119 results about "Diagnostic agent" patented technology

The invention provides particles, compositions including the particles, and methods of making the particles using electrospray. In certain embodiments, the particles allow for high concentrations of a therapeutic or diagnostic agent to be delivered at low viscosity. Particles may also exhibit beneficial properties with respect to stability.

Theranostic targeted ultrasonic blasting nano-bubbles, a preparation method therefor, and use thereof, wherein the nano-bubbles are the targeted drug-gene nano-bubbles miRNA / FTY720 / PFP@PEI-T7 NBs. The nano-bubbles can be used for preparing a thyroid ultrasound diagnostic agent or a drug for treating thyroid cancer.

Compositions comprising microalgal extracellular vesicles (MEVs) formulated for intranasal delivery are provided, whereby upon intranasal administration, the MEVs are transported by a specific route, to specific regions in the brain via the olfactory nerve after intranasal administration, and to interconnected brain regions through the lateral olfactory tract (LOT). The MEVs are transported via neuronal axonal transport. The MEVs have the ability to cross synapses including: (i) synapses between olfactory sensory neurons (OSNs) and mitral / tufted neurons; (ii) synapses between mitral / tufted neurons and local neurons in multiple brain regions colonized by the lateral olfactory tract (LOT); and (iii) synapses between neurons in brain regions colonized by the LOT and neurons from the frontal cortex, hippocampus, thalamus, and hypothalamus. The compositions contain extracellular vesicles (MEVs) from microalgae loaded with bioactive cargo for the treatment, detection, diagnosis, or monitoring of diseases, disorders, or conditions of or involving the brain, particularly neuronal delivery of the cargo. The compositions and methods have multiple applications as therapeutic and diagnostic agents for the treatment, diagnosis, and monitoring of diseases, disorders, or conditions of or involving the brain. The compositions can be used in methods and uses for the treatment of cancers involving the brain, and can be used, for example, to deliver therapeutic agents for psychiatric diseases, disorders, conditions, and to deliver therapeutic agents for neurodegenerative diseases, disorders, and conditions.

The present invention relates to a supramolecular self-assembly system, comprising the following ingredients:(2) one or more carriers (or building blocks), which are water-soluble or at least soluble under pH≤8 conditions, where at least one carrier is amphiphilic with a hydrophobic group and a hydrophilic group; and(3) one or more targets, preferably the targets are active ingredients such as drugs, diagnostic agents, biomarkers, vaccines, nutrients, or cosmetic active ingredients, and preferably in a free, salt, hydrate, or solvate form.

This disclosure relates to polyethylene glycol (PEG) -functionalized nanoparticles comprising a functional agent, and preparation methods, properties and applications thereof. The nanoparticle represented by PEG-L-G / P, comprising a type of hydrophilic PEG, a hydrophobic functional agent G, which are covalently linked by L: a linker or a chemical bond, and a type of hydrophobic polymer P. The G and P form the hydrophobic core, while the PEG constitutes the hydrophilic outer layer of the nanoparticle in an aqueous medium. The functional agent comprises one or more functional compounds including a therapeutic drug, an imaging diagnostic agent, a photoelectric responsive diagnostic agent, an immune-stimulating agent, or a combination thereof. The nanoparticles comprising such functional agent can offer various applications in multiple biomedical fields.

Disclosed herein are devices and methods for isolation and analysis of exosomal molecules from cell DNA samples. Such devices and methods facilitate isolation of ecDNA for downstream applications, such as cellular analysis and design of probes or therapeutic agents, in order to detect or target ecDNA for degradation or cells carrying ecDNA. Similarly, disclosed herein are compositions enriched for ecDNA and their use in the development of therapeutic or diagnostic agents.

A diagnostic agent for pancreatic cancer, the diagnostic agent comprising: a primer set for amplifying SLC12A7 DNA or mRNA in a sample derived from a subject; and / or a probe that binds to the SLC12A7 DNA, mRNA or an amplification product thereof, or an antibody that binds to SLC12A7 protein. An anti-pancreatic cancer agent comprising an SLC12A7 inhibitor as an active ingredient.

The present disclosure provides a nanobody platform having a high affinity purification on protein A, wherein the nanobodies may incorporate diverse bioactive peptides, lipid or glycoside in its CDR1 and / or CDR3 regions. The present disclosure also provides a peptide-modified nanobody comprising non-toxic bioactive peptides and that exhibit potent anti-tumor activity. Moreover, the peptide-modified nanobody is able to be combined with other technologies, such as but not limited to bispecific antibodies and antibody-drug conjugates. Further, the present disclosure also provides production processes of the nanobodies and their use as a treatment and diagnostic agents.

The present invention relates to agents and methods for targeted delivery of a payload to a cell. The payload comprises various molecules, such as therapeutic or diagnostic agents, in particular toxins, immunomodulators or radiodiagnostic agents. In some embodiments, the invention relates to providing a subject with a compound comprising a payload moiety and at least two tags (tag conjugates) and a compound (docking compound) that binds to the tags of the tag conjugates and a target antigen (e.g., a cell surface antigen on a target cell).

The invention relates to the technical field of vehicle diagnosis, and discloses a multi-core chip, a vehicle diagnosis method and a vehicle diagnostic agent.The multi-core chip comprises a first kernel, a second kernel and a third kernel, the first kernel is used for establishing encrypted communication connection with a mobile terminal, and the second kernel is used for establishing encrypted communication connection with the mobile terminal; receiving a configuration data packet required by vehicle diagnosis from the mobile terminal; the second kernel is used for sending a diagnosis instruction to the vehicle-mounted control unit based on the configuration data packet, collecting diagnosis data as diagnosed information, and returning the diagnosed information to the mobile terminal through the first kernel; and the third kernel is used for establishing a bidirectional encryption channel between the first kernel and the second kernel by using the first communication key distributed to the first kernel and the second communication key distributed to the second kernel. The safety, the integration level and the communication efficiency of the vehicle diagnosis system are remarkably improved.

The application relates to the field of biomedical technology, and discloses a diagnostic agent for identifying melanoma molecular subtype typing and application, wherein the diagnostic agent comprises a first antibody specifically combined with a SOX10 protein and a second antibody specifically combined with an EGR1 protein; the diagnostic agent can be applied to preparation of a diagnostic product for evaluating the prognostic effect of a melanoma patient, preparation of a diagnostic product for predicting the treatment sensitivity of melanoma to a BRAF inhibitor, and preparation of a diagnostic product for guiding an individualized treatment scheme of melanoma. The diagnostic agent for melanoma molecular subtype typing can be directly transformed into clinical practice, and can assist in realizing real individualized treatment.

The present invention relates to a bispecific anti-tumor antigen / anti-HSG antibody having screened light and heavy chain variable domains, which is capable of improving the pre-targeting of tumors for the specific delivery of therapeutic or diagnostic agents. The antibodies have a significant affinity for tumor antigens and stay at desired sites for a sufficient time. Antibodies that do not bind to the antigen can be rapidly cleared from the body, minimizing exposure of normal tissue. A humanized anti-HSG antibody is bound to each of a group containing histamine-succinyl-glycine (HSG) and a tumor antigen with high affinity. The bispecific antibodies can be further Fc silenced, resulting in additional properties, such as reduced binding to Fc [gamma] R and FcRn, thereby modulating effector function and regulating half-life. These antibodies are useful in the diagnosis and treatment of subjects suffering from malignancies.

The present invention relates to the field of biomedicine and antibody engineering. Specifically, it relates to mono and multispecific multivalent single chain polypeptide molecules and derivatives thereof, preferably to multispecific single chain (tandem) trimerbodies with defined stoichiometry, to nucleic acid sequences and vectors encoding thereof, and host cells expressing the same. It further relates to methods of producing thereof, pharmaceutical compositions, kits, methods of treatment, use as diagnostics or imaging reagents and combination therapies using thereof.

A major obstacle in the field of biotherapeutics is the need for platform technologies that enable high bioavailability and long-term therapeutic exposure of biotherapies in localized disease. Traditional approaches result in problematic trade-offs, such as toxicity and off-target side effects. The present disclosure provides compounds comprising follistatin domain 1 (FSD1) of follistatin (FST), which can bind to biological structures, such as the extracellular matrix, via heparan sulfate without the undesired neutralizing effects on the activity of activin A, myostatin, and GDF11, as full-length follistatin does. The present invention relates to fusion or conjugated proteins, compositions thereof, constructs or vectors encoding them, their medical uses, and methods for biotherapeutics.

The present disclosure concerns a new polypeptide and fusion proteins which comprise said new polypeptide which bind to Human Epidermal Growth Factor Receptor 2 (in the following referred to as HER2), said new polypeptide comprising the amino acid sequence: EMRNAYWEIALLPNLTNQQKRAFIRKLYDDPSQSSELLSEAKKLNDSQAPEPE The present disclosure also relates to use of such a HER2‐binding polypeptide or fusion proteins as a diagnostic agent, prognostic agent, theranostic agent and / or medicament, more particularly use thereof in the diagnosis, prognosis and / or treatment of forms of cancer characterized by over‐expression of HER2.

The present disclosure provides a carborane-phospholipid conjugate which incorporates a carborane group at the end of one of the lipid arms of a phospholipid. The present disclosure also provides liposomal compositions comprising such carborane-phospholipid conjugates and their use for the delivery of at least one therapeutic agent and / or at least one diagnostic agent.

The application belongs to the technical field of power equipment fault diagnosis, and particularly relates to a diagnostic agent suitable for overheat fault early warning of power oil-filled equipment. R The main body skeleton is in a configuration or S The main body skeleton is in a configuration or 1 R is hydrogen, aryl or alkyl; R 2 R is hydrogen, aryl or alkyl; R 2 R is alkyl. The application has the following beneficial effects: the diagnostic agent can be applied to the field of power equipment fault early warning; the early warning mechanism is based on low-energy barrier response, and early fault warning can be realized; the diagnostic principle is based on atropisomerism effect, the reaction path is clear, and a quantitative analysis model can be easily established; the diagnostic agent has good compatibility with insulating oil, insulating paper and metal materials, and does not affect normal operation of the equipment.

This invention provides drugs and methods for the targeted delivery of payloads to cells. These drugs and methods are useful for delivering therapeutic or diagnostic agents to target cells. [Solution] In one embodiment, the present invention includes the step of administering RNA encoding a peptide or polypeptide (docketing compound) comprising a binding portion that binds to a target cell (primary targeting portion) and a further binding portion (secondary target) that binds to a drug comprising a payload (effector probe). After RNA expression, the primary targeting portion may bind to a target antigen such as a cancer antigen on a cancer cell, and then the secondary targeting portion contained in the effector probe may target the secondary target, thereby accurately delivering the "payload" to the target cell such as a cancer cell.

The invention belongs to the technical field of power equipment fault diagnosis, and particularly relates to a preparation method of a fault diagnosis agent for transformer insulating oil. The preparation method comprises the following steps: mixing a phenolic compound, a halogenated hydrocarbon compound, alkali and a solvent, carrying out a stirring reaction, and carrying out optional cooling, optional filtering, optional filtrate concentration and optional purification to obtain the fault diagnosis agent. The preparation method of the fault diagnosis agent provided by the invention is simple in reaction steps, does not need complex equipment and is easy to industrialize; cheap and easily available raw materials are used, no catalyst is used, and the cost is low; the reaction conditions are mild, the safety is high, and the method is environment-friendly; and the product has high purity and good compatibility with insulating oil.

Disclosed are methods for delivering a therapeutic or diagnostic agent to the cytosol of a cell in a subject. The disclosed methods generally include administering to the subject an effective amount of a lipid nanoparticle comprising the therapeutic or diagnostic agent and an effective amount of a membrane-destabilizing polymer. Also disclosed are related compositions and delivery systems.

This application relates to the field of computer technology and provides a method and related equipment for optimizing a diagnostic agent. The method acquires multi-turn dialogue data and diagnostic results from interactions between the diagnostic agent and the user; performs multi-dimensional review of the multi-turn dialogue data and diagnostic results to obtain a target review result; and generates standardized rule patch prompts based on the target review result. The rule patch prompts are incrementally appended to the current main prompts of the diagnostic agent to optimize the agent in real time. When the accumulation of rule patch prompts meets a preset trigger threshold, the appended rule patch prompts are fused with the main prompts to generate new main prompts for optimizing the diagnostic agent. By incrementally appending standardized patches, real-time error blocking and correction are achieved. The introduction of a periodic fusion mechanism based on a preset trigger threshold enables the diagnostic agent to possess adaptive evolution capabilities.

Articles, compositions, kits, and methods relating to nanostructures, including synthetic nanostructures, are provided. Certain embodiments described herein include structures having a core-shell type arrangement; for instance, a nanostructure core may be surrounded by a shell including a material, such as a lipid bilayer, and may include other components such as oligonucleotides. In some embodiments, the structures, when introduced into a subject, can be used to deliver nucleic acids and / or can regulate gene expression. Accordingly, the structures described herein may be used to diagnose, prevent, treat or manage certain diseases or bodily conditions. In some cases, the structures are both a therapeutic agent and a diagnostic agent.

This application relates to the field of computer technology and provides a method and related equipment for generating intelligent agents for diagnosis. The method generates a virtual object containing temporal pathological feature data based on a preset disease evolution template; controls an initial diagnostic agent to interact with the virtual object in multiple rounds to obtain a temporal diagnostic strategy output by the initial diagnostic agent; generates feedback results for the initial diagnostic agent based on the diagnostic strategy and the target diagnostic scheme corresponding to the virtual object; and optimizes the parameters of the initial diagnostic agent based on the feedback results to generate a target diagnostic agent. By constructing a disease evolution template, this application can generate virtual patient data with continuous temporal features at low cost and on a large scale, enabling the diagnostic agent to be exposed to the complete disease progression logic from the latent stage to the critical stage during the training phase, thereby improving the model's generalization ability.

The present disclosure relates to ureido ligands targeting PSMA comprising a moiety targeting PSMA, a linker, and a pyridazine moiety. The disclosed PSMA-targeted ureido ligands are suitable for use as radiopharmaceuticals, as imaging agents (e.g., diagnostic agents), or for the treatment of prostate cancer, or as diagnostic agents.

Provided is a method for constructing a nanobody-encoding DNA library. The method comprises: using an immunogen to screen peripheral blood mononuclear cells (PBMCs) of an animal to obtain positive cells specifically binding to the immunogen; and amplifying nucleic acid samples derived from the positive cells to obtain a nanobody-encoding DNA library, wherein the nanobody is a nanobody specifically binding to the immunogen, and wherein the amplifying comprises using one or more groups of primer pairs, and each group of primer pairs among the one or more groups of primer pairs comprises one or more forward primers and one or more reverse primers. In the present invention, a large number of diverse DNA sequences containing a large number of low-abundance sequences are obtained. A high-throughput sequencing-based technical route for rapid preparation of a VHH antibody allows for efficient and rapid acquisition of the VHH antibody having high affinity and high specificity, thereby satisfying a raw material requirement of a high-quality diagnostic agent.

Described herein are 1,2-dioxetane dimers that are useful as chemiluminescent probes, diagnostic agents, and imaging agents. Also described herein are compositions containing such compounds and methods of using the same.

This invention relates to the technical field of programming task code generation methods based on multi-agent collaboration and iterative reasoning. Specifically, it discloses a method for generating programming task code based on multi-agent collaboration and iterative reasoning, comprising: obtaining a task description with a primary-secondary functional dependency structure; generating initial code by a generating agent based on a dependency-guided thought chain and performing static structure verification; collecting runtime execution trajectories in an isolated sandbox through dynamic agents; having a diagnostic agent attribute errors to the trajectories, distinguishing between inter-function collaboration errors and intra-function logic errors, and generating structured repair guidance; and combining historical perception feedback and a controlled reset mechanism to guide subsequent iterative repairs and avoid local optima. This invention solves the problems of ambiguous error location, easy code degradation, and low repair efficiency in existing code generation methods for multi-functional dependency tasks, achieving accurate error attribution, preventing code rollback, and improving generation success rate and repair convergence efficiency.

Compositions and methods are disclosed for targeted treatment of lung cancer-derived metastatic brain tumors. In particular, tumor targeting agents comprising targeting peptides are disclosed that can target a payload, such as a therapeutic or diagnostic agent, to lung cancer-derived metastatic brain tumors. Chimeric antigen receptor (CAR) polypeptides are disclosed that can be used with adoptive cell transfer to target and kill lung cancer-derived metastatic brain tumors.

Hemicyanine-based compounds having optoacoustic properties and methods of their use as imaging and diagnostic agents and as conjugates with targeting and / or drug compounds.