Sustained transgene expression of modified ERT2 peptide-suicide protein fusion polypeptides

HK40134870APending Publication Date: 2026-07-10SENTI BIOSCI INC +1
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
HK62026124340
Authority / Receiving Office
HK · HK
Patent Type
Applications
Current Assignee / Owner
Priority Date
2023-05-12
Filing Date
2026-06-04
Publication Date
2026-07-10

AI Technical Summary

Technical Problem

Existing cell and gene therapy products lack functional control, leading to safety concerns such as toxicity issues during treatment, especially regarding safety and selectivity after conversion into differentiated cells.

Method used

A technical approach is employed: a technical approach is designed to introduce a novel cell and gene therapy product into cell and gene therapy, an improved method for functional control, by introducing a novel cell and gene therapy product, utilizing an improved ERT2 gene system to achieve sensitivity and selectivity control of synthetic ligands, and providing a regulated cell death system as a safety mechanism to address adverse events of cell or gene therapy.

Benefits of technology

This technology enables safety control of cell and gene therapies. By introducing an improved ERT2 gene system, it provides a regulated cell death system, which solves the safety and selectivity issues in existing technologies and ensures safety and efficacy in clinical applications.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 00000000_0000_ABST
    Figure 00000000_0000_ABST
Patent Text Reader

Abstract

Provided herein are targeting constructs for sustained transgene expression of inducible cell death systems that include mutants of estrogen receptor alpha ligand binding domain (ER-LBD). Also provided are methods for use of the same, such as inducing cell death in a cell.
Need to check novelty before this filing date? Find Prior Art

