11267results about "Depsipeptides" patented technology

The invention relates to the field of biotechnology and medicine, and more particularly to a polypeptide having the amino acid sequence SEQ ID NO: 1 and being capable of inhibiting RAS-GTPase activity, to the use of said polypeptide to produce a drug for treating stomach cancer or rectal cancer in a dose of 0.81-3.00 mg / kg, as well as to a drug based on said polypeptide for the treatment of stomach cancer or rectal cancer, and to a method for treating stomach cancer or rectal cancer by intraperitoneally administering said drug to a subject in an amount of 150 ml twice at an interval of 7 days.

Present invention teaches the method of using a keratin hydrolysis peptide (“KHP”) solution to enhance the drought-tolerance of the cotton plant. By selectively choosing specific weights of feathers and water, and treating the mixture, though one embodiment does not have water mixed in, to a high-temperature high-pressure hydrolysis process, the resulting solution is confirmed to contain at least 253 peptides and then applied to the cotton seeds and the soil around the cotton plants. Optionally, the KHP solution can be diluted by water, as taught in the specification, before applying to the seeds and the soil as taught herein.

The invention relates to the technical field of biology, in particular to a verticillium dahliae virulence gene, a verticillium dahliae virulence protein and application. The invention discloses a verticillium dahliae virulence gene VdPHO23like. The verticillium dahliae virulence gene VdPHO23like comprises a polynucleotide sequence for coding an amino acid sequence of SEQ ID NO: 3. According to the invention, expression of the gene is inhibited in a targeted manner through an RNA interference mediated gene silencing technology so as to weaken virulence of pathogenic bacteria, and an efficient, specific and environment-friendly comprehensive prevention and control strategy is provided for verticillium wilt of crops such as cotton.

The invention belongs to the technical field of gene engineering, and particularly relates to applications of OpgG and a mutant thereof in production of human milk oligosaccharide. The invention provides a dextran biosynthetic protein OpgG mutant, and the OpgG mutant is obtained by mutating the 443rd amino acid from threonine to proline on the basis of a wild type dextran biosynthetic protein OpgG as shown in SEQ ID NO.1. The invention also provides a preparation method of the dextran biosynthetic protein OpgG mutant. An opgG gene and / or a T443P mutant coding gene are / is introduced into a human milk oligosaccharide production strain and applied to production of human milk oligosaccharide, and the yield of 3 '-SL, 6'-SL, LNT II, LNnT and LNT is greatly increased.

The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).

The invention provides a method and a system for screening and constructing a small molecule polypeptide simulant based on interaction between proteins, relates to the technical field of biology, and comprises the following steps: predicting an interaction model of RECK protein and ADAM10 protein through a molecular docking platform, and analyzing interaction sites of the RECK protein and the ADAM10 protein. And then, determining a KAZAL region of the RECK protein according to the interaction site, and predicting a sequence structure of the KAZAL region. And then carrying out molecular docking on the KAZAL region and ADAM10 protein, designing a plurality of peptide fragments with the length of 30 amino acids, and screening the peptide fragment sequence with the highest score as candidate polypeptide. And finally, performing species homology comparison and quality control detection on the candidate polypeptide, and verifying the binding capacity and biological function of the candidate polypeptide to ADAM10 protein through cell experiments. The invention provides a method for screening to obtain a polypeptide simulant specifically bound with ADAM10 protein. The polypeptide simulant can be used for treating ADAM10 related diseases.

The invention provides compositions and methods for treating cancer by using immune effector cells (e.g., T cells, NK cells) engineered to conditionally express an agent which enhances the immune effector response of an immune effector cell that expresses a Chimeric Antigen Receptor (CAR). The conditional agents described herein include agents that target a cancer associated antigen, e.g., a CAR, agents that inhibit one or more checkpoint inhibitors of the immune response, and a cytokine.

