14394 results about "Acid amino sequences" patented technology

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

The invention relates to the field of biotechnology and medicine, and more particularly to a polypeptide having the amino acid sequence SEQ ID NO: 1 and being capable of inhibiting RAS-GTPase activity, to the use of said polypeptide to produce a drug for treating stomach cancer or rectal cancer in a dose of 0.81-3.00 mg / kg, as well as to a drug based on said polypeptide for the treatment of stomach cancer or rectal cancer, and to a method for treating stomach cancer or rectal cancer by intraperitoneally administering said drug to a subject in an amount of 150 ml twice at an interval of 7 days.

The invention belongs to the technical field of cosmetics, and discloses anti-aging recombinant collagen as well as a preparation method and application thereof. The amino acid sequence of the anti-aging recombinant collagen is as shown in SEQ ID NO.1, and the nucleotide sequence of the anti-aging recombinant collagen is as shown in SEQ ID NO.2. The recombinant collagen CaI1 is constructed and expressed by recombining the effective sequences of the I-type collagen, the III-type collagen and the XVII-type collagen, and the recombinant collagen CaI1 is free of cytotoxicity, free of hidden danger of endotoxin and good in safety. The skin care product added with the recombinant collagen CaI1 can promote skin collagen absorption, inhibit skin aging and improve skin elasticity, and has a good application prospect.

The invention discloses a bovine serum albumin combined nano antibody and a preparation method and application thereof, the amino acid sequence of the bovine serum albumin combined nano antibody Nb1 is shown as SEQ.ID No.1, the nano antibody Nb not only has high affinity to bovine serum albumin, but also has good binding activity to both human serum albumin and mouse serum albumin, and the nano antibody Nb has high affinity to human serum albumin and mouse serum albumin. And the antibody has a relatively good broad-spectrum application range, and can be widely applied to the aspects of drug half-life period enhancement, tumor targeted therapy and imaging, immunodetection or diagnosis, recombinant albumin purification or enrichment and the like.

The invention relates to the technical field of biology, in particular to a verticillium dahliae virulence gene, a verticillium dahliae virulence protein and application. The invention discloses a verticillium dahliae virulence gene VdPHO23like. The verticillium dahliae virulence gene VdPHO23like comprises a polynucleotide sequence for coding an amino acid sequence of SEQ ID NO: 3. According to the invention, expression of the gene is inhibited in a targeted manner through an RNA interference mediated gene silencing technology so as to weaken virulence of pathogenic bacteria, and an efficient, specific and environment-friendly comprehensive prevention and control strategy is provided for verticillium wilt of crops such as cotton.

The invention discloses a xanthine oxidase inhibitory peptide with a kidney improving function and application thereof, and belongs to the technical field of biological medicines.The xanthine oxidase inhibitory peptide is screened out by conducting enzymolysis, separation and purification on litopenaeus vannamei processing by-products and utilizing a molecular docking technology, the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Leu-Gly-Pro-Pro-Pro, and the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Leu-Gly-Pro-Pro-Pro. And the half inhibition concentration of the polypeptide is 2.356 + / -0.2448 mM. The xanthine oxidase inhibitory peptide is proved to have an improvement effect on hyperuricemia mice, the improvement effect is mainly characterized by reducing the content of serum uric acid, creatinine and urea nitrogen of the hyperuricemia mice, inhibiting the activity of xanthine oxidase (XOD) in serum and livers of the mice, inhibiting synthesis of uric acid and improving kidney injury of the mice, and Toxinpred prediction shows that the xanthine oxidase inhibitory peptide has the effect of inhibiting the activity of xanthine oxidase (XOD) in the serum and livers of the mice. The xanthine oxidase inhibitory peptide is free of toxic and side effects, so that the xanthine oxidase inhibitory peptide has a wide application prospect in preparation of food or drugs for improving renal functions.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention provides a carbonyl reductase mutant. The carbonyl reductase mutant is obtained by performing single-point mutation or multi-point combined mutation on the 17th site, the 40th site and the 64th site of an amino acid sequence as shown in SEQ ID NO.1. The invention also provides a coding gene, a recombinant vector containing the coding gene, a co-expression engineering bacterium and an application of the co-expression engineering bacterium. Compared with a wild type enzyme, the carbonyl reductase mutant has high activity and high stereoselectivity, the enzyme activity can reach more than two times that of the wild type enzyme, the catalytic efficiency on a substrate precursor ketone is remarkably improved, the yield of a statin drug intermediate and chiral alcohol synthesized by an enzyme method of the carbonyl reductase mutant is remarkably improved, and the yield of a rosuvastatin intermediate (3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R) is remarkably improved. The highest yields of the (3R, 5R)-6-chloro-3, 5-dihydroxyhexanoic acid tert-butyl ester and the atorvastatin intermediate (3R, 5R)-6-cyano-3, 5-dihydroxyhexanoic acid tert-butyl ester reach 99% and 97.6% respectively, e.e. Is larger than 99%, and the method has high industrial application value.