Description

(12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) ™ (19) World Intellectual Property SS Organization LAY TAAA TA A A A A International Bureau —) (10) International Publication Number (43) International Publication Date. = =~ WO 2024 / 163957 Al 08 August 2024 (08.08.2024) WIPO|PCT (51) International Patent Classification: THERAPEUTICS LP, 238 Main Street, Floor 3, Cam- A61K 31 / 138 (2006.01) CI2N 15 / 62 (2006.01) bridge, Massachusetts 02142 (US). MCAULIFFE, Conor; A61K 35 / 12 (2015.01) CI2N 15 / 90 (2006.01) c / o BLUEROCK THERAPEUTICS LP, 238 Main Street, CO07K 14 / 47 (2006.01) CI2N 5 / 10 (2006.01) Floor 3, Cambridge, Massachusetts 02142 (US). CUTK 1678 200001) 12092220601) ay) Agent, LANGE, Kein etal; Goodwin Procter LLP CI2N 15 / 113 (2010 01) , 100 Northern Avenue, IP DOCKETING DEPT. / 7TH FL, ‘ Boston, Massachusetts 02210 (US). (21) International Application ser ct / U$2024 / 014331 (81) Designated States (unless otherwise indicated, for every kind of national protection available); AE, AG, AL, AM, (22) International Filing Date: AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, BZ, 02 February 2024 (02.02.2024) CA, CH, CL, CN, CO, CR, CU, CV, CZ, DE, DJ, DK, DM, (25) Filing Language: English DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, B Manguage: 6 HN, HR, HU, ID, IL, IN, IQ, IR, IS, IT, JM, JO, JP, KE, KG, (26) Publication Language: English KH, KN, KP, KR, KW, KZ, LA, LC, LK, LR, LS, LU, LY, 30) Prioritv Data: MA, MD, MG, MK, MN, MU, MW, Mx, MY, MZ, NA, “” 63 / 482 987 02 Feb 2023 (02.02.2023 S NG, NL NO, NZ, OM, PA, PE, PG, PH, PL, PT, QA, RO, oo lee tse My han nies Co ‘3 003 ) 5 : RS, RU, RW, SA, SC, SD, SE, SG, SK, SL, ST, SV, SY, TH, ay 2023 (12.05.2023) TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, WS, (71) Applicants: SENTI BIOSCIENCES, INC. [US / US]; 2 ZA, ZM, ZW. — Corporate Drive, First Floor, South San Francisco, Cali- . og, ; ° j > (84) Designated States (unless otherwise indicated, for every _—— fornia 94080 (US). BLUEROCK THERAPEUTICS LP kind of regional protection available): ARIPO (BW, CV, — [US / US], 238 Main Street, Floor 3, Cambridge, Massachu- ci P tt 02142 S , ; , GH, GM, KE, LR, LS, MW, MZ, NA, RW, SC, SD, SL, ST, — setts (US). SZ, TZ, UG, ZM, ZW), Eurasian (AM, AZ, BY, KG, KZ, m= (72) Inventor; and RU, TJ, TM), European (AL, AT, BE, BG, CH, CY, CZ, === (71) Applicant: IRION, Stefan [DE / US]; West 70th Street #3, DE, DK, EE, ES, FI, FR, GB, GR, HR, HU, IE, IS, IT, LT, = New York, New York 10023 (US). LU, LV, MC, ME, MK, MT, NL, NO, PL, PT, RO, RS, SE, — SI, SK, SM, TR), OAPI (BF, BJ, CF, CG, CI, CM, GA, GN, mm (72) Inventors: COTTMAN, Rebecca Tayler; c / o SENTI GQ, GW. KM ye Te we SN, TD, TG) — BIOSCIENCES, INC., 2 Corporate Drive, First Floor, ; ; 0 eee ‘ — South San Francisco, California 94080 (US). HUNG. . —— , > Declarat der Rule 4.17: = Michelle Elizabeth; c / o SENTI BIOSCIENCES, INC.,20 en — Corporate Drive, First Floor, South San Francisco, Califor- — as to applicant's entitlement to apply for and be granted a == : > > . > tent (Rule 4.17 / (ii — TIBIOSCIENCES, INC. 2 Corporate Dave, Fits Flo x _— as fo he vpplicanr’s entitlement to claim the priority of the — _ a , > : ° li lication (Rule 4.17 / (iii South San Francisco, California 94080 (US). LU, Timothy earlier application (Rule (Hy) — Kuan-Ta; c / o SENTI BIOSCIENCES, INC., 2 Corporate Published: >= Drive, First Floor, South San Francisco, California 94080 — _ with international search report (Art. 21(3)) = (US). TOMISHIMA, Mark; c / o BLUEROCK THERA- — _ before the expiration of the time limit for amending the = PEUTICS LP, 238 Main Street, Floor 3, Cambridge, Mass- claims and to be republished in the event of receipt of — achusetts 02142 (US). SOH, Chew-Li; c / o BLUEROCK amendments (Rule 48.2(h)) == (4) Title: SUSTAINED TRANSGENE EXPRESSION OF MODIFIED ERT2 PEPTIDE-SUICIDE PROTEIN FUSION POLY PEP- m= TIDES “ = FIG. 1A — fan ©} (57) Abstract: Provided herein are targeting constructs for sustained transgene expression of inducible cell death systems that include nN mutants of estrogen receptor alpha ligand binding domain (ER-LBD). Also provided are methods for use of the same, such as inducing © cell death in a cell. WO 2024 / 163957 PCT / US2024 / 014331 SUSTAINED TRANSGENE EXPRESSION OF MODIFIED ERT2 PEPTIDE-SUICIDE PROTEIN FUSION POLYPEPTIDES 1. CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application claims the benefit of and priority to U.S. Provisional Patent Application No. 63 / 482,987, filed on February 2, 2023, and U.S. Provisional Patent Application No. 63 / 466,156, filed on May 12, 2023, the disclosures of each of which are hereby incorporated by reference in their entireties for all purposes. 2. SEQUENCE LISTING

[0002] The instant application contains a Sequence Listing XML which has been submitted electronically and is hereby incorporated by reference in its entirety. Said XML copy, created on Month XX, 20XX, is named XXXXXXX, and is XXX,XXX bytes in size. 3. BACKGROUND

[0003] Currently available cell and gene therapy products can lack control of function, which can lead to safety concerns such as toxicity in subjects that receive the therapies. Thus, additional methods of controlling and regulating these therapies are needed. 4. SUMMARY

[0004] Estrogen receptor (ER) is a ligand-dependent transcription factor that binds endogenous hormone ligands such as estrogen and estradiol. Synthetic ligands that bind to ER have been developed for treating ER-positive cancers such as ER-positive breast cancer. For example, active metabolites of the drug tamoxifen induce nuclear translocation of ER and antagonize ER in a tissue-selective manner. Tamoxifen and its active metabolites are also utilized as a tool for controlling nuclear localization in the research setting. For example, it can be desirable to engineer cell and gene therapy products with sustained transgene expression of a “kill” switch, e.g., an inducible cell death system, as a safety mechanism to address adverse events related to administration of cell or gene therapy. In the context of cell therapies or gene therapies where the administered therapeutic cells or cells transfected with a gene therapy transform from one state to another (e.g., from iPSC to a differentiated cell), it is pertinent that a kill switch is functional even after transformation. Thus, sustained transgene expression of modified ERT2-based systems with improved sensitivity to and / or selectivity for synthetic ligands would be useful for suicide-switch mediated regulated cell killing in a clinical setting.