The invention relates to the field of prevention and treatment of plant filamentous fungal diseases, in particular to an application of a compound NSC-32 (N-[(5Z)-4-oxo-5-(phenylmethylidene-1, 3-thiazolidin-3-yl) pyridin-4-carboxamide) in prevention and treatment of magnaporthe oryzae, and a preparation method of the compound NSC-32 (N-[(5Z)-4-oxo-5-(phenylmethylidene-1, 3-thiazolidin-3-yl) pyridin-4-carboxamide). MoPex19 protein is used as a target spot, a compound NSC-32 is obtained through screening, and it is proved that the compound can inhibit growth of magnaporthe oryzae and reduce pathogenicity of the magnaporthe oryzae. In addition, the application object, the use method, the target specificity and the action mechanism of the compound NSC-32 are further explored, and a new green pesticide and a new thought are provided for preventing and treating the magnaporthe oryzae.

The invention relates to a protein for improving the expression yield of a foreign protein and application of the protein. Wherein the ERV29 protein and the related protein as well as the P180 protein and the related protein can be used as molecular chaperones for improving the expression yield of foreign proteins such as Brazilian sweet and the like; the amino acid sequence of the ERV29 protein is as shown in SEQ ID No. 4; the amino acid sequence of the P180 protein is as shown in SEQ ID No. 6.

The invention belongs to the technical field of protein engineering, and discloses a Brazilian sweet protein mutant and application thereof. According to the invention, lysine is used for replacing aspartic acid at the 29th site of Brazilian sweet protein, and / or arginine is used for replacing glutamic acid at the 36th site, and / or alanine is used for replacing aspartic acid at the 50th site, amino acid mutation at the sites is carried out to construct a Brazilian sweet protein mutant, and the Brazilian sweet protein mutant is subjected to heterologous expression in pichia pastoris GS115, so that the Brazilian sweet protein mutant is obtained. And carrying out sweetness performance evaluation on the expressed Brazilian sweet protein mutant. The sweetness property of the double mutant Asp29Lys-Asp50Ala protein is improved by 240% compared with the sweetness property of the Brazilian sweet protein before mutation.

Recombinant NK cells, and especially recombinant NK-92 cells express a chimeric antigen receptor (CAR) having an intracellular domain of FcεRIγ. Notably, CAR constructs with an intracellular domain of FcεRIγ had a substantially prolonged duration of expression and significantly extended cytotoxicity over time. The CAR may be expressed from RNA and DNA, preferably as a tricistronic construct that further encodes CD16 and a cytokine to confer autocrine growth support. Advantageously, such constructs also enable high levels of transfection and expression of the recombinant proteins and provide a convenient selection marker to facilitate rapid production of recombinant NK / NK-92 cells.

Methods for making synthetic gene clusters are described.

The invention discloses an attenuated salmonella typhimurium EN-VNP (Enhanced Natriuretic Peptide) strain as well as a preparation method and application of the attenuated salmonella typhimurium EN-VNP strain. Comprising the following steps: on the basis of a salmonella VNP20009 strain, flagellin genes fliC and fljB, a phosphoethanolamine transferase gene eptA, a 4-amino-4-deoxy-L-arabinose transferase gene arnT and phosphotransferase yeiU are sequentially knocked out or silenced, and a strain is formed after a phosphotransferase gene lpxE is knocked in or overexpressed, so that the attenuated salmonella typhimurium EN-VNP strain is prepared. According to the attenuated salmonella typhimurium EN-VNP with low toxicity and the T cell adjuvant effect and an EN-OMV antigen delivery system prepared from the attenuated salmonella typhimurium EN-VNP, an improved strain does not contain flagellin, an LPS molecular structure is changed, the attenuated salmonella typhimurium EN-VNP has the low toxicity and the T cell adjuvant effect, and normal multiplication culture can be achieved.

