formed by N times of repeated series connection of the polypeptide serving as a unit, n is an integer from 2 to 4; the polypeptide derived from the XVII type collagen comprises a polypeptide A and / or a polypeptide B; the amino acid sequence of the A polypeptide is as shown in SEQ ID NO: 1; and the amino acid sequence of the B polypeptide is as shown in SEQ ID NO: 2. The humanized recombinant XVII type collagen not only can be massively and stably recombined and expressed, but also has cell adhesion activity, cell proliferation promotion activity, cell migration promotion activity and excellent hair follicle repair and regeneration promotion activity, and has no sensitization side effect. The invention provides a new way for preparing collagen products with rich functions.

The invention provides a method and a system for screening and constructing a small molecule polypeptide simulant based on interaction between proteins, relates to the technical field of biology, and comprises the following steps: predicting an interaction model of RECK protein and ADAM10 protein through a molecular docking platform, and analyzing interaction sites of the RECK protein and the ADAM10 protein. And then, determining a KAZAL region of the RECK protein according to the interaction site, and predicting a sequence structure of the KAZAL region. And then carrying out molecular docking on the KAZAL region and ADAM10 protein, designing a plurality of peptide fragments with the length of 30 amino acids, and screening the peptide fragment sequence with the highest score as candidate polypeptide. And finally, performing species homology comparison and quality control detection on the candidate polypeptide, and verifying the binding capacity and biological function of the candidate polypeptide to ADAM10 protein through cell experiments. The invention provides a method for screening to obtain a polypeptide simulant specifically bound with ADAM10 protein. The polypeptide simulant can be used for treating ADAM10 related diseases.

The invention relates to the technical field of hippocampus extract, in particular to a hippocampus-sourced neuroprotection and anti-oxidative stress polypeptide and a preparation method thereof.The amino acid sequence of the polypeptide is shown as SEQ ID No.1. The preparation method comprises the following steps that 1, 500 g of fresh hippocampus is weighed, surface silt is removed, freeze-drying is conducted at the temperature of-60 DEG C, then the hippocampus is smashed through a smashing machine and sieved through a 20-mesh sieve, and the hippocampus extract is obtained; dialyzing with distilled water for 24 hours, and freeze-drying to obtain hippocampus powder; (2) weighing 200g of hippocampus powder, adding 1000ml of 95% ethanol, extracting for three times, removing fat-soluble substances, and extracting and freeze-drying precipitates by using a 1 mol / L NaCl solution under the condition of 4 DEG C in combination with ultrasonic assistance to obtain crude hippocampus protein; (3) the hippocampus crude protein is taken, the hippocampus polypeptide is prepared through an ultrasonic-assisted bionic digestion method, and the hippocampus polypeptide has the advantages of being specific in molecular structure, clear in action mechanism, stable in gastrointestinal tracts, capable of protecting nerves, resistant to oxidative stress and the like.

The invention relates to a recombinant A type humanized XVII type collagen as well as construction and application thereof, the protein is the humanized XVII type collagen which is composed of an intracellular region, a transmembrane region and an extracellular region, and the amino acid sequence is as shown in SEQ No. 1. The hair follicle repairing agent has the advantages of hair follicle repairing, hair regeneration, good biological activities of cell proliferation, cell adhesion and the like, and can be widely applied to the fields of medicines, medical instruments, biological materials, tissue engineering, cosmetics and the like. The gene sequence of the recombinant A type XVII collagen is 100% identical to the corresponding part of the gene sequence of the recombinant A type XVII collagen, so that the recombinant A type XVII collagen has good hydrophilicity and high activity, and has application potential in the fields of biomedical materials, beauty cosmetics, skin care products and the like.

The invention relates to the field of rice gene engineering, and particularly provides OsSULTR2; the invention also discloses application of the 2 protein and the coding gene thereof in regulating and controlling the salt tolerance of rice. The protein meets the following conditions: B1) a protein with an amino acid sequence of SEQ ID NO.1; and B2) a fusion protein with the same function obtained by connecting a tag to the N end and / or C end of B1). The method is used for detecting OsSULTR2; the salt stress phenotype identification in the seedling stage is carried out on the transgenic rice with the gene knockout 1, 2, and the result shows that when the gene segment is deleted, the salt stress tolerance of the rice is improved, and the function and the application way of the gene are proved. Therefore, the OsSULTR2 of the present invention; the 2 protein and the coding gene thereof can regulate and control the salt tolerance of rice, and have important significance for cultivating salt-tolerant transgenic rice.