[0005] Provided herein is a targeting construct comprising: 1 WO 2024 / 163957 PCT / US2024 / 014331 (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (i) a modified estrogen receptor ligand binding domain (ER-LBD); and (ii) a caspase 9 domain or derivative or functional fragment thereof; (c) a second homology arm corresponding to a 3' target sequence comprising second region of homology to the target genomic locus wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the modified ER-LBD comprises a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: (i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, Gi) an L391V substitution, a N413D substitution, a Q414E substitution, a $463P substitution, and a H524F substitution, (ii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, aM421L substitution, aM517A substitution, and a H524F substitution, (iv) an L354] substitution, a L391¥V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, 2 WO 2024 / 163957 PCT / US2024 / 014331 (v) an L391¥V substitution, a Q414E substitution, an N413D substitution, an $463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an MS517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354I substitution, an L384M substitution, and an H524L substitution, or (viii) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element.

[0006] Also provided herein, in various embodiments, is a targeting construct comprising: (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (1) a first modified estrogen receptor ligand binding domain (ER-LBD),; (ii) a first caspase 9 domain or derivative or functional fragment thereof; (iii) a second modified estrogen receptor ligand binding domain (ER-LBD); and (iv) a second caspase 9 domain or derivative or functional fragment thereof; (c) a second homology arm corresponding to a 3’ target sequence comprising second region of homology to the target genomic locus, wherein the first modified ER-LBD and the second modified ER-LBD each comprise an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the first modified ER-LBD and the second modified ER-LBD each independently comprise: a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: G) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a $463P substitution, and a H524L substitution, (11) an L391V substitution, a N413D substitution, a Q414E substitution, a $463P substitution, and a H524F substitution, (iii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, aM517A substitution, and a H524F substitution, Gv) an L354I 3 WO 2024 / 163957 PCT / US2024 / 014331 substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, (v) an L391V substitution, a Q414E substitution, an N413D substitution, an $463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L3541 substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354] substitution, an L384M substitution, an H524L substitution, or (viii) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element.

[0007] In some embodiments, the additional amino acid substitutions comprise: an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of (SEQ ID NO:2). In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:2. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:2. In some embodiments, the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:2.

[0008] In some embodiments, the additional amino acid substitutions comprise: an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:3. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:3. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:3. In some embodiments, the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:3.

[0009] In some embodiments, the additional amino acid substitutions comprise: an L3541 substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L 4 WO 2024 / 163957 PCT / US2024 / 014331 substitution, aM517A_ substitution, and a H524F substitution, and wherein the modified ER- LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:4. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:4. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:4. In some embodiments, the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:-4. In some embodiments, the additional amino acid substitutions comprise: an L3541 substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:5. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:5. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:5. In some embodiments, the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:5.

[0010] In some embodiments, the additional amino acid substitutions comprise: an L391V substitution, a Q414E substitution, an N413D substitution, an $463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:40. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:40. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:40. In some embodiments, the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:40.

[0011] In some embodiments, the additional amino acid substitutions comprise: an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:41. In some embodiments, 5 WO 2024 / 163957 PCT / US2024 / 014331 the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:41. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:41. In some embodiments, the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:41.

[0012] In some embodiments, the additional amino acid substitutions comprise: an N413D substitution, an S463P substitution, an L354] substitution, an L384M substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:42. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:42. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:42. In some embodiments, the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:42.

[0013] In some embodiments, the additional amino acid substitutions comprise: an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:43. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:43. In some embodiments, the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:43. In some embodiments, the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:43.

[0014] In some embodiments, the modified ERT2 peptide further comprises an N-terminal serine (S) residue.

[0015] In some embodiments, the modified ER-LBD comprises the V595A amino acid substitution.

[0016] In some embodiments, the caspase 9 domain or derivative or functional fragment thereof does not comprise a Caspase Activation and Recruitment Domain (CARD) domain 6 WO 2024 / 163957 PCT / US2024 / 014331 sequence. In some embodiments, the caspase 9 domain or derivative or functional fragment thereof comprises (SEQ ID NO:6).