The invention relates to the technical field of a preparation method of a type A recombinant botulinum toxin, in particular to a type A botulinum toxin obtained by adopting a gene recombination technology, and the amino acid sequence of the type A botulinum toxin is consistent with the sequence of the type A botulinum toxin prepared by extracting and purifying a wild strain Clostridium botulinum. According to the technical scheme, the single-chain protein of the botulinum toxin A sequentially comprises a botulinum toxin A light chain or a modified botulinum toxin A light chain, a connecting region and a botulinum toxin A heavy chain. According to the scheme, the high-quality recombinant botulinum toxin A is obtained after the single-chain protein is subjected to fermentation, crude purification, enzyme digestion and fine purification. According to the technical scheme, the problems of complex process, long period, high safety risk and the like in the existing process for preparing the botulinum toxin A from the wild bacterial strain clostridium botulinum can be solved, and meanwhile, the problem that the amino acid sequence consistent with that of the botulinum toxin A prepared from the wild bacterial strain clostridium botulinum cannot be obtained through the existing gene recombination technology is solved.

The invention discloses a fatty acid modified coronavirus antigen and application thereof, and belongs to the field of biological medicine. The fatty acid modified coronavirus antigen contains fatty acid modified N-terminal cysteine (Cys) and a coronavirus antigen, and can contain a connecting structural domain; the coronavirus antigen is a coronavirus spike protein (S protein) receptor binding domain (RBD). The fatty acid modified coronavirus S protein RBD can be self-polymerized into nanoparticles, and compared with the RBD which is not subjected to fatty acid modification, the antigen can induce faster and higher humoral immunity through injection immunity, can induce mucosal immunity and humoral immunity through respiratory tract atomization immunity, and is a candidate mucosal vaccine with potential medical value.

The invention discloses a cherax quadricarinatus oocyte targeted penetrating peptide VgSP and a living body delivery method thereof, and belongs to the technical field of biology. The invention provides the cherax quadricarinatus oocyte targeted penetrating peptide VgSP on one hand, and provides application of the cherax quadricarinatus oocyte targeted penetrating peptide VgSP on the other hand. The invention provides a polypeptide VgSP capable of being recognized by a cherax quadricarinatus oocyte surface receptor and mediated into an oocyte, and an injection and detection method of the polypeptide in sub-adult and adult female cherax quadricarinatus. The breakthrough lays a technical foundation for establishing a gene editing element delivery method with oocyte targeting, and is expected to be applied to the field of cherax quadricarinatus gene editing.

The invention discloses construction and application of an L-malic acid producing issatchenkia orientalis strain, and belongs to the technical field of microorganisms and the technical field of microbial fermentation and metabolic engineering. Through a metabolic engineering means, a cytoplasm metabolic pathway of an issatchenkia orientalis strain is transformed, and a pyruvate decarboxylase coding gene, glycerol dehydrogenase and lactic dehydrogenase are knocked out; a pyruvate carboxylase gene derived from aspergillus flavus, a malate dehydrogenase gene derived from corynebacterium glutamicum and phosphoenolpyruvate carboxylase derived from escherichia coli are screened and integrated, so that a cytoplasm rTCA cycle synthesis pathway is enhanced; inserting a dicarboxylic acid external transporter gene from schizosaccharomyces cerevisiae at a neutral site GD21, and knocking out endogenous dicarboxylic acid internal transporter; the L-malic acid yield of the modified yeast strain in the fermentation process is remarkably increased and reaches 140.16 g / L. The engineering strain provided by the invention has good industrial application potential in efficient L-malic acid production.

The invention belongs to the technical field of genetic engineering, and particularly relates to an antibacterial peptide with antibacterial and antiviral effects and application and a product thereof. The amino acid sequence of the antibacterial peptide provided by the invention has the following general formula: X1GX2FX3FX4KKFX5LFX6X7SKVLK, x1 is M or has no amino acid; x2 is one of R, G and H; x3 is one of KS, KR, HR and HH; x4 is R or L; x5 is one of KK, HH and HK; x6 is RR or KK; and X7 is I or L. The antibacterial peptide disclosed by the invention has a relatively good antibacterial effect, and shows antiviral activity on HPV16 (Human Papilloma Virus 16) and HPV18 (Human Papilloma Virus 18). Good application prospects are shown in the preparation of antibacterial or antiviral products.