The invention discloses an AsSN1 gene and application, and relates to the technical field of biology. The nucleotide sequence of the AsSN1 gene is as shown in SEQ ID NO.1, and the amino acid sequence of the AsSN1 protein is as shown in SEQ ID NO.2. The AsSN1 gene and the protein provided by the invention can regulate and control the spikelet number of the oats, further regulate and control the yield of the oats, provide important support for oat breeding and germplasm resource improvement, and have important significance for meeting the development requirements of animal husbandry.

The invention discloses preparation of a targeting LYPD3 antibody and application of the targeting LYPD3 antibody in tumor immunotherapy. The antibody or antigen binding fragment thereof comprises a heavy chain variable region having CDR-H1, CDR-H2 and CDR-H3 and a light chain variable region having CDR-L1, CDR-L2 and CDR-L3 wherein CDR-H1, CDR-H2 and CDR-H3 comprise the amino acid sequences of SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, respectively, and CDR-L1, CDR-L2 and CDR-L3 comprise the amino acid sequences of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, respectively.

The invention discloses polyketide synthase or a polyketide synthase mutant and application thereof, and belongs to the technical field of gene engineering. The polyketide synthase is AspiPKS4, AspiPKS5, AspiPKS6 and AspiPKS7 from cyathea spinulosa, FhPKS2, FhPKS3, FhPKS4, FhPKS5 and FhPKS6 from ficus himalayana, and CrPKS from floating fern. The mutant is obtained by carrying out single point mutation on the second amino acid of AspiPKS7 or deleting an N-terminal redundant sequence. The polyketide synthase or the mutant is used for replacing NnHisspS in an original FBP luminescence system, and the biological self-luminescence level can be remarkably improved. The invention further provides a simplified and improved FBP system which comprises the polyketide synthase or the polyketide synthase mutant, CPH, H3H and Luz, and the application convenience and the application luminescence capacity of the FBP system are improved.

The invention discloses a glycosyl transferase UGT76G1 mutant and a method for catalytically synthesizing rebaudioside M by using the glycosyl transferase UGT76G1 mutant, and relates to the technical field of biological catalytic synthesis. The glycosyl transferase UGT76G1 mutant is any one of the following components (A)-(C): (A) a protein obtained by performing any one or more of the following mutations on the basis of an amino acid sequence as shown in SEQ ID NO.1: the 89th amino acid is mutated into H from M; the 380th amino acid is mutated from L to M; the 411th amino acid is mutated from A to Y; (B) a protein which has 95% or 98% or more of identity with the amino acid sequence defined by (A) and has the same function as the amino acid sequence defined by (A); and (C) a fusion protein obtained by connecting a tag to the terminal of the protein defined in (A) or (B). The glycosyl transferase UGT76G1 mutant disclosed by the invention is obtained by mutating and screening glycosyl transferase UGT76G1, has higher catalytic activity, and can be used for efficiently synthesizing rebaudioside M by taking rebaudioside D and UDPG as substrates.

The invention relates to the field of gene engineering, and discloses a D-3-phosphoglycerate dehydrogenase mutant, a coding gene thereof and application of the D-3-phosphoglycerate dehydrogenase mutant and the coding gene. Compared with a protein with an amino acid sequence as shown in SEQ ID NO: 1, the mutant comprises mutation at the 131 site and / or the 285 site. The mutant can specifically catalyze a substrate 3-phosphoglycerate to synthesize 3-phosphate-hydroxypyruvic acid, can effectively promote synthesis of L-serine in a metabolic pathway of microorganisms, improves the yield and conversion rate of the L-serine, and reduces the yield of byproducts at the same time.

A method of predicting protein functions and interactions, including identifying a first protein and a second protein for analysis, generating a first embedded representation of a first amino acid sequence of the first protein and a second embedded representation of a second amino acid sequence of the second protein, generating a first contact map prediction for the first protein based on the first amino acid sequence and a second contact map prediction for the second protein based on the second amino acid sequence, generating first physiochemical features associated with the first protein, and second physiochemical features associated with the second protein, and generating a prediction score for a protein function or interaction between the first protein and the second protein based on the first embedded representation, the second embedded representation, the first contact map prediction, the second contact map prediction, the first physiochemical features and the second physiochemical features.

The present invention discloses a Gs12-7 endonuclease variant and a gene editing system mediated thereby. Specifically, by means of a rational mutation strategy, two Gs12-7 mutants were constructed and compared, and it was found that after the 157th amino acid of the Gs12-7 endonuclease was mutated from Glu to Arg, the activity of this gene editing enzyme could be significantly improved, and this variant was designated as Gs12-7MAX. The present invention provides an efficient gene editing technology mediated by the CRISPR-Gs12-7MAX system, which has broad application prospects in the field of genome site-directed modification.

