18104 results about "Acid amino sequences" patented technology

The invention relates to the technical field of antibacterial peptides, and particularly discloses a marine antibacterial peptide and application thereof, and the amino acid sequence of the marine antibacterial peptide is as shown in SEQ ID NO.1: MWKLPKWRNGRRRGFKIPRW. The marine antibacterial peptide CD109 provided by the invention has an inhibition effect on staphylococcus aureus, acinetobacter baumannii, pseudomonas aeruginosa and klebsiella pneumoniae, and has extremely low cytotoxicity.

The present application relates to the field of biotechnology, and in particular to an epimerase for synthesizing D-tagatose and its application, wherein the epimerase produces a mutation at position 100, or at position 125, or at position 127, or at position 131, or at position 268, or at position 270, or at position 271, or at position 308, or at position 339, or at position 340, or at position 342, or at position 366, or at position 402, or at position 437, or at position 440 in the amino acid sequence shown in SEQ ID NO. 142; through the above-mentioned method, the epimerase exhibits excellent epimerization activity at the 4th carbon position of D-fructose, can efficiently convert D-fructose into D-tagatose, and is beneficial to improving the synthesis efficiency of D-tagatose.

The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).

The invention relates to the field of biotechnology and medicine, and more particularly to a polypeptide having the amino acid sequence SEQ ID NO: 1 and being capable of inhibiting RAS-GTPase activity, to the use of said polypeptide to produce a drug for treating stomach cancer or rectal cancer in a dose of 0.81-3.00 mg / kg, as well as to a drug based on said polypeptide for the treatment of stomach cancer or rectal cancer, and to a method for treating stomach cancer or rectal cancer by intraperitoneally administering said drug to a subject in an amount of 150 ml twice at an interval of 7 days.

The invention belongs to the technical field of gene engineering and enzyme engineering, and particularly relates to an ornithine decarboxylase mutant as well as a coding gene, an expression vector, a recombinant strain and application thereof. The ornithine decarboxylase mutant is obtained by mutating wild ornithine decarboxylase ODC10 of which the amino acid sequence is shown as SEQ ID NO.1, the catalytic activity of the obtained mutant is improved, and the biosynthesis efficiency of 1, 4-butanediamine is favorably improved. The recombinant strain for expressing the ornithine decarboxylase mutant constructed by the invention can efficiently synthesize 1, 4-butanediamine, and the molar conversion rate of ornithine is remarkably improved, so that the production benefit is improved, and the production cost is reduced.

To provide VHH-containing polypeptides that bind CD123, and a method for treating cancer that includes administration of the VHH-containing polypeptides.SOLUTION: Provided is a polypeptide comprising at least one VHH domain that binds to CD123, comprising CDR1, CDR2, and CDR3, each comprising a specific amino acid sequence.SELECTED DRAWING: Figure 3A

The invention relates to a nano antibody targeting cadherin 17 and application thereof, and relates to the technical field of immunology and molecular biology, the amino acid sequence of a complementary determining region of the nano antibody targeting cadherin 17 comprises CDR1 shown as any one of SEQ ID NO: 21-32, CDR2 shown as any one of SEQ ID NO: 34-45, and CDR3 shown as any one of SEQ ID NO: 47-58. According to the invention, an alpaca immune phage display library is constructed, a series of nano antibody molecules targeting cadherin 17 (CDH17) are screened from the alpaca immune phage display library, and functions and applications of the nano antibody are verified at various levels of CDH17 antigen protein, CDH17 target cells, CDH17 CAR-T cells and the like.

The invention discloses a glycosyl transferase mutant for synthesizing rebaudioside M and a synthesis method of rebaudioside M, and belongs to the technical field of gene engineering. The glycosyl transferase mutant for synthesizing the rebaudioside M is a glycosyl transferase UGT76G4 mutant and / or a glycosyl transferase UGT91C1 mutant, and the glycosyl transferase mutant is a glycosyl transferase UGT76G4 mutant. The glycosyl transferase UGT76G4 mutant is obtained by mutation of an amino acid sequence as shown in SEQ ID NO: 1: 85th amino acid is mutated into R from L, and 90th amino acid is mutated into G from I; the glycosyltransferase UGT91C1 mutant is obtained by mutating an amino acid sequence shown in SEQ ID NO: 3 as follows: the 204th amino acid is mutated into A from L, the 208th amino acid is mutated into A from F, and the 380th amino acid is mutated into D from G. The mutant can realize efficient catalytic synthesis of rebaudioside M, and the yield of rebaudioside M synthesized by an enzymic method is improved.

The invention belongs to the technical field of cosmetics, and discloses anti-aging recombinant collagen as well as a preparation method and application thereof. The amino acid sequence of the anti-aging recombinant collagen is as shown in SEQ ID NO.1, and the nucleotide sequence of the anti-aging recombinant collagen is as shown in SEQ ID NO.2. The recombinant collagen CaI1 is constructed and expressed by recombining the effective sequences of the I-type collagen, the III-type collagen and the XVII-type collagen, and the recombinant collagen CaI1 is free of cytotoxicity, free of hidden danger of endotoxin and good in safety. The skin care product added with the recombinant collagen CaI1 can promote skin collagen absorption, inhibit skin aging and improve skin elasticity, and has a good application prospect.

The invention relates to a high-activity recombinant XVII type collagen as well as a rapid preparation method and application thereof, and belongs to the technical field of bioengineering. The amino acid sequence of the high-activity recombinant XVII type collagen is as shown in SEQ ID NO. 1, and the nucleotide sequence of the high-activity recombinant XVII type collagen is as shown in SEQ ID NO. 2. The invention also provides a preparation method and application of the recombinant XVII type collagen. The high-activity recombinant XVII type collagen has good biological activity, has good effects of promoting cell adhesion, cell proliferation and cell migration, and can be compounded with other proteins to form raw materials of tissue engineering products, cosmetics, health care products or medicines. The high-activity recombinant XVII type collagen gene is integrated to different positions of a yeast genome through three different vectors, and the copy number of a target gene is increased, so that the expression quantity of the recombinant XVII type collagen is remarkably increased, and the yield of the high-activity recombinant XVII type collagen is effectively increased.

The invention belongs to the technical field of optimized coding genes, and discloses a recombinant human I-type collagen as well as a preparation method and application thereof, and the amino acid sequence of the recombinant human I-type collagen is shown as SEQ ID No.1. The recombinant I-type collagen provided by the invention is relatively high in expression quantity, has relatively good cell migration promoting, cell proliferation promoting and cell adhesion promoting properties, is high in safety, and can be widely applied to the fields of medicines, medical instruments, biological materials, tissue engineering, cosmetics and the like.

The invention discloses a bovine serum albumin combined nano antibody and a preparation method and application thereof, the amino acid sequence of the bovine serum albumin combined nano antibody Nb1 is shown as SEQ.ID No.1, the nano antibody Nb not only has high affinity to bovine serum albumin, but also has good binding activity to both human serum albumin and mouse serum albumin, and the nano antibody Nb has high affinity to human serum albumin and mouse serum albumin. And the antibody has a relatively good broad-spectrum application range, and can be widely applied to the aspects of drug half-life period enhancement, tumor targeted therapy and imaging, immunodetection or diagnosis, recombinant albumin purification or enrichment and the like.

The invention discloses a broad-spectrum antibacterial peptide SS-7 and application thereof, and belongs to the field of biological medicine. The amino acid sequence of the broad-spectrum antibacterial peptide SS-7 disclosed by the invention is VRRVRFVVLRRIKKWRRI, and the broad-spectrum antibacterial peptide SS-7 has a remarkable inhibition effect on various gram-positive bacteria and gram-negative bacteria such as drug-resistant strains such as methicillin-resistant staphylococcus aureus (ATCC43300) and shows low toxicity and no hemolytic toxicity on eukaryotic cells and red blood cells of mammals; lPS and lipoteichoic acid on the surfaces of bacteria can be combined to achieve the effect of neutralizing the bacteria, and a very good treatment and protection effect is achieved on animals infected by the bacteria. The antibacterial peptide SS-7 can be used for preparing an antibacterial agent and preparing a medicine for preventing or treating bacterial infection, has the advantages of being wide in antibacterial spectrum, low in drug-resistant mutation frequency, low in toxicity and low in production cost, can effectively solve the current bacterial drug resistance problem, and has wide application prospects and important clinical value.

The invention provides a recombinant humanized III-type collagen with a triple helix structure and preparation and application thereof, and belongs to the technical field of protein engineering, the amino acid sequence of the recombinant humanized III-type collagen comprises n core units, n is an integer of 1 or greater than 1, and the amino acid sequence of each core unit is as shown in SEQ ID NO: 1; the invention also provides a construction method of the expression system and a preparation method of the recombinant humanized III-type collagen. The invention also provides practical industrial application according to the characteristics of the protein. The recombinant humanized III-type collagen provided by the invention is high in purity, good in stability and high in biological activity, and experiments show that the recombinant humanized III-type collagen has various biological activities of promoting cell proliferation and migration and the like.

The invention provides recombinant human III-type collagen which is of a triple-helix structure and assembled into collagenous fibers and application of the recombinant human III-type collagen, and belongs to the technical field of bioengineering. Collagen fragments capable of forming a triple helix structure are screened out through a bioinformatics algorithm, the fragments are connected in series, a key C-terminal structural domain and a specific amino acid sequence are combined, and formation of a stable triple helix advanced structure and assembly of collagenous fibers are effectively promoted. The recombinant human III type collagen is efficiently expressed through a eukaryotic expression system, and shows excellent stability, low immunogenicity and good biocompatibility. Experimental results show that the prepared recombinant human III-type collagen not only has a natural triple helix structure, but also can be further assembled into macromolecular collagen fibers, is suitable for multiple fields such as medical beauty, bioengineering and tissue repair, and has wide application prospects and market values.

A method for predicting one or more features of an antigen-binding protein is provided, comprising: providing the amino acid sequence of at least part of one or more chains of the antigen-binding protein or an encoded sequence derived therefrom as input to a deep learning model comprising a sequence encoding module configured to take as input an amino acid sequence and to produce as output an embedding corresponding to the input sequence, and predicting the one or more features of the antigen-binding protein using the embedding produced by the sequence encoding module The sequence encoding module has been trained as part of a machine learning model comprising a structure encoding module, and using training sequence data and structure data from a plurality of antigen-binding proteins. Related methods, systems and products are also described.

Provided are a protein language model training method, a method for extracting an amino acid sequence representation by using a protein language model, a method for obtaining a new amino acid sequence by using a protein language model, a method for obtaining a related amino acid sequence by using a protein language model, a method for predicting an amino acid sequence perplexity by using a protein language model, an electronic device, a computer-readable medium, and a program product. The protein language model training method comprises: during a training process, executing at least one training sub-task amongst two training sub-tasks included in a first type of training task and a second type of training task; and, on the basis of a first loss value corresponding to the first type of training task and a loss value corresponding to the second type of training task, adjusting parameters of a protein language model to obtain a trained protein language model.

The invention discloses a polypeptide and application thereof in preparation of a medicine for preventing and / or treating cancers. The amino acid sequence of the polypeptide is shown as SEQ ID No. 1 or SEQ ID No. 2. The cancer is at least one of breast cancer, colorectal cancer, leukemia, esophageal cancer, pancreatic cancer, brain glioma, kidney cancer, skin cancer, osteosarcoma, ovarian cancer and prostate cancer. The invention designs and synthesizes the polypeptide of a targeted staphylococcus tumor protein compound SND1-MTDH containing a nuclease structural domain 1 (SND1 and a heteromucin (MTDH), finds that the polypeptide has excellent inhibitory activity on various different types of human cancer cells for the first time, and provides an optional scheme for broad-spectrum anti-cancer drugs. The polypeptide applied in the invention is simple in synthesis process and low in production cost.

The invention relates to the technical field of biology, in particular to a verticillium dahliae virulence gene, a verticillium dahliae virulence protein and application. The invention discloses a verticillium dahliae virulence gene VdPHO23like. The verticillium dahliae virulence gene VdPHO23like comprises a polynucleotide sequence for coding an amino acid sequence of SEQ ID NO: 3. According to the invention, expression of the gene is inhibited in a targeted manner through an RNA interference mediated gene silencing technology so as to weaken virulence of pathogenic bacteria, and an efficient, specific and environment-friendly comprehensive prevention and control strategy is provided for verticillium wilt of crops such as cotton.