The invention discloses an antibacterial peptide and application thereof, and belongs to the technical field of biology. The antibacterial peptide with an inhibition effect on various clinically common pathogenic microorganisms is obtained, and the antibacterial peptide comprises gram-negative bacteria such as escherichia coli, klebsiella pneumoniae, pseudomonas aeruginosa, acinetobacter baumannii, vibrio parahaemolyticus, salmonella gallinarum, salmonella typhimurium and enterobacter sakazakii, and gram-positive bacteria. The antibacterial peptide provided by the invention can be used as an antibacterial peptide, such as staphylococcus aureus, listeria monocytogenes and bacillus cereus, and the antibacterial peptide provided by the invention is novel in structure and easy to prepare.

The instant specification provides for evolved base editors which overcome deficiencies of those in art (including increased efficiency and / or decreased requirement for specific sequence-context at an editing site) and which are obtained a result of a phage-assisted continuous evolution (PACE) system. In particular, the instant specification provides for evolved cytidine base editors (e.g., based on APOBEC1, CDA, or AID cytidine deaminase domains) which overcome deficiencies of those in art (including increased efficiency and / or decreased requirement for specific sequence-context at an editing site) and which are obtained a result of a phage-assisted continuous evolution (PACE) system.

According to the method, an antibacterial peptide sequence design framework is designed based on protein language model supervised fine tuning and human feedback reinforcement learning, a multiple screening framework is designed, and specifically, an antibacterial peptide design and screening model and a fine tuning mode of the model are developed through an innovative calculation method and a comprehensive analysis process; the method effectively solves the problems of low antibacterial peptide design and screening efficiency, insufficient accuracy, single optimization dimension and the like in the prior art, and an efficient, accurate and flexible new method is provided for research and development of the antibacterial peptide.

Present invention uses a mixture of feathers and water, and, depending on specific embodiments of the ratio between feathers and water, subject the mixture to a high-temperature and high-pressure treatment process for a fixed amount of time, resulting in a keratin solution containing at least 253 peptides, with their molecular masses between 500 and 4,000 Daltons, and the concentration is in the range of 2.0×105˜4.5×105 ppm. The solution can then be further diluted by water for application to different plants, at specific growth stages, following additional steps or processes of application to increase crops yield.

The invention discloses an immune composition containing a fatty acid modified SpyCatcher protein and a preparation method of the immune composition, and belongs to the field of biological medicines. Wherein the SpyCatcher protein (LipoSC) can be self-polymerized into nanoparticles, the SpyCatcher protein (LipoSC) is covalently linked with an antigen containing SpyTag polypeptide through an isopeptide bond, so that the immunogenicity of the loaded antigen can be improved, and a coronavirus spike protein (S protein) receptor binding domain (RBD) is taken as an example. The immune composition containing the fatty acid modified SpyCatcher protein and the coronavirus RBD antigen disclosed by the invention can induce strong RBD specific immune response, and particularly can induce mucosal immunity and humoral immunity of antigen specificity as a mucosal subunit vaccine. The invention further provides a method for finishing fatty acid modification of the SpyCatcher protein in escherichia coli and a method for preparing various immune compositions by using the fatty acid modified protein.

The invention discloses sea cucumber gonad-derived antioxidant peptide as well as a preparation method and application thereof, and belongs to the technical field of food biology. The antioxidant peptide is obtained by carrying out enzymolysis and molecular docking screening on sea cucumber gonads, and comprises at least one of peptides with amino acid sequences as shown in SEQ.ID.NO.1-4. Wherein the docking energy of the SEQ.ID.NO.1 and the receptor SOD is-7.5 kcal / mol, the docking energy of the SEQ.ID.NO.2 and the receptor SOD is-7.5 kcal / mol, the docking energy of the SEQ.ID.NO.3 and the receptor SOD is-7.4 kcal / mol, and the docking energy of the SEQ.ID.NO.4 and the receptor SOD is-7.2 kcal / mol. Tests prove that the antioxidant peptide has high antioxidant activity and has wide application space in the field of functional food.