The invention discloses a BamA-targeting antibacterial peptide as well as a preparation method and application thereof, and is characterized in that amino acids in a sequence are all D-type amino acids, and the amino acid sequence is as follows: w-r-r-w-r-r-p-w-k-r (dTrp-dArg-dArg-dTrp-dArg-dArg-dPro-dTrp-dLys-dArg). The antibacterial peptide provided by the invention has good antibacterial activity, can be synthesized by adopting an Fmoc solid-phase chemical method, is low in preparation difficulty, and has high affinity with target protein BamA.

The invention provides an artificial nucleic acid molecule which is used for improving the expression quantity of target amino acid, polypeptide or protein. The artificial nucleic acid molecule at least comprises a target 5'untranslated region (UTR), a target coding region (CDS) and a target 3 'untranslated region (UTR). Wherein the sequence of the target 5 'UTR is one of the following sequences: 5' UTR of a high-expression gene and a 5 'UTR variant of the high-expression gene. The sequence of the target 3 'UTR is one of the following sequences: 3' UTR of a high-expression gene and a 3 'UTR variant of the high-expression gene. Optionally, the artificial nucleic acid molecule may further comprise, for example, a 5 '-end cap structure (Cap), a PolyA tail. The 5 'UTR and the 3' UTR have regulating effects on translation and stability of nucleic acid molecules, so that the 5 'UTR, the 3' UTR and variants thereof are selected from high-expression genes, the nucleic acid molecules can be further stabilized and are not easy to degrade, and the amount of protein or polypeptide obtained by translation of the nucleic acid molecules can be increased. The invention also provides methods for making, delivering, and using such artificial nucleic acid molecules, as well as the use of the artificial nucleic acid molecules for the treatment and / or prevention of related diseases or disorders.

Provided are an environmentally-friendly biological liquid fertilizer and a preparation method therefor. The environmentally-friendly biological liquid fertilizer comprises the following components in parts by weight: 95-105 parts of a microcapsule microbial inoculant liquid fertilizer, 10-15 parts of an amino acid fertilizer, 8-12 parts of glucose, 7-10 parts of potassium humate, and 400-500 parts of water, wherein the microcapsule microbial inoculant liquid fertilizer is a suspension formed by a microbial inoculant microcapsule in an inorganic fertilizer solution, and the microbial inoculant microcapsule is a hydrophobic microcapsule prepared by coating a microbial inoculant with sodium lignin sulfonate-corn starch. By means of preparing the hydrophobic microcapsule, the technical effect of coating a microbial inoculant to avoid an environmental impact is achieved, a variety of microbial inoculants are separately encapsulated and are dispersed in the inorganic fertilizer solution, and an organic fertilizer and a carbon source are supplemented to prepare the composite biological liquid fertilizer, thereby achieving the technical effects of easy absorption of the fertilizer, prevention against microbial antagonism, an increased survival rate and water-fertilizer integration.

A direct air capture (DAC) of CO2 system includes a reaction reactor having a solid, amine-functionalized sorbent configured to sequester CO2 from air; an in-situ dual-function device configured as a CO2 conversion reactor and an exchange fluid regeneration device; and the exchange fluid, recirculating between the reaction reactor and the dual-function device, configured to capture the sequestered CO2 from the solid sorbent in the reaction reactor and release the captured CO2 in the conversion reactor, the exchange fluid including one or more amino acids.

The invention relates to the technical field of biology, in particular to multifunctional belly-expanding hippocampal peptide as well as a preparation method and application thereof. Comprising a polypeptide with an amino acid sequence as shown in SEQ ID NO.1. The hippocampus antioxidative peptide is prepared by adopting an ultrahigh pressure pretreatment and enzymolysis technology, the adopted extraction process is simple in route, and the time and the production cost are effectively saved; an animal model is utilized to prove the anti-oxidation effect and the effect of improving male reproductive disorder and testis injury of the multifunctional belly-expanding hippocampal peptide; and on the basis, a novel peptide fragment with high activity, no toxicity and no sensitization is obtained.

The invention provides an antibacterial peptide cAMP048 sourced from microorganisms in a deep sea environment and application of the antibacterial peptide cAMP048, and belongs to the technical field of peptide inhibitors. The antibacterial peptide cAMP048 has an amino acid sequence as shown in SEQ ID NO: 1 (Sequence Identity Number 1). The antibacterial peptide can inhibit the growth of acinetobacter baumannii at 64 mu M, inhibit the growth of multi-drug-resistant acinetobacter baumannii and multi-drug-resistant enterococcus faecium at 128 mu M and inhibit the growth of escherichia coli, staphylococcus aureus and multi-drug-resistant klebsiella pneumoniae at 256 mu M. The antibacterial peptide can be used for preparing products with antibacterial and / or bactericidal performance, and can be applied to preparation of antibacterial and / or bactericidal products. Such as food, skin care products or medical supplies.