9499results about "Depsipeptides" patented technology

The invention relates to the field of biotechnology and medicine, and more particularly to a polypeptide having the amino acid sequence SEQ ID NO: 1 and being capable of inhibiting RAS-GTPase activity, to the use of said polypeptide to produce a drug for treating stomach cancer or rectal cancer in a dose of 0.81-3.00 mg / kg, as well as to a drug based on said polypeptide for the treatment of stomach cancer or rectal cancer, and to a method for treating stomach cancer or rectal cancer by intraperitoneally administering said drug to a subject in an amount of 150 ml twice at an interval of 7 days.

The invention relates to the technical field of biology, in particular to a verticillium dahliae virulence gene, a verticillium dahliae virulence protein and application. The invention discloses a verticillium dahliae virulence gene VdPHO23like. The verticillium dahliae virulence gene VdPHO23like comprises a polynucleotide sequence for coding an amino acid sequence of SEQ ID NO: 3. According to the invention, expression of the gene is inhibited in a targeted manner through an RNA interference mediated gene silencing technology so as to weaken virulence of pathogenic bacteria, and an efficient, specific and environment-friendly comprehensive prevention and control strategy is provided for verticillium wilt of crops such as cotton.

The invention belongs to the technical field of gene engineering, and particularly relates to applications of OpgG and a mutant thereof in production of human milk oligosaccharide. The invention provides a dextran biosynthetic protein OpgG mutant, and the OpgG mutant is obtained by mutating the 443rd amino acid from threonine to proline on the basis of a wild type dextran biosynthetic protein OpgG as shown in SEQ ID NO.1. The invention also provides a preparation method of the dextran biosynthetic protein OpgG mutant. An opgG gene and / or a T443P mutant coding gene are / is introduced into a human milk oligosaccharide production strain and applied to production of human milk oligosaccharide, and the yield of 3 '-SL, 6'-SL, LNT II, LNnT and LNT is greatly increased.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention provides a method and a system for screening and constructing a small molecule polypeptide simulant based on interaction between proteins, relates to the technical field of biology, and comprises the following steps: predicting an interaction model of RECK protein and ADAM10 protein through a molecular docking platform, and analyzing interaction sites of the RECK protein and the ADAM10 protein. And then, determining a KAZAL region of the RECK protein according to the interaction site, and predicting a sequence structure of the KAZAL region. And then carrying out molecular docking on the KAZAL region and ADAM10 protein, designing a plurality of peptide fragments with the length of 30 amino acids, and screening the peptide fragment sequence with the highest score as candidate polypeptide. And finally, performing species homology comparison and quality control detection on the candidate polypeptide, and verifying the binding capacity and biological function of the candidate polypeptide to ADAM10 protein through cell experiments. The invention provides a method for screening to obtain a polypeptide simulant specifically bound with ADAM10 protein. The polypeptide simulant can be used for treating ADAM10 related diseases.

The invention provides compositions and methods for treating cancer by using immune effector cells (e.g., T cells, NK cells) engineered to conditionally express an agent which enhances the immune effector response of an immune effector cell that expresses a Chimeric Antigen Receptor (CAR). The conditional agents described herein include agents that target a cancer associated antigen, e.g., a CAR, agents that inhibit one or more checkpoint inhibitors of the immune response, and a cytokine.

The invention relates to the field of prevention and treatment of plant filamentous fungal diseases, in particular to an application of a compound NSC-32 (N-[(5Z)-4-oxo-5-(phenylmethylidene-1, 3-thiazolidin-3-yl) pyridin-4-carboxamide) in prevention and treatment of magnaporthe oryzae, and a preparation method of the compound NSC-32 (N-[(5Z)-4-oxo-5-(phenylmethylidene-1, 3-thiazolidin-3-yl) pyridin-4-carboxamide). MoPex19 protein is used as a target spot, a compound NSC-32 is obtained through screening, and it is proved that the compound can inhibit growth of magnaporthe oryzae and reduce pathogenicity of the magnaporthe oryzae. In addition, the application object, the use method, the target specificity and the action mechanism of the compound NSC-32 are further explored, and a new green pesticide and a new thought are provided for preventing and treating the magnaporthe oryzae.

Recombinant NK cells, and especially recombinant NK-92 cells express a chimeric antigen receptor (CAR) having an intracellular domain of FcεRIγ. Notably, CAR constructs with an intracellular domain of FcεRIγ had a substantially prolonged duration of expression and significantly extended cytotoxicity over time. The CAR may be expressed from RNA and DNA, preferably as a tricistronic construct that further encodes CD16 and a cytokine to confer autocrine growth support. Advantageously, such constructs also enable high levels of transfection and expression of the recombinant proteins and provide a convenient selection marker to facilitate rapid production of recombinant NK / NK-92 cells.