[0017] In some embodiments, the modified estrogen receptor ligand binding domain (ER- LBD) is N-terminal to the caspase 9 domain or derivative or functional fragment thereof. In some embodiments, the modified estrogen receptor ligand binding domain (ER-LBD) is C- terminal to the caspase 9 domain or derivative or functional fragment thereof.

[0018] In some embodiments, the fusion polypeptide comprises a linker between the modified estrogen receptor ligand binding domain (ER-LBD) and the caspase 9 domain or derivative or functional fragment thereof.

[0019] In some embodiments, the targeting construct is configured such that upon its recombination with the target genomic locus, the STEL gene is modified such to incorporate the fusion polypeptide coding sequence 3' to the STEL protein coding sequence. In some embodiments, the targeting construct is configured such that upon its recombination with the target genomic locus, the STEL gene is modified such to incorporate the fusion polypeptide coding sequence 5' to the STEL protein coding sequence.

[0020] In some embodiments, the nucleotide insert further comprises a nucleotide sequence encoding a separator sequence. In some embodiments, the targeting construct is configured such that upon recombination of the targeting construct with the target genomic locus, the separator sequence coding sequence is positioned between the coding sequence of the STEL protein and the fusion polypeptide coding sequence. In some embodiments, the separator sequence is an internal ribosome entry site (“IRES’’). In some embodiments, the separator sequence is a self- cleaving peptide. In some embodiments, the self-cleaving peptide is a 2A peptide. In some embodiments, the self-cleaving peptide is T2A, P2A, E2A, F2A, POR, Opt2A, or Opt2A_2.0.

[0021] In some embodiments, the STEL gene encodes a polypeptide involved in one or more of: glycolysis, ribonucleopolypeptide complex formation, focal adhesion, cell-substrate adherens junction, cell-substrate junction, cell anchoring, extracellular exosome, extracellular vesicle, intracellular organelle, anchoring junction, RNA binding, nucleic acid binding (e.g., rRNA or mRNA binding), and polypeptide binding.

[0022] In some embodiments, the STEL gene encodes a ribosomal polypeptide. In some embodiments, the STEL gene is RPLI3A, RPLPO, RPL1IO, RPL13, RPSJS, RPL3, RPLP1, RPLI5, RPL41], RPLI1, RPL32, RPL1I8 A, RPL19, RPL28, RPL29, RPL9, RPLS, RPL6, RPL18, RPL7, RPL7A, RPL21, RPL37A, RPL 12, RPLS, RPL34, RPL35A, RPL30, RPL24, RPL39, RPL37, RPL14, RPL27A, RPLP2, RPL23A, RPL26, RPL36, RPL35, RPL23, RPL4, or RPL22. 7 WO 2024 / 163957 PCT / US2024 / 014331

[0023] In some embodiments, the STEL gene encodes a ribosomal polypeptide small subunit (RPS). In some embodiments, the STEL gene is RPS2, RPS19, RPS14, RPS3A, RPS12, RPS3, RPS6, RPS23, RPS27A, RPSS, RPS4X, RPS7, RPS24, RPS27, RPSISA, RPS9, RPS28, RPS13, RPSA, RPS5, RPS 16, RPS25, RPS15, RPS20, or RPS / 1.

[0024] In some embodiments, the STEL gene encodes a mitochondrial polypeptide. In some embodiments, the STEL gene is MT-CO1, MT-CO2, MT-ND4, MT-ND1, or MT-ND2.

[0025] In some embodiments, the STEL gene encodes an actin polypeptide. In some embodiments, the STEL gene is ACTG1 or ACTB.

[0026] In some embodiments, STEL gene encodes a eukaryotic translation factor. In some embodiments, the STEL gene is EEF1A1, EEF2, or EIF1.

[0027] In some embodiments, the STEL gene encodes a histone. In some embodiments, the STEL gene is H3F3A or H3F3B.

[0028] In some embodiments, the STEL gene is FTL, FTH1, TPT1, IMSB10, GAPDH, PTMA, GNB2L1, NACA, YBX1, NPM1, FAU, UBA52, HSP90AB1, MYL6, SERF2, or SRP 14. In some embodiments, the STEL gene is GAPDH.

[0029] In some embodiments, the STEL gene is RPLI3A. In some embodiments, the STEL gene is RPL7. In some embodiments, the STEL gene is RPLPO.