The invention provides an immunologic adjuvant composition as well as a preparation method and application thereof. The immunologic adjuvant composition comprises an immunologic active agent and a liposome for loading the immunologic active agent, wherein the immunologic active agent comprises saponin and CpG oligodeoxynucleotide. The immunologic adjuvant composition can induce immune response of mammals to human herpes virus and / or hepatitis B virus, and can induce generation of a relatively high cellular immune response level. The QS21 and the CpG oligodeoxynucleotide are simultaneously loaded by using the liposome, so that the QS21 and the CpG oligodeoxynucleotide have a better synergistic effect in the aspect of promoting cellular immunity, and compared with a Shingrix commercially available vaccine, the vaccine can induce generation of a higher cellular immune response level.

The invention belongs to the technical field of characterization of target samples, and provides PANX3 biopore protein and application of a mutant and single molecule detection thereof. The PANX3 biopore protein is composed of seven identical subunits, the overall channel is funnel-shaped, and the amino acid sequence is shown as SEQ ID NO: 1. After one or more amino acids of the wild type PANX3 biopore protein are mutated into common amino acids except original amino acids, compared with the wild type PANX3 biopore protein, the mutant can be normally expressed and has stable properties, and the current property and the current signal of the mutant are obviously improved.

The present disclosure provides BCMA binding molecules that specifically bind to human BCMA, conjugates comprising the BCMA binding molecules, and pharmaceutical compositions comprising the BCMA binding molecules and the conjugates. The disclosure further provides methods of using the BCMA binding molecules to treat cancers that express cell surface BCMA. The disclosure yet further provides recombinant host cells engineered to express the BCMA binding molecules and methods of producing the BCMA binding molecules by culturing the host cells under conditions in which the BCMA binding molecules are expressed.

The invention relates to fusarium venanii with high protein conversion rate and application of the fusarium venanii to improvement of hypha protein satiety, and belongs to the field of genetic engineering technology and food biotechnology. The fusarium venenatum FCPD disclosed by the invention is preserved in the China Center for Type Culture Collection on December 6, 2024, and the preservation number of the fusarium venenatum FCPD is CCTCC (China Center for Type Culture Collection) NO: M 20242752. The glucose consumption of a substrate for producing mycelia with the same dry weight by the fusarium venanii is reduced by 40-60% compared with that of a wild type, the protein conversion rate is improved by 70-80%, the grease content is improved by 90-110%, the gastric semi-emptying time of in-vitro simulated digestion is prolonged by 10-30%, and the quality of fusarium venanii mycelium protein is remarkably improved. Genetic engineering modification work can be further developed, and fusarium strains with high substrate conversion rate, high grease content and high satiety potential can be cultivated.

The invention relates to a polypeptide ligand and a derivative of E3 ubiquitin ligase as well as a preparation method and application of the polypeptide ligand and the derivative, and relates to the technical field of biological medicines. The polypeptide ligand of the E3 ubiquitin ligase is characterized in that the amino acid sequence of the polypeptide ligand is shown as any one of SEQ ID NO: 1-3, and at least one disulfide bond is formed between cysteine residues in the amino acid sequence of the polypeptide ligand; the polypeptide ligand is combined with the E3 ubiquitin ligase RNF43 and / or the E3 ubiquitin ligase ZNRF3. The polypeptide ligand provided by the invention can be used for flexibly and modularly constructing various bifunctional molecules, such as small-size bifunctional molecules or bifunctional molecules with components which cannot be obtained through expression, so as to degrade disease-related membrane proteins, such as PD-L1, EGFR and the like, and has the potential of disease treatment.

The present invention relates to the field of lentiviral delivery. Specifically provided are a mutated vesicular virus envelope protein and the use thereof in lentiviral vector packaging.