The invention discloses a xanthine oxidase inhibitory peptide with uric acid reducing activity and application thereof, and belongs to the technical field of biological medicines.The xanthine oxidase inhibitory peptide is obtained by conducting enzymolysis, separation and purification on processing byproducts such as litopenaeus vannamei heads and shells with xanthine oxidase inhibitory activity. The xanthine oxidase inhibitory peptide is screened by using a molecular docking technology, and the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Pro-Val-Pro-Pro-Pro. The xanthine oxidase inhibitory peptide has an XOD (X-Oxidase) half inhibitory concentration of 3.181 + / -0.1786 mM. The invention further proves that the xanthine oxidase inhibitory peptide has a certain improvement effect on hyperuricemia mice, and the xanthine oxidase inhibitory peptide mainly has the effects of reducing the content of serum uric acid, creatinine and urea nitrogen of the hyperuricemia mice, inhibiting the activity of xanthine oxidase (XOD) in serum and liver of the mice, inhibiting synthesis of uric acid and improving kidney injury of the mice, and the xanthine oxidase inhibitory peptide has a certain improvement effect on the hyperuricemia mice through Toxinpred prediction. The xanthine oxidase inhibitory peptide uric acid reducing peptide is free of toxic and side effects and has a wide market application prospect.

The invention provides humanized recombinant XVII collagen for promoting hair follicle stem cell repair and resisting aging as well as a preparation method and application thereof, and belongs to the technical field of biological medicines. The humanized recombinant XVII type collagen comprises polypeptide derived from the XVII type collagen or repeated protein formed by N times of repeated series connection of the polypeptide serving as a unit, n is an integer from 2 to 4; the polypeptide derived from the XVII type collagen comprises a polypeptide A and / or a polypeptide B; the amino acid sequence of the A polypeptide is as shown in SEQ ID NO: 1; and the amino acid sequence of the B polypeptide is as shown in SEQ ID NO: 2. The humanized recombinant XVII type collagen not only can be massively and stably recombined and expressed, but also has cell adhesion activity, cell proliferation promotion activity, cell migration promotion activity and excellent hair follicle repair and regeneration promotion activity, and has no sensitization side effect. The invention provides a new way for preparing collagen products with rich functions.

The invention relates to a recombinant A type humanized XVII type collagen as well as construction and application thereof, the protein is the humanized XVII type collagen which is composed of an intracellular region, a transmembrane region and an extracellular region, and the amino acid sequence is as shown in SEQ No. 1. The hair follicle repairing agent has the advantages of hair follicle repairing, hair regeneration, good biological activities of cell proliferation, cell adhesion and the like, and can be widely applied to the fields of medicines, medical instruments, biological materials, tissue engineering, cosmetics and the like. The gene sequence of the recombinant A type XVII collagen is 100% identical to the corresponding part of the gene sequence of the recombinant A type XVII collagen, so that the recombinant A type XVII collagen has good hydrophilicity and high activity, and has application potential in the fields of biomedical materials, beauty cosmetics, skin care products and the like.

The invention discloses an AsSN1 gene and application, and relates to the technical field of biology. The nucleotide sequence of the AsSN1 gene is as shown in SEQ ID NO.1, and the amino acid sequence of the AsSN1 protein is as shown in SEQ ID NO.2. The AsSN1 gene and the protein provided by the invention can regulate and control the spikelet number of the oats, further regulate and control the yield of the oats, provide important support for oat breeding and germplasm resource improvement, and have important significance for meeting the development requirements of animal husbandry.

The invention discloses preparation of a targeting LYPD3 antibody and application of the targeting LYPD3 antibody in tumor immunotherapy. The antibody or antigen binding fragment thereof comprises a heavy chain variable region having CDR-H1, CDR-H2 and CDR-H3 and a light chain variable region having CDR-L1, CDR-L2 and CDR-L3 wherein CDR-H1, CDR-H2 and CDR-H3 comprise the amino acid sequences of SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, respectively, and CDR-L1, CDR-L2 and CDR-L3 comprise the amino acid sequences of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, respectively.