[0030] In some embodiments, the nucleotide insert further comprises a transgene. In some embodiments, the transgene is linked to the fusion polypeptide coding sequence. In some embodiments, the fusion polypeptide coding sequence and transgene are connected via a nucleotide sequence encoding a separator sequence. In some embodiments, the separator sequence is an internal ribosome entry site (‘IRES’’). In some embodiments, the separator sequence is a nucleotide sequence encoding a self-cleaving peptide (the “self-cleaving peptide coding sequence’). In some embodiments, the self-cleaving peptide is a 2A peptide. In some embodiments, the self-cleaving peptide is T2A, P2A, E2A, F2A, POR, Opt2A, or Opt2A_2.0. In some embodiments, the transgene encodes a therapeutic polypeptide.

[0031] Provided herein is a system comprising: (a) the targeting construct disclosed herein; (b) a CRISPR-associated endonuclease (“Cas polypeptide”) or a nucleic acid encoding a Cas polypeptide; and (c) a guide RNA (“gRNA”) comprising a scaffold for binding the Cas polypeptide and a spacer sequence corresponding to the STEL gene, or a nucleic acid encoding the gRNA. 8 WO 2024 / 163957 PCT / US2024 / 014331

[0032] In some embodiments, the guide RNA is a single guide RNA (“sgRNA”). In some embodiments, the system comprises the Cas polypeptide and gRNA. In some embodiments, the system is in the form of a ribonucleoprotein particle (“RNP”).

[0033] Provided herein is a method of producing a gene-edited target cell, comprising: (a) introducing the system of disclosed herein into a target cell; and (b) culturing the target cell under conditions in which gene editing occurs, thereby producing gene-edited target cell.

[0034] In some embodiments, the target cell is a stem cell or a cell differentiated from a stem cell. In some embodiments, the target cell is a stem cell. In some embodiments, the stem cell is a human embryonic stem cell, an induced pluripotent stem cell (“1PSC’) or a cell differentiated therefrom. In some embodiments, the target cell is: (a) a regulatory T cell, a myeloid cell, a dendritic cell, and a macrophage (e.g., an immunosuppressive macrophage), or a precursor or progenitor cell thereof; a cell in the human nervous system, optionally selected from dopaminergic neuron, a microglial cell, an oligodendrocyte, an astrocyte, a cortical neuron, a spinal or oculomotor neuron, an enteric neuron, a Placode-derived cell, a Schwann cell, and a trigeminal or sensory neuron, or a precursor or progenitor cell thereof; a cell in the human cardiovascular system, optionally selected from a cardiomyocyte, an endothelial cell, and a nodal cell, or a precursor or progenitor cell thereof; a cell in the human metabolic system, optionally selected from a hepatocyte, a cholangiocyte, and a pancreatic beta cell, or a precursor or progenitor cell thereof, or (b) a cell in the human ocular system, optionally selected from a retinal pigment epithelial cell, a photoreceptor cone cell, a photoreceptor rod cell, a bipolar cell, a ganglion cell, or a precursor or progenitor cell thereof.

[0035] In some embodiments, the gene-edited target cell is of ectoderm lineage, optionally wherein the gene-edited target cell is a neuron. In some embodiments, the gene-edited target cell is of mesoderm lineage, optionally wherein the gene-edited target cell is a cardiomyocyte.

[0036] Provided herein is a gene-edited target cell obtained or obtainable by any one of the above methods.

[0037] Provided herein is a gene-edited target cell comprising a STEL gene that comprises a nucleic acid encoding a fusion polypeptide under the transcriptional control of a STEL gene regulatory element, the fusion polypeptide comprising: (a) a modified estrogen receptor ligand binding domain (ER-LBD); and (b) a caspase 9 domain or derivative or functional fragment thereof, wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the modified ER-LBD comprises 9 WO 2024 / 163957 PCT / US2024 / 014331 a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: Gi) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, Gi) an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution, (ii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, a M517A substitution, and a H524F substitution, (iv) an L354] substitution, a L391¥V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, (v) an L391¥V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L354I substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354I substitution, an L384M substitution, and an H524L substitution, or (viii) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution.