Methods for making synthetic gene clusters are described.

The invention discloses a cherax quadricarinatus oocyte targeted penetrating peptide VgSP and a living body delivery method thereof, and belongs to the technical field of biology. The invention provides the cherax quadricarinatus oocyte targeted penetrating peptide VgSP on one hand, and provides application of the cherax quadricarinatus oocyte targeted penetrating peptide VgSP on the other hand. The invention provides a polypeptide VgSP capable of being recognized by a cherax quadricarinatus oocyte surface receptor and mediated into an oocyte, and an injection and detection method of the polypeptide in sub-adult and adult female cherax quadricarinatus. The breakthrough lays a technical foundation for establishing a gene editing element delivery method with oocyte targeting, and is expected to be applied to the field of cherax quadricarinatus gene editing.

The invention discloses construction and application of an L-malic acid producing issatchenkia orientalis strain, and belongs to the technical field of microorganisms and the technical field of microbial fermentation and metabolic engineering. Through a metabolic engineering means, a cytoplasm metabolic pathway of an issatchenkia orientalis strain is transformed, and a pyruvate decarboxylase coding gene, glycerol dehydrogenase and lactic dehydrogenase are knocked out; a pyruvate carboxylase gene derived from aspergillus flavus, a malate dehydrogenase gene derived from corynebacterium glutamicum and phosphoenolpyruvate carboxylase derived from escherichia coli are screened and integrated, so that a cytoplasm rTCA cycle synthesis pathway is enhanced; inserting a dicarboxylic acid external transporter gene from schizosaccharomyces cerevisiae at a neutral site GD21, and knocking out endogenous dicarboxylic acid internal transporter; the L-malic acid yield of the modified yeast strain in the fermentation process is remarkably increased and reaches 140.16 g / L. The engineering strain provided by the invention has good industrial application potential in efficient L-malic acid production.

The invention belongs to the technical field of genetic engineering, and particularly relates to an antibacterial peptide with antibacterial and antiviral effects and application and a product thereof. The amino acid sequence of the antibacterial peptide provided by the invention has the following general formula: X1GX2FX3FX4KKFX5LFX6X7SKVLK, x1 is M or has no amino acid; x2 is one of R, G and H; x3 is one of KS, KR, HR and HH; x4 is R or L; x5 is one of KK, HH and HK; x6 is RR or KK; and X7 is I or L. The antibacterial peptide disclosed by the invention has a relatively good antibacterial effect, and shows antiviral activity on HPV16 (Human Papilloma Virus 16) and HPV18 (Human Papilloma Virus 18). Good application prospects are shown in the preparation of antibacterial or antiviral products.

The invention discloses an antibacterial peptide and application thereof, and belongs to the technical field of biology. The antibacterial peptide with an inhibition effect on various clinically common pathogenic microorganisms is obtained, and the antibacterial peptide comprises gram-negative bacteria such as escherichia coli, klebsiella pneumoniae, pseudomonas aeruginosa, acinetobacter baumannii, vibrio parahaemolyticus, salmonella gallinarum, salmonella typhimurium and enterobacter sakazakii, and gram-positive bacteria. The antibacterial peptide provided by the invention can be used as an antibacterial peptide, such as staphylococcus aureus, listeria monocytogenes and bacillus cereus, and the antibacterial peptide provided by the invention is novel in structure and easy to prepare.

The instant specification provides for evolved base editors which overcome deficiencies of those in art (including increased efficiency and / or decreased requirement for specific sequence-context at an editing site) and which are obtained a result of a phage-assisted continuous evolution (PACE) system. In particular, the instant specification provides for evolved cytidine base editors (e.g., based on APOBEC1, CDA, or AID cytidine deaminase domains) which overcome deficiencies of those in art (including increased efficiency and / or decreased requirement for specific sequence-context at an editing site) and which are obtained a result of a phage-assisted continuous evolution (PACE) system.

According to the method, an antibacterial peptide sequence design framework is designed based on protein language model supervised fine tuning and human feedback reinforcement learning, a multiple screening framework is designed, and specifically, an antibacterial peptide design and screening model and a fine tuning mode of the model are developed through an innovative calculation method and a comprehensive analysis process; the method effectively solves the problems of low antibacterial peptide design and screening efficiency, insufficient accuracy, single optimization dimension and the like in the prior art, and an efficient, accurate and flexible new method is provided for research and development of the antibacterial peptide.