The invention discloses a glycosyl transferase UGT76G1 mutant and a method for catalytically synthesizing rebaudioside M by using the glycosyl transferase UGT76G1 mutant, and relates to the technical field of biological catalytic synthesis. The glycosyl transferase UGT76G1 mutant is any one of the following components (A)-(C): (A) a protein obtained by performing any one or more of the following mutations on the basis of an amino acid sequence as shown in SEQ ID NO.1: the 89th amino acid is mutated into H from M; the 380th amino acid is mutated from L to M; the 411th amino acid is mutated from A to Y; (B) a protein which has 95% or 98% or more of identity with the amino acid sequence defined by (A) and has the same function as the amino acid sequence defined by (A); and (C) a fusion protein obtained by connecting a tag to the terminal of the protein defined in (A) or (B). The glycosyl transferase UGT76G1 mutant disclosed by the invention is obtained by mutating and screening glycosyl transferase UGT76G1, has higher catalytic activity, and can be used for efficiently synthesizing rebaudioside M by taking rebaudioside D and UDPG as substrates.

The invention relates to the field of gene engineering, and discloses a D-3-phosphoglycerate dehydrogenase mutant, a coding gene thereof and application of the D-3-phosphoglycerate dehydrogenase mutant and the coding gene. Compared with a protein with an amino acid sequence as shown in SEQ ID NO: 1, the mutant comprises mutation at the 131 site and / or the 285 site. The mutant can specifically catalyze a substrate 3-phosphoglycerate to synthesize 3-phosphate-hydroxypyruvic acid, can effectively promote synthesis of L-serine in a metabolic pathway of microorganisms, improves the yield and conversion rate of the L-serine, and reduces the yield of byproducts at the same time.

A method of predicting protein functions and interactions, including identifying a first protein and a second protein for analysis, generating a first embedded representation of a first amino acid sequence of the first protein and a second embedded representation of a second amino acid sequence of the second protein, generating a first contact map prediction for the first protein based on the first amino acid sequence and a second contact map prediction for the second protein based on the second amino acid sequence, generating first physiochemical features associated with the first protein, and second physiochemical features associated with the second protein, and generating a prediction score for a protein function or interaction between the first protein and the second protein based on the first embedded representation, the second embedded representation, the first contact map prediction, the second contact map prediction, the first physiochemical features and the second physiochemical features.

The invention discloses a formate dehydrogenase mutant and application thereof in catalytic synthesis of D-mannitol, and belongs to the technical field of bioengineering. According to the formate dehydrogenase mutant provided by the invention, the 18th-site glutamic acid of wild-type formate dehydrogenase with an amino acid sequence shown as SEQ ID NO.2 is mutated into proline, the 57th-site asparagine is mutated into glutamic acid, the 70th-site histidine is mutated into tryptophan, the 235th-site serine is mutated into threonine, and the 316th-site valine is mutated into threonine, so that the formate dehydrogenase mutant is high in enzyme activity and catalytic activity; the coenzyme circulation efficiency during the production of D-mannitol can be obviously improved, so that the yield of D-mannitol can be effectively improved. When the genetically engineered bacterium co-expressed by the formate dehydrogenase mutant and the mannitol dehydrogenase mutant is used for catalyzing 150 g / L fructose to produce D-mannitol, the yield of D-mannitol within 15 h can reach 140 g / L or above.

The invention relates to the technical field of biology, in particular to multifunctional belly-expanding hippocampal peptide as well as a preparation method and application thereof. Comprising a polypeptide with an amino acid sequence as shown in SEQ ID NO.1. The hippocampus antioxidative peptide is prepared by adopting an ultrahigh pressure pretreatment and enzymolysis technology, the adopted extraction process is simple in route, and the time and the production cost are effectively saved; an animal model is utilized to prove the anti-oxidation effect and the effect of improving male reproductive disorder and testis injury of the multifunctional belly-expanding hippocampal peptide; and on the basis, a novel peptide fragment with high activity, no toxicity and no sensitization is obtained.

The invention provides an antibacterial peptide cAMP048 sourced from microorganisms in a deep sea environment and application of the antibacterial peptide cAMP048, and belongs to the technical field of peptide inhibitors. The antibacterial peptide cAMP048 has an amino acid sequence as shown in SEQ ID NO: 1 (Sequence Identity Number 1). The antibacterial peptide can inhibit the growth of acinetobacter baumannii at 64 mu M, inhibit the growth of multi-drug-resistant acinetobacter baumannii and multi-drug-resistant enterococcus faecium at 128 mu M and inhibit the growth of escherichia coli, staphylococcus aureus and multi-drug-resistant klebsiella pneumoniae at 256 mu M. The antibacterial peptide can be used for preparing products with antibacterial and / or bactericidal performance, and can be applied to preparation of antibacterial and / or bactericidal products. Such as food, skin care products or medical supplies.

The invention relates to the field of gene engineering for enhancing the cold resistance of plants, and relates to a recombinant expression vector, a recombinant strain and a primer pair of a pennisetum purpureum PpMYB2 gene, a method for improving the cold resistance of the plants and application of related materials in improving the cold resistance of the plants. One purpose of the invention is to provide application of the Pennisetum purpureum PpMYB2 gene and related materials thereof in improving the cold resistance of the plant, the amino acid sequence of the encoding protein of the Pennisetum purpureum PpMYB2 gene is as shown in SEQ ID NO.1, and the plant is arabidopsis thaliana or Pennisetum purpureum. Under the background that extreme low temperature events caused by global climate change are increasingly frequent, the cold resistance enhancing technology provided by the invention has important significance on guaranteeing the stability of agricultural production and reducing loss caused by low temperature. Through overexpression of the gene PpMYB2, the adaptability of perennial pennisetum purpureum to low-temperature stress can be remarkably improved, so that the planting range of perennial pennisetum purpureum is expanded to regions with lower temperature, and the survival and growth performance in different ecological environments is enhanced.

The embodiment of the invention provides a tyrosine ammonia lyase mutant and application thereof in synthesis of p-coumaric acid. The mutant is subjected to any one of the following amino acid mutations on an amino acid sequence as shown in SEQ ID NO. 2: F497I, F497I + L248M, F497I + L248M + M4T, and L248M + F497I + M4T + V482L. According to the embodiment of the invention, an amino acid sequence as shown in SEQ ID NO. 2 is taken as a template, a key active site of the template is subjected to mutation transformation, a mutant library is constructed, and a series of mutants with remarkably improved catalytic activity and / or conversion rate are screened; the tyrosine ammonia lyase mutant provided by the embodiment of the invention can selectively catalyze L-tyrosine to generate p-coumaric acid, and has excellent yield and / or higher yield.

The invention belongs to the technical field of protein engineering and biology, and discloses a recombinant III-type humanized collagen, a coding gene thereof, a protein preparation, a preparation method of the protein preparation, application of the protein preparation and a skin care product. The amino acid sequence of the recombinant III type humanized collagen is as shown in SEQ ID NO. 1. According to the recombinant III type humanized collagen, the transdermal absorption efficiency is greatly improved, and meanwhile, the proliferation and migration capabilities of keratinocytes are also remarkably improved. The collagen is widely applied to the fields of medical cosmetic plastic surgery, cosmetics and the like, and has a good application prospect.

The invention belongs to the technical field of genetic engineering, and particularly relates to an antibacterial peptide with antibacterial and antiviral effects and application and a product thereof. The amino acid sequence of the antibacterial peptide provided by the invention has the following general formula: X1GX2FX3FX4KKFX5LFX6X7SKVLK, x1 is M or has no amino acid; x2 is one of R, G and H; x3 is one of KS, KR, HR and HH; x4 is R or L; x5 is one of KK, HH and HK; x6 is RR or KK; and X7 is I or L. The antibacterial peptide disclosed by the invention has a relatively good antibacterial effect, and shows antiviral activity on HPV16 (Human Papilloma Virus 16) and HPV18 (Human Papilloma Virus 18). Good application prospects are shown in the preparation of antibacterial or antiviral products.

The invention provides a recombinant keratin polypeptide as well as a preparation method and application thereof, and relates to the technical field of genetic engineering. The amino acid sequence of the recombinant keratin polypeptide is as shown in any one of SEQ ID No. 1, SEQ ID No. 4, SEQ ID No. 7 and SEQ ID No. 10. The recombinant keratin polypeptide has a good soothing effect and the effects of stimulating skin angiogenesis and improving local blood circulation, and can be widely applied to the industries of medicines, cosmetics, skin care products and the like.