[0038] In some embodiments, the modified ER-LBD is as defined as provided above. In some embodiments, the caspase 9 domain or derivative or functional fragment thereof is as defined above. In some embodiments, the fusion polypeptide is as defined above. In some embodiments, the STEL gene is configured as defined above. In some embodiments, the gene- 10 WO 2024 / 163957 PCT / US2024 / 014331 edited target cell further comprises a transgene in the STEL gene. In some embodiments, the transgene is as defined above. In some embodiments, the target cell is as defined above.

[0039] Provided herein is a pharmaceutical composition comprising the gene-edited target cell as provided herein and a pharmaceutically acceptable carrier.

[0040] Provided herein is a method of treating a patient in need thereof, comprising administering to the patient the gene-edited target cell as provided herein or a pharmaceutical composition comprising the gene-edited target cell and a pharmaceutically acceptable carrier. In some embodiments, the method further comprises controlling the gene-edited target cell population in the patient by: (a) monitoring, optionally, the gene-edited target cell population in the patient; and (b) administering an inducer of the modified ER-LBD if the patient experiences adverse events related to the gene-edited target cell population.

[0041] Provided herein is a method of mitigating adverse events or a safety risk associated with cell therapy in the form of the gene-edited target cells as defined above or the pharmaceutical composition of as defined above, the method comprising administering to a patient who received the gene-edited target cells or pharmaceutical composition an inducer of a modified ER-LBD if the patient experiences adverse events or a safety risk related to the gene- edited target cells or pharmaceutical composition.

[0042] In some embodiments of the foregoing administration methods, a single inducer of the modified ER-LBD is administered. In other embodiments, a combination of two or more inducers of the modified ER-LBD are administered. In some embodiments, the inducer(s) of the modified ER-LBD comprise tamoxifen and / or a tamoxifen metabolite. In some embodiments, the inducer(s) of the modified ER-LBD comprise tamoxifen. In some embodiments, the inducer(s) of the modified ER-LBD comprise a tamoxifen metabolite. In some embodiments, the tamoxifen metabolite is 4-hydroxytamoxifen, N- desmethyltamoxifen, tamoxifen-N-oxide, or endoxifen.

[0043] In some embodiments, the targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to an amino acid sequence set forth in SEQ ID NO: 13, 15, 17, 19, 21, 23, 25, 27, 44, 46, 48, or 50. In some embodiments, the targeting construct comprises an amino acid sequence set forth in SEQ ID NO: 13, 15, 17, 19, 21, 23, 25, 27, 44, 46, 48, or 50. 11 WO 2024 / 163957 PCT / US2024 / 014331 5. BRIEF DESCRIPTION OF THE FIGURES

[0044] FIGS. 1A-1B are schematic diagrams of exemplary constructs of the disclosure, comprising a nucleic acid sequence encoding a modified ERT2 peptide-suicide protein fusion polypeptide disclosed herein flanked by sustained transcription expression locus (STEL) homology arms. FIG. 1A is an exemplary construct, which comprises from 5’ to 3’, a STEL left homology arm (LHA), a separator sequence (SS), a coding sequence for at least one modified estrogen receptor ligand binding domain (modified ER-LBD, also referred to interchangeably herein as modified ERT2 peptide), a suicide protein coding sequence for a caspase 9 domain or derivative or functional fragment thereof, and a STEL right homology arm (RHA). FIG. 1B is another exemplary construct, which comprises from 5’ to 3’, a STEL left homology arm, a separator sequence, a modified ERT2 peptide encoding sequence disclosed herein, a suicide protein coding sequence for a caspase 9 domain or derivative or functional fragment thereof (“Casp9”), an optional separator sequence, an optional transgene, and a STEL right homology arm. Modified ERT2 peptides and Caspase-9 sequences in the constructs depicted in FIGS. 1A and 1B are described in Sections 6.3.1 and 6.3.2, respectively. Although in FIGS. 1A-1B the modified ERT2 peptide coding sequence is shown 35’ to the suicide protein coding sequence and encoding a fusion polypeptide with a modified ERT2 peptide N-terminal to the suicide protein, the fusion polypeptides of the disclosure may additionally or alternatively include a modified ERT2 peptide C-terminal to the suicide protein. The modified ERT2 peptide and suicide protein sequences may be separated by a linker.