The invention discloses a xanthine oxidase inhibitory peptide with a kidney improving function and application thereof, and belongs to the technical field of biological medicines.The xanthine oxidase inhibitory peptide is screened out by conducting enzymolysis, separation and purification on litopenaeus vannamei processing by-products and utilizing a molecular docking technology, the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Leu-Gly-Pro-Pro-Pro, and the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Leu-Gly-Pro-Pro-Pro. And the half inhibition concentration of the polypeptide is 2.356 + / -0.2448 mM. The xanthine oxidase inhibitory peptide is proved to have an improvement effect on hyperuricemia mice, the improvement effect is mainly characterized by reducing the content of serum uric acid, creatinine and urea nitrogen of the hyperuricemia mice, inhibiting the activity of xanthine oxidase (XOD) in serum and livers of the mice, inhibiting synthesis of uric acid and improving kidney injury of the mice, and Toxinpred prediction shows that the xanthine oxidase inhibitory peptide has the effect of inhibiting the activity of xanthine oxidase (XOD) in the serum and livers of the mice. The xanthine oxidase inhibitory peptide is free of toxic and side effects, so that the xanthine oxidase inhibitory peptide has a wide application prospect in preparation of food or drugs for improving renal functions.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention provides a tripeptide for promoting bone growth, the tripeptide is VPF, the amino acid sequence of the tripeptide is Val-Pro-Phe, the molecular weight of the tripeptide is 361.44 Da, and the tripeptide belongs to the technical field of functional bioactive peptides. The tripeptide can be prepared from egg yolk protein through enzymolysis separation and purification, can also be obtained through chemical solid-phase synthesis, has a good effect of promoting bone growth, can remarkably improve the growth and proliferation level of osteoblasts in a body, promotes synthesis and secretion of bone matrixes, and has a good application prospect. Meanwhile, the secretion of insulin-like growth factors (IGF-1), transforming growth factors (TGF-beta1) and I-type procollagen amino-terminal peptide (PINP) in the body is efficiently promoted, and good market prospects are achieved.

The invention provides a broad-spectrum antibacterial peptide, an antibacterial agent and application, and belongs to the technical field of biological medicine. The invention provides a broad-spectrum antibacterial peptide. The broad-spectrum antibacterial peptide comprises an amino acid sequence as shown in SEQ ID No. 1. The minimum inhibitory concentration of the antibacterial peptide to gram-positive bacteria, gram-negative bacteria and fungi proves that the antibacterial peptide has obvious antibacterial activity to the gram-positive bacteria, the gram-negative bacteria and the fungi. The invention also verifies the minimum inhibitory concentration of the antibacterial peptide to clinical drug-resistant bacteria. The cytotoxicity of the SL-12 disclosed by the invention is relatively weak, the SL-12 only shows obvious cytotoxicity at 200 [mu] g / ml, and the minimum inhibitory concentration of the SL-12 is 6.25-12.5 [mu] g / ml; the SL-12 has no obvious hemolytic activity when the concentration is 100 [mu] g / ml or lower, and is high in safety.

The invention provides a carbonyl reductase mutant. The carbonyl reductase mutant is obtained by performing single-point mutation or multi-point combined mutation on the 17th site, the 40th site and the 64th site of an amino acid sequence as shown in SEQ ID NO.1. The invention also provides a coding gene, a recombinant vector containing the coding gene, a co-expression engineering bacterium and an application of the co-expression engineering bacterium. Compared with a wild type enzyme, the carbonyl reductase mutant has high activity and high stereoselectivity, the enzyme activity can reach more than two times that of the wild type enzyme, the catalytic efficiency on a substrate precursor ketone is remarkably improved, the yield of a statin drug intermediate and chiral alcohol synthesized by an enzyme method of the carbonyl reductase mutant is remarkably improved, and the yield of a rosuvastatin intermediate (3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R, 3R) is remarkably improved. The highest yields of the (3R, 5R)-6-chloro-3, 5-dihydroxyhexanoic acid tert-butyl ester and the atorvastatin intermediate (3R, 5R)-6-cyano-3, 5-dihydroxyhexanoic acid tert-butyl ester reach 99% and 97.6% respectively, e.e. Is larger than 99%, and the method has high industrial application value.

The invention discloses recombinant human XVII type collagen as well as a preparation method and application thereof. The recombinant human XVII type collagen is obtained by repeating an amino acid sequence from natural human XVII type collagen. The amino acid sequence of the recombinant human XVII type collagen is derived from natural human XVII type collagen, and the recombinant human XVII type collagen does not generate adverse immune response when being used for a human body. The recombinant human XVII type collagen can be secreted and expressed in a commercial yeast expression system, the expression quantity is greater than 10g / L, the preparation method is simple, and the high-yield recombinant human XVII type collagen can be obtained at low cost; in addition, the cell adhesion promoting activity of the recombinant human XVII type collagen is obviously superior to that of human collagen.

The invention discloses a xanthine oxidase inhibitory peptide with uric acid reducing activity and application thereof, and belongs to the technical field of biological medicines.The xanthine oxidase inhibitory peptide is obtained by conducting enzymolysis, separation and purification on processing byproducts such as litopenaeus vannamei heads and shells with xanthine oxidase inhibitory activity. The xanthine oxidase inhibitory peptide is screened by using a molecular docking technology, and the amino acid sequence of the xanthine oxidase inhibitory peptide is Pro-Pro-Val-Pro-Pro-Pro. The xanthine oxidase inhibitory peptide has an XOD (X-Oxidase) half inhibitory concentration of 3.181 + / -0.1786 mM. The invention further proves that the xanthine oxidase inhibitory peptide has a certain improvement effect on hyperuricemia mice, and the xanthine oxidase inhibitory peptide mainly has the effects of reducing the content of serum uric acid, creatinine and urea nitrogen of the hyperuricemia mice, inhibiting the activity of xanthine oxidase (XOD) in serum and liver of the mice, inhibiting synthesis of uric acid and improving kidney injury of the mice, and the xanthine oxidase inhibitory peptide has a certain improvement effect on the hyperuricemia mice through Toxinpred prediction. The xanthine oxidase inhibitory peptide uric acid reducing peptide is free of toxic and side effects and has a wide market application prospect.

The invention relates to the technical field of antibacterial peptide application, in particular to an antibacterial peptide for inhibiting drug-resistant acinetobacter baumannii as well as a preparation method and application of the antibacterial peptide. The antibacterial peptide is cd77AHP-2, and the amino acid sequence of the antibacterial peptide is shown as SEQ ID NO.1. The antibacterial peptide cd77 obtained through artificial chemical synthesis is modified, distribution of cationic amino acid is optimized, and the antibacterial activity of the antibacterial peptide is remarkably improved. The antibacterial peptide cd77AHP-2 has a remarkable antibacterial effect on acinetobacter baumannii which are gram-negative bacteria and multi-drug resistant acinetobacter baumannii, and the antibacterial peptide cd77AHP-2 has a remarkable antibacterial effect on the acinetobacter baumannii which are gram-negative bacteria. The antibacterial peptide cd77AHP-2 provided by the invention has relatively low cytotoxicity to human bronchial epithelial cells, and has the potential of preparing a drug for resisting drug-resistant acinetobacter baumannii. The invention provides a novel functional polypeptide for the field of antibacterial peptides, and the novel functional polypeptide has important practical application value.

The invention provides humanized recombinant XVII collagen for promoting hair follicle stem cell repair and resisting aging as well as a preparation method and application thereof, and belongs to the technical field of biological medicines. The humanized recombinant XVII type collagen comprises polypeptide derived from the XVII type collagen or repeated protein formed by N times of repeated series connection of the polypeptide serving as a unit, n is an integer from 2 to 4; the polypeptide derived from the XVII type collagen comprises a polypeptide A and / or a polypeptide B; the amino acid sequence of the A polypeptide is as shown in SEQ ID NO: 1; and the amino acid sequence of the B polypeptide is as shown in SEQ ID NO: 2. The humanized recombinant XVII type collagen not only can be massively and stably recombined and expressed, but also has cell adhesion activity, cell proliferation promotion activity, cell migration promotion activity and excellent hair follicle repair and regeneration promotion activity, and has no sensitization side effect. The invention provides a new way for preparing collagen products with rich functions.

The present invention relates to a method for the production and purification of a protein of interest, and more particularly, the present invention relates to a fusion protein comprising: a self-aggregating peptide, a linker peptide comprising an amino acid sequence selected from an elastin-like polypeptide (ELP) or a protease propeptide (ProP) and the spacer comprising a cleavage site, and a protein portion of interest, and a method for column-free one-step purification of a target protein by expressing the fusion protein.

The invention relates to the technical field of hippocampus extract, in particular to a hippocampus-sourced neuroprotection and anti-oxidative stress polypeptide and a preparation method thereof.The amino acid sequence of the polypeptide is shown as SEQ ID No.1. The preparation method comprises the following steps that 1, 500 g of fresh hippocampus is weighed, surface silt is removed, freeze-drying is conducted at the temperature of-60 DEG C, then the hippocampus is smashed through a smashing machine and sieved through a 20-mesh sieve, and the hippocampus extract is obtained; dialyzing with distilled water for 24 hours, and freeze-drying to obtain hippocampus powder; (2) weighing 200g of hippocampus powder, adding 1000ml of 95% ethanol, extracting for three times, removing fat-soluble substances, and extracting and freeze-drying precipitates by using a 1 mol / L NaCl solution under the condition of 4 DEG C in combination with ultrasonic assistance to obtain crude hippocampus protein; (3) the hippocampus crude protein is taken, the hippocampus polypeptide is prepared through an ultrasonic-assisted bionic digestion method, and the hippocampus polypeptide has the advantages of being specific in molecular structure, clear in action mechanism, stable in gastrointestinal tracts, capable of protecting nerves, resistant to oxidative stress and the like.