The invention provides an immunologic adjuvant composition as well as a preparation method and application thereof. The immunologic adjuvant composition comprises an immunologic active agent and a liposome for loading the immunologic active agent, wherein the immunologic active agent comprises saponin and CpG oligodeoxynucleotide. The immunologic adjuvant composition can induce immune response of mammals to human herpes virus and / or hepatitis B virus, and can induce generation of a relatively high cellular immune response level. The QS21 and the CpG oligodeoxynucleotide are simultaneously loaded by using the liposome, so that the QS21 and the CpG oligodeoxynucleotide have a better synergistic effect in the aspect of promoting cellular immunity, and compared with a Shingrix commercially available vaccine, the vaccine can induce generation of a higher cellular immune response level.

The invention belongs to the technical field of characterization of target samples, and provides PANX3 biopore protein and application of a mutant and single molecule detection thereof. The PANX3 biopore protein is composed of seven identical subunits, the overall channel is funnel-shaped, and the amino acid sequence is shown as SEQ ID NO: 1. After one or more amino acids of the wild type PANX3 biopore protein are mutated into common amino acids except original amino acids, compared with the wild type PANX3 biopore protein, the mutant can be normally expressed and has stable properties, and the current property and the current signal of the mutant are obviously improved.

The present invention relates to the field of lentiviral delivery. Specifically provided are a mutated vesicular virus envelope protein and the use thereof in lentiviral vector packaging.

The invention discloses a porcine epidemic diarrhea virus antigen fusion protein, a coding gene and a porcine epidemic diarrhea vaccine prepared from the porcine epidemic diarrhea virus antigen fusion protein. The method comprises the following steps: screening to obtain a homosensory sequence of the spike protein of the porcine epidemic diarrhea virus, and fusing the homosensory sequence with a monomeric porcine ferritin heavy chain subunit to obtain an antigen fusion protein; in order to improve the expression quantity or the titer of the antigen fusion protein, the obtained antigen fusion protein is subjected to sequence optimization and then subjected to single-site or multi-site mutation, and the expression quantity and the titer of the obtained mutant are remarkably improved. According to the invention, a recombinant protein is expressed by using a silkworm or AcMNPV-insect cell and other eukaryotic expression systems to obtain a self-assembled ferritin nanoparticle antigen for displaying an S protein antigen protein on the surface of a cage structure of porcine ferritin, and a vaccine prepared from the prepared nanoparticle antigen can induce a widely neutralized anti-porcine epidemic diarrhea virus antibody; the porcine epidemic diarrhea virus vaccine has the potential of becoming a universal porcine epidemic diarrhea virus vaccine with cross immune efficacy.

The invention relates to an oral mucosa repairing medicine and a preparation method thereof, and belongs to the technical field of medicines, the medicine comprises barnacle peptide, salivary lactobacillus, resveratrol, a biphasic adhesion matrix, hydroxyapatite, vitamin B family and other components. The preparation method comprises the following steps: sequentially carrying out enzymolysis on barnacle gooseneck by pepsin and lumbrukinase to obtain barnacle peptide. The double-phase adhesion matrix comprises a water-phase matrix, an oil-phase matrix and lecithin; the water-phase matrix contains a chondroitin sulfate-chitosan quaternary ammonium salt compound, sodium alginate and other components; the oil-phase matrix comprises sesame oil, beeswax, a polylactic acid-glycolic acid copolymer and the like. According to the invention, barnacle peptide and salivary lactobacillus are prepared by adopting a special method and are matched with resveratrol for use, so that multi-target and multi-path promotion of oral mucosa repair can be realized; the chondroitin sulfate-chitosan quaternary ammonium salt compound is prepared through electrostatic and physical embedding, the chondroitin sulfate-chitosan quaternary ammonium salt compound is matched with other components to prepare the biphasic adhesion matrix, the biocompatibility is good, the adhesion is high, and the action time of a sustained-release drug is well prolonged.

The present invention relates to a new class of molecules for selective clearance of antibodies and the uses thereof for treating antibody-mediated diseases and disorders.

The technology described herein relates to novel CRISPR / Cas systems and components thereof, vectors, proteins, fusion proteins, ribonucleoprotein complexes and methods of using the novel systems and components. The new system can be used in CRIS PRi applications and can be fused with any number of effector domain patterns, such as nuclease, base editor, leader editor, and the like, to conduct a variety of DNA modifications.

The invention belongs to the field of prevention and treatment of tilletia controversa Kuhn, and particularly relates to a tilletia controversa Kuhn effect protein g16561 and application thereof. An amino acid sequence of the Tilletia controversa Kuhn effect protein is shown as SEQ ID NO: 2. The effect protein plays an important role in the process of inhibiting plant defense reaction, and has an interaction relationship with a wheat protein in the process of infecting wheat by Tilletia controversa Kuhn. According to the invention, the pathogenesis of Tilletia controversa Kuhn can be deeply researched, and the excavation of wheat disease-resistant genes and the cultivation of wheat disease-resistant varieties can be promoted.

The present application relates to a method of producing a protein comprising an unnatural amino acid (UAA), the method comprising culturing a host cell, where the host cell is a eukaryotic cell, together with a nucleotide sequence encoding a first recoding tRNA or a first recoding tRNA, where the first recoding tRNA comprises an anticodon complementarily paired with a first codon, wherein the first codon is a rare codon; a nucleotide sequence encoding a first aminoacyl-tRNA synthetase or a first aminoacyl-tRNA synthetase, the first aminoacyl-tRNA synthetase being capable of loading a first recoding tRNA with a first non-natural amino acid.

Some aspects of this disclosure provide compositions, methods, systems, and kits for controlling the activity of RNA-programmable endonucleases, such as Cas9, or for controlling the activity of proteins comprising a Cas9 variant fused to a functional effector domain, such as a nuclease, nickase, recombinase, deaminase, transcriptional activator, transcriptional repressor, or epigenetic modifying domain. For example, the inventive proteins provided comprise a ligand-dependent intein, the presence of which inhibits one or more activities of the protein (e.g., gRNA binding, enzymatic activity, target DNA binding). The binding of a ligand to the intein results in self-excision of the intein, restoring the activity of the protein.

The invention relates to the field of prevention and treatment of respiratory diseases, and discloses a preparation method of a human respiratory syncytial virus preventive mRNA vaccine. The main components of the mRNA vaccine comprise mRNA for coding an antigen and lipid nanoparticles. According to the mRNA sequence provided by the invention, an independently researched and developed 5 'UTR / 3' UTR sequence and a codon optimization mode are adopted, and efficient translation of target protein can be realized. According to the mRNA vaccine provided by the invention, RSV F protein is selected as an antigen, and the RSV F protein sequence is optimally designed, so that stable pre-fusion conformation RSV F protein can be expressed, and after a mouse is immunized, the mouse can be induced to generate high-level RSV F protein specific binding antibody titer and neutralizing antibody titer.

Systems and methods for targeted gene modification, targeted insertion, perturbation of gene transcripts, and nucleic acid editing. Novel nucleic acid targeting systems comprise components of CRISPR systems and non-LTR retrotransposon elements.

Some aspects of this disclosure provide strategies, systems, reagents, methods, and kits that are useful for the targeted editing of nucleic acids, including editing a single site within the genome of a cell or subject, e.g., within the human genome. In some embodiments, fusion proteins of Cas9 and nucleic acid editing proteins or protein domains, e.g., deaminase domains, are provided. In some embodiments, methods for targeted nucleic acid editing are provided. In some embodiments, reagents and kits for the generation of targeted nucleic acid editing proteins, e.g., fusion proteins of Cas9 and nucleic acid editing proteins or domains, are provided.

The invention discloses a transcription factor Cgl2988 related to production of 5-aminolevulinic acid based on network model prediction and application, the amino acid sequence of the transcription factor Cgl2988 is as shown in SEQ ID NO.1. The transcription factor Cgl2988 related to production of 5-ALA is simulated and predicted based on a metabolic network model system mcCGL, and experiments prove that the transcription factor Cgl2988 related to production of 5-ALA has the advantages that the transcription factor Cgl2988 related to production of 5-ALA can be used for preparing the transcription factor Cgl2988 related to production of 5-ALA; the expression strain Cgh3-low-cgl2988 of the transcription factor gene cgl2988 in the down-regulated corynebacterium glutamicum is subjected to shake flask fermentation, and the yield of 5-ALA is 5.52 + / -0.19 g / L and is increased by about 1.64 times compared with that of a control strain; the expression strain Cgh3-pX-cgl2988 of the transcription factor gene cgl2988 in the up-regulated corynebacterium glutamicum is subjected to shake flask fermentation, and the yield of the 5-ALA is 5.76 + / -0.11 g / L, which is about 2.84 times higher than that of a control strain.

The disclosure is directed in part to variant capsid polypeptides that can be used to deliver payloads.