[0045] FIGS. 2A-2B are schematic diagrams of exemplary constructs of the disclosure, comprising a sequence encoding a modified ERT2 peptide-suicide protein fusion polypeptide, flanked by GAPDH homology arms, wherein the sequence encoding a modified ERT2 peptide- suicide protein fusion polypeptide comprises a modified ERT2 peptide encoding sequence disclosed herein and a suicide protein coding sequence for a caspase 9 domain or derivative or functional fragment thereof (“Casp9”). FIG. 2A is an exemplary construct, which comprises from 5’ to 3’, a GAPDH left homology arm (LHA), a T2A sequence, an ERT2 peptide sequence, a Casp9 sequence, and a GAPDH right homology arm (RHA). FIG. 2B is an exemplary construct, which comprises from 5’ to 3’, a GAPDH left homology arm, a T2A sequence, an ERT2 peptide sequence, a Casp9 sequence, and IRES, an RFP marker, and a GAPDH right homology arm. Although in FIGS. 2A-2B the ERT2 peptide coding sequence is shown 5’ to the suicide protein coding sequence and encoding a fusion polypeptide with an ERT2 peptide N-terminal to the suicide protein, the fusion polypeptides of the disclosure may additionally or alternatively include an ERT2 peptide C-terminal to the suicide protein. The ERT2 peptide and suicide protein sequences may be separated by a linker. 12 WO 2024 / 163957 PCT / US2024 / 014331

[0046] FIG. 3 is an illustration depicting the mechanism of apoptosis in cells transfected with a construct of the disclosure. In the absence of an ERT2 inducer such as tamoxifen, a modified ERT2 peptide-suicide protein fusion polypeptide of the disclosure comprising a caspase-9 peptide and ERT2, do not dimerize and remain inactive. Addition of a suitable hormone or hormone analog (e.g., tamoxifen) that binds to the modified ERT2 peptide allows dimerization of the modified ERT2 peptide-suicide protein fusion polypeptide. This dimerization activates Caspase-9, which leads to apoptosis.

[0047] FIGS. 4A-4B are graphs demonstrating targeted integration of modified ERT2 peptide-suicide protein fusion polypeptides Construct 1, Construct 2, Construct 3, and Construct 4 at GAPDH loci in the presence and absence of 4-OHT. FIG. 4A is a bar graph depicting junction GAPT2A ddPCR results in a clonal human iPSC line with a mono-allelic integration of a T2A containing construct at GAPDH or depicting pooled junction GAPT2A ddPCR results in one of the modified ERT2 peptide-suicide protein fusion polypeptide constructs, Construct | or Construct 2. FIG. 4B is a bar graph depicting junction GAPT2A ddPCR results in a clonal human iPSC line with a mono-allelic integration of a T2A containing construct at GAPDH or depicting pooled junction GAPT2A ddPCR results in one of the modified ERT2 peptide-suicide protein polypeptide constructs, Construct 3 or Construct 4.

[0048] FIGS. 5A-5B are agarose gel photographs showing targeted integration of modified ERT2 peptide-suicide protein fusion polypeptides Construct 1, Construct 2, Construct 3, and Construct 4 at GAPDH loci in a pooled human iPSC population in the presence and absence of 4-OHT. FIG. 5A shows the results of a PCR analysis of a human iPSC line edited with mono- allelic integration of a T2A containing construct at GAPDH or PCR analysis of pools of human iPSCs transfected with one of the modified ERT2 peptide-suicide protein fusion polypeptide constructs, Construct 1 or Construct 2, in the absence or presence of 4-OHT. FIG. 5B shows the results of a PCR analysis of a human iPSC line edited with mono-allelic integration of a T2A containing construct at GAPDH or PCR analysis of pools of human iPSCs transfected with one of the modified ERT2 peptide-suicide protein fusion polypeptide constructs, Construct 3 or Construct 4, in the absence or presence of 4-OHT. “Parental wt” represents data for unedited parental cells. “NTC” is ano template PCR control.

[0049] FIG. 6 is a bar graph depicting zygosity assessment of several clones via junction GAPT2A ddPCR.

[0050] FIGS. 7A-7E are images of iPSC cultures at one or two days of treatment with 1nM 4-OHT or were left untreated for the same duration. FIG. 7A panels show the images of unedited cells. FIG. 7B panels show the images of cells transfected with the modified ERT2 13 WO 2024 / 163957 PCT / US2024 / 014331 peptide-suicide protein fusion polypeptide construct, Construct 1. FIG. 7C panels show the images of cells transfected with the modified ERT2 peptide-suicide protein fusion polypeptide construct, Construct 2. FIG. 7D panels show the images of cells transfected with the modified ERT2 peptide-suicide protein fusion polypeptide construct, Construct 3. FIG. 7E panels show the images of cells transfected with the modified ERT2 peptide-suicide protein fusion polypeptide construct, Construct 4.

[0051] FIG. 8 shows cytometric dot plots demonstrating apoptotic activity in human iPSCs transfected with the modified ERT2 peptide-suicide protein fusion polypeptide construct, Construct 1, following a two-day treatment with 1nM 4-OHT.

[0052] FIG. 9 shows cytometric dot plots demonstrating lack of apoptotic activity in human iPSCs transfected with the modified ERT2 peptide-suicide protein fusion polypeptide construct, Construct 2, following a two-day treatment with InM 4-OHT.

[0053] FIGS. 10A-10B are graphs demonstrating apoptotic efficacy of 4-OHT treatment of Construct 1, Construct 2, Construct 3, and Construct 4 clones. FIG. 10A shows that most clones treated with 5nM 4-OHT display apoptotic efficacy. FIG. 10B shows that the same set of clones display differential sensitivity to lnM 4-OHT treatment. Among these clones, Construct | clone displayed the highest apoptotic efficacy.

[0054] FIGS. 11A-11B are graphs demonstrating apoptotic efficacy of Endoxifen treatment of Construct 1, Construct 2, Construct 3, and Construct 4 clones. FIG. 11A compares apoptotic efficacy in clones treated with 10nM Endoxifen or 400 ng / mL hygromycin (as a positive apoptotic control). FIG. 11B shows the differential sensitivity of clones to 1nM Endoxifen treatment.

[0055] FIGS. 12A-12B are graphs depicting the apoptotic efficacy of treatment of Construct 1 clone with combinations of 4-OHT and Endoxifen. FIG. 12A depicts the apoptotic efficacy of treatment of Construct 1 clone with 1.25nM Endoxifen and 0.125nM to InM 4-OHT. FIG. 12B depicts the apoptotic efficacy of treatment of Construct 1 clone with 0.625nM or 1.25nM Endoxifen and 0.125nM 4-OHT.

[0056] FIGS. 13A-13E show the design and results of an experiment assessing the apoptotic efficacy in PSC-derived myeloid progenitor cells, following engineering of PSCs with TamCasp9 Construct 1, differentiation of the engineered PSCs into myeloid progenitor cells, and endoxifen treatment. FIG. 13A shows a schematic of an experimental workflow performed to validate conservation of kill switch function after differentiation of PSCs to myeloid progenitor cells. FIG. 13B shows flow cytometry evaluation of the differentiated cells, indicating successful differentiation into myeloid progenitor cells. FIG. 13C shows brightfield 14 WO 2024 / 163957 PCT / US2024 / 014331 images with fluorescent overlay. Cells were stained with AO / PI, with dead cells appearing darker after uptake of Propidium Iodide. FIG. 13D shows quantitation of the kill switch activity in myeloid progenitor cells following differentiation of unedited PSCs at the indicated endoxifen treatment conditions. FIG. 13E shows quantitation of the kill switch activity in myeloid progenitor cells following differentiation of TamCasp9-edited PSCs, at the indicated endoxifen treatment conditions.

[0057] FIG. 14 is a graph depicting quantitation of kill switch activity in myeloid progenitor cells following differentiation of PSCs to myeloid progenitor cells with or without TamCasp9 editing at the indicated endoxifen and 4-OHT treatment conditions.

[0058] FIG. 15 is a schematic depicting a construct including a kill switch fusion polypeptide encoding sequences inserted between left and right homology arms targeting the GAPDH STEL, with a T2A peptide sequence linking a modified ERT2 peptide-suicide protein fusion polypeptide encoding sequence to the left homology arm. The construct also includes a linked puromycin-resistance (PuroR) selection cassette.

[0059] FIG. 16 is a schematic depicting a construct including a kill switch fusion polypeptide encoding sequences inserted between left and right homology arms targeting the GAPDH STEL with a T2A peptide sequence linking a tandem modified ERT2 peptide-suicide protein fusion polypeptide encoding sequence to the left homology arm. The construct also includes a linked puromycin-resistance (PuroR) selection cassette.

[0060] FIGs. 17A-17D are graphs demonstrating iPSC death (based on percentage confluency) following combination 4-OHT and endoxifen treatment of pools of puromycin- selected edited iPSCs containing Constructs 9-12. