72 results about "Diagnostic agent" patented technology

This disclosure relates to polyethylene glycol (PEG) -functionalized nanoparticles comprising a functional agent, and preparation methods, properties and applications thereof. The nanoparticle represented by PEG-L-G / P, comprising a type of hydrophilic PEG, a hydrophobic functional agent G, which are covalently linked by L: a linker or a chemical bond, and a type of hydrophobic polymer P. The G and P form the hydrophobic core, while the PEG constitutes the hydrophilic outer layer of the nanoparticle in an aqueous medium. The functional agent comprises one or more functional compounds including a therapeutic drug, an imaging diagnostic agent, a photoelectric responsive diagnostic agent, an immune-stimulating agent, or a combination thereof. The nanoparticles comprising such functional agent can offer various applications in multiple biomedical fields.

A diagnostic agent for pancreatic cancer, the diagnostic agent comprising: a primer set for amplifying SLC12A7 DNA or mRNA in a sample derived from a subject; and / or a probe that binds to the SLC12A7 DNA, mRNA or an amplification product thereof, or an antibody that binds to SLC12A7 protein. An anti-pancreatic cancer agent comprising an SLC12A7 inhibitor as an active ingredient.

The present disclosure provides a nanobody platform having a high affinity purification on protein A, wherein the nanobodies may incorporate diverse bioactive peptides, lipid or glycoside in its CDR1 and / or CDR3 regions. The present disclosure also provides a peptide-modified nanobody comprising non-toxic bioactive peptides and that exhibit potent anti-tumor activity. Moreover, the peptide-modified nanobody is able to be combined with other technologies, such as but not limited to bispecific antibodies and antibody-drug conjugates. Further, the present disclosure also provides production processes of the nanobodies and their use as a treatment and diagnostic agents.

The present invention relates to agents and methods for targeted delivery of a payload to a cell. The payload comprises various molecules, such as therapeutic or diagnostic agents, in particular toxins, immunomodulators or radiodiagnostic agents. In some embodiments, the invention relates to providing a subject with a compound comprising a payload moiety and at least two tags (tag conjugates) and a compound (docking compound) that binds to the tags of the tag conjugates and a target antigen (e.g., a cell surface antigen on a target cell).

The invention relates to the technical field of vehicle diagnosis, and discloses a multi-core chip, a vehicle diagnosis method and a vehicle diagnostic agent.The multi-core chip comprises a first kernel, a second kernel and a third kernel, the first kernel is used for establishing encrypted communication connection with a mobile terminal, and the second kernel is used for establishing encrypted communication connection with the mobile terminal; receiving a configuration data packet required by vehicle diagnosis from the mobile terminal; the second kernel is used for sending a diagnosis instruction to the vehicle-mounted control unit based on the configuration data packet, collecting diagnosis data as diagnosed information, and returning the diagnosed information to the mobile terminal through the first kernel; and the third kernel is used for establishing a bidirectional encryption channel between the first kernel and the second kernel by using the first communication key distributed to the first kernel and the second communication key distributed to the second kernel. The safety, the integration level and the communication efficiency of the vehicle diagnosis system are remarkably improved.

The application relates to the field of biomedical technology, and discloses a diagnostic agent for identifying melanoma molecular subtype typing and application, wherein the diagnostic agent comprises a first antibody specifically combined with a SOX10 protein and a second antibody specifically combined with an EGR1 protein; the diagnostic agent can be applied to preparation of a diagnostic product for evaluating the prognostic effect of a melanoma patient, preparation of a diagnostic product for predicting the treatment sensitivity of melanoma to a BRAF inhibitor, and preparation of a diagnostic product for guiding an individualized treatment scheme of melanoma. The diagnostic agent for melanoma molecular subtype typing can be directly transformed into clinical practice, and can assist in realizing real individualized treatment.

The present invention relates to the field of biomedicine and antibody engineering. Specifically, it relates to mono and multispecific multivalent single chain polypeptide molecules and derivatives thereof, preferably to multispecific single chain (tandem) trimerbodies with defined stoichiometry, to nucleic acid sequences and vectors encoding thereof, and host cells expressing the same. It further relates to methods of producing thereof, pharmaceutical compositions, kits, methods of treatment, use as diagnostics or imaging reagents and combination therapies using thereof.

The present disclosure concerns a new polypeptide and fusion proteins which comprise said new polypeptide which bind to Human Epidermal Growth Factor Receptor 2 (in the following referred to as HER2), said new polypeptide comprising the amino acid sequence: EMRNAYWEIALLPNLTNQQKRAFIRKLYDDPSQSSELLSEAKKLNDSQAPEPE The present disclosure also relates to use of such a HER2‐binding polypeptide or fusion proteins as a diagnostic agent, prognostic agent, theranostic agent and / or medicament, more particularly use thereof in the diagnosis, prognosis and / or treatment of forms of cancer characterized by over‐expression of HER2.

The present disclosure provides a carborane-phospholipid conjugate which incorporates a carborane group at the end of one of the lipid arms of a phospholipid. The present disclosure also provides liposomal compositions comprising such carborane-phospholipid conjugates and their use for the delivery of at least one therapeutic agent and / or at least one diagnostic agent.

The application belongs to the technical field of power equipment fault diagnosis, and particularly relates to a diagnostic agent suitable for overheat fault early warning of power oil-filled equipment. R The main body skeleton is in a configuration or S The main body skeleton is in a configuration or 1 R is hydrogen, aryl or alkyl; R 2 R is hydrogen, aryl or alkyl; R 2 R is alkyl. The application has the following beneficial effects: the diagnostic agent can be applied to the field of power equipment fault early warning; the early warning mechanism is based on low-energy barrier response, and early fault warning can be realized; the diagnostic principle is based on atropisomerism effect, the reaction path is clear, and a quantitative analysis model can be easily established; the diagnostic agent has good compatibility with insulating oil, insulating paper and metal materials, and does not affect normal operation of the equipment.

The invention belongs to the technical field of power equipment fault diagnosis, and particularly relates to a preparation method of a fault diagnosis agent for transformer insulating oil. The preparation method comprises the following steps: mixing a phenolic compound, a halogenated hydrocarbon compound, alkali and a solvent, carrying out a stirring reaction, and carrying out optional cooling, optional filtering, optional filtrate concentration and optional purification to obtain the fault diagnosis agent. The preparation method of the fault diagnosis agent provided by the invention is simple in reaction steps, does not need complex equipment and is easy to industrialize; cheap and easily available raw materials are used, no catalyst is used, and the cost is low; the reaction conditions are mild, the safety is high, and the method is environment-friendly; and the product has high purity and good compatibility with insulating oil.

This application relates to the field of computer technology and provides a method and related equipment for optimizing a diagnostic agent. The method acquires multi-turn dialogue data and diagnostic results from interactions between the diagnostic agent and the user; performs multi-dimensional review of the multi-turn dialogue data and diagnostic results to obtain a target review result; and generates standardized rule patch prompts based on the target review result. The rule patch prompts are incrementally appended to the current main prompts of the diagnostic agent to optimize the agent in real time. When the accumulation of rule patch prompts meets a preset trigger threshold, the appended rule patch prompts are fused with the main prompts to generate new main prompts for optimizing the diagnostic agent. By incrementally appending standardized patches, real-time error blocking and correction are achieved. The introduction of a periodic fusion mechanism based on a preset trigger threshold enables the diagnostic agent to possess adaptive evolution capabilities.

Articles, compositions, kits, and methods relating to nanostructures, including synthetic nanostructures, are provided. Certain embodiments described herein include structures having a core-shell type arrangement; for instance, a nanostructure core may be surrounded by a shell including a material, such as a lipid bilayer, and may include other components such as oligonucleotides. In some embodiments, the structures, when introduced into a subject, can be used to deliver nucleic acids and / or can regulate gene expression. Accordingly, the structures described herein may be used to diagnose, prevent, treat or manage certain diseases or bodily conditions. In some cases, the structures are both a therapeutic agent and a diagnostic agent.

This application relates to the field of computer technology and provides a method and related equipment for generating intelligent agents for diagnosis. The method generates a virtual object containing temporal pathological feature data based on a preset disease evolution template; controls an initial diagnostic agent to interact with the virtual object in multiple rounds to obtain a temporal diagnostic strategy output by the initial diagnostic agent; generates feedback results for the initial diagnostic agent based on the diagnostic strategy and the target diagnostic scheme corresponding to the virtual object; and optimizes the parameters of the initial diagnostic agent based on the feedback results to generate a target diagnostic agent. By constructing a disease evolution template, this application can generate virtual patient data with continuous temporal features at low cost and on a large scale, enabling the diagnostic agent to be exposed to the complete disease progression logic from the latent stage to the critical stage during the training phase, thereby improving the model's generalization ability.

The present disclosure relates to ureido ligands targeting PSMA comprising a moiety targeting PSMA, a linker, and a pyridazine moiety. The disclosed PSMA-targeted ureido ligands are suitable for use as radiopharmaceuticals, as imaging agents (e.g., diagnostic agents), or for the treatment of prostate cancer, or as diagnostic agents.

Provided is a method for constructing a nanobody-encoding DNA library. The method comprises: using an immunogen to screen peripheral blood mononuclear cells (PBMCs) of an animal to obtain positive cells specifically binding to the immunogen; and amplifying nucleic acid samples derived from the positive cells to obtain a nanobody-encoding DNA library, wherein the nanobody is a nanobody specifically binding to the immunogen, and wherein the amplifying comprises using one or more groups of primer pairs, and each group of primer pairs among the one or more groups of primer pairs comprises one or more forward primers and one or more reverse primers. In the present invention, a large number of diverse DNA sequences containing a large number of low-abundance sequences are obtained. A high-throughput sequencing-based technical route for rapid preparation of a VHH antibody allows for efficient and rapid acquisition of the VHH antibody having high affinity and high specificity, thereby satisfying a raw material requirement of a high-quality diagnostic agent.

Described herein are 1,2-dioxetane dimers that are useful as chemiluminescent probes, diagnostic agents, and imaging agents. Also described herein are compositions containing such compounds and methods of using the same.

This invention relates to the technical field of programming task code generation methods based on multi-agent collaboration and iterative reasoning. Specifically, it discloses a method for generating programming task code based on multi-agent collaboration and iterative reasoning, comprising: obtaining a task description with a primary-secondary functional dependency structure; generating initial code by a generating agent based on a dependency-guided thought chain and performing static structure verification; collecting runtime execution trajectories in an isolated sandbox through dynamic agents; having a diagnostic agent attribute errors to the trajectories, distinguishing between inter-function collaboration errors and intra-function logic errors, and generating structured repair guidance; and combining historical perception feedback and a controlled reset mechanism to guide subsequent iterative repairs and avoid local optima. This invention solves the problems of ambiguous error location, easy code degradation, and low repair efficiency in existing code generation methods for multi-functional dependency tasks, achieving accurate error attribution, preventing code rollback, and improving generation success rate and repair convergence efficiency.

Hemicyanine-based compounds having optoacoustic properties and methods of their use as imaging and diagnostic agents and as conjugates with targeting and / or drug compounds.

1. Name of the product in this design: Microcatheter. 2. Purpose of this design: This design is used to introduce implantable devices, interventional devices, diagnostic agents or therapeutic agents into the human body or animal body, or to output substances from the human body or animal body. 3. The key design feature of this product is its shape. 4. The image or photograph that best illustrates the key design points: Design 1 3D view. 5. Design 1 is designated as the basic design. 6. Other situations requiring explanation: In Design 1, the handle part A is made of transparent material; in Design 2, the part drawn with red lines in the reference figure is made of transparent material, and the internal structure B can be seen through the transparent part.

The design, synthesis, and functionalization of a conjugate including a tumor-targeting near-infrared (NIR) dye and a therapeutic agent and / or a diagnostic agent, whereby the NIR dye can function to target the therapeutic agent and / or diagnostic agent to tumor cells.

The invention provides particles, compositions including the particles, and methods of making the particles using electrospray. In certain embodiments, the particles allow for high concentrations of a therapeutic or diagnostic agent to be delivered at low viscosity. Particles may also exhibit beneficial properties with respect to stability.

A self-diagnosis and self-repair intelligent coating based on microfluidic technology and a preparation method thereof are provided. Microcapsules are prepared by combining microfluidic T-junction and interfacial polymerization. The wall material of the microcapsules is made of polyurea, and the core material is made of diagnostic agent, repair agent and photoinitiator. Self-diagnosis and self-repair microcapsules are evenly distributed in the coating with silicone resin as matrix.

Provided herein are compounds for the delivery of one or more radiotherapy or radiodiagnostic agents. In some embodiments, the compounds have a radioagent binding moiety (RBM) linked to a GRPR binding moiety (GBM) via a linker (RBM-L-GBM) wherein at least one of L and GBM is optionally substituted by an albumin binding moiety (ABM). In some embodiments, the one or more therapeutic or diagnostic agents are delivered to cancer cells.

The disclosure provides for lipids that may be formulated in a delivery vehicle to facilitate the encapsulation of a wide range of single or multiple payloads including therapeutic, theragnostic, preventive, prophylactic, pre-emptive, and diagnostic agents, such as, without limitation, nucleic acids (e.g., RNA or DNA), proteins, peptides, and small molecule active pharmaceutical ingredients (APIs). Methods of delivering and / or producing a polypeptide of interest in a cell are also provided.

The present disclosure provides a nanobody platform having a high affinity purification on protein A, wherein the nanobodies may incorporate diverse bioactive peptides, lipid or glycoside in its CDR1 and / or CDR3 regions. The present disclosure also provides a peptide-modified nanobody comprising non-toxic bioactive peptides and that exhibit potent anti-tumor activity. Moreover, the peptide-modified nanobody is able to be combined with other technologies, such as but not limited to bispecific antibodies and antibody-drug conjugates. Further, the present disclosure also provides production processes of the nanobodies and their use as a treatment and diagnostic agents.

Provided herein are methods of preparing a sample for testing. In various embodiments, methods of the present disclosure comprise providing a composition comprising particles suspended in a non-aqueous carrier liquid, wherein the particles comprise a therapeutic or diagnostic agent; separating the particles from the carrier liquid in the composition; and dissolving the particles in an aqueous liquid to prepare a sample for testing, wherein the sample is not an emulsion.

Single-domain antibodies that bind receptor tyrosine kinase (ROR1) are described. The single-domain antibodies can be used for multiple purposes including in research, imaging, diagnosis, and treatment of ROR1-related conditions. The disclosed single-domain antibodies can be used as anti-cancer therapeutics such as antibody-drug conjugates, multi-domain binding molecules, or recombinant receptors or can be used as cancer imaging / diagnostic agents.

The present application relates to a method for diagnosing pancreatic function, comprising: a step of administering to a subject a diagnostic agent for pancreatic function containing a compound represented by general formula (1-0) as an effective ingredient; a step of detecting the compound (1-0) accumulated in the pancreas; and a step of quantitatively analyzing the amount of the compound (1-0) accumulated in the pancreas. [In general formula (1-0), R represents -O(CH2) n -, -O(CH2) n OC2H4-, -CH2O(CH2) n - or -CH2O(CH2) n OC2H4-, n represents an integer of 1 to 5, and Q 1 represents F or -OCH3.]