The invention discloses monoclonal antibodies NP5 and NP8 for resisting influenza A virus NP protein and application of the monoclonal antibodies NP5 and NP8, and belongs to the technical field of monoclonal antibodies. According to the invention, 19 influenza A virus NP protein monoclonal antibodies are prepared, and the monoclonal antibodies NP5 and NP8 are obtained by screening through ELISA (enzyme-linked immuno sorbent assay) detection and sequencing analysis. The NP5 comprises a light chain CDR2 of which the amino acid sequence is RTS, light chains CDR1 and CDR3 of which the amino acid sequences are shown as SEQ ID NO.3-4, and heavy chains CDR1-3 of which the amino acid sequences are shown as SEQ ID NO.7-9; the NP8 comprises a light chain CDR2 of which the amino acid sequence is LVS, light chains CDR1 and CDR3 of which the amino acid sequences are as shown in SEQ ID NO.12 to SEQ ID NO.13, and heavy chains CDR1-3 of which the amino acid sequences are as shown in SEQ ID NO.16 to SEQ ID NO.18. The invention lays a foundation for preparing an influenza A virus detection kit.

The invention provides a Ustilaginoidea virens gene UvASE2 for regulating and controlling rice resistance and application of the Ustilaginoidea virens gene UvASE2, and relates to the technical field of plant genetic engineering. The nucleotide sequence of the Ustilaginoidea virens gene UvASE2 is as shown in SEQ ID NO: 1, and the amino acid sequence of the encoding protein of the Ustilaginoidea virens gene UvASE2 is as shown in SEQ ID NO: 2. By constructing a transgenic rice plant for heterologous expression of UvASE2, it is found that the transgenic rice can significantly improve the resistance to false smut and bacterial blight and significantly induce the outbreak of active oxygen. The heterologous expression UvASE2 gene of Ustilaginoidea virens has the function of positively regulating and controlling the disease resistance of rice, and the UvASE2 gene can be used for improving the disease resistance of rice and has important significance on creation of disease-resistant germplasm of rice.

The invention relates to the technical field of biological medicines, and particularly discloses an anti-human CD3 rabbit recombinant monoclonal antibody as well as a preparation method and application thereof. The antibody obtains anti-CD3 immune response by immunizing a rabbit, is obtained by combining single B cell sorting, gene cloning and a mammalian cell expression system, and has high affinity and good specificity. The antibody can effectively recognize CD3 positive T cells in human peripheral blood and can be applied to the fields of flow cytometry, immunohistochemistry, T cell function research and the like. Experimental results show that the antibody has the advantages of high titer, strong fluorescence signal, low background and the like, and is superior to the traditional murine anti-CD3 antibody. Amino acid sequences of light chain and heavy chain variable regions of the antibody are further obtained, and controllability and repeatability of antibody expression are achieved. The antibody has important scientific research value and industrial application prospect, and is suitable for various scenes such as T cell marker detection, immune state evaluation, immunotherapy auxiliary research and the like.

Provided is the use of a protein derived from wheat and a biomaterial related thereto in increasing the yield per plant and grain protein content of a crop. The protein is designated as SWEET11, and may be a protein having an amino acid sequence as shown in sequence 9, sequence 6 or sequence 3 in the sequence listing. The wheat SWEET11 protein (TaSWEET11) is over-expressed in the Zhengmai 7698 wheat variety (nationally approved), and it is found that the over-expression of TaSWEET11 can significantly improve the thousand-grain weight of wheat grains and increase the yield. In addition, the over-expression of TaSWEET11 also increases the protein content in the wheat grain, significantly improving the grain quality while increasing the yield. The TaSWEET11 protein can be used for breeding and quality improvement of crops.

The invention belongs to the field of biological detection, and discloses a kit for detecting cervical cancer and application of the kit. The kit comprises an elisa plate coated with a captured antibody, an HRP labeled antibody, an antigen standard substance, a washing solution, a developing solution and a stop solution, the heavy chain amino acid sequence of the monoclonal antibody CPT1A-1 of the anti-CPT1A protein in the capture antibody is as shown in SEQ ID NO. 1, and the light chain amino acid sequence is as shown in SEQ ID NO. 2; the heavy chain amino acid sequence of the monoclonal antibody CPT1A-2 of the anti-CPT1A protein in the HRP labeled antibody is as shown in SEQ ID NO.3, and the light chain amino acid sequence of the monoclonal antibody CPT1A-2 of the anti-CPT1A protein in the HRP labeled antibody is as shown in SEQ ID NO.4. The kit for diagnosis of cervical cancer provided by the invention has strong specificity, can specifically detect the content of CPT1A protein in serum, has good stability, and has good application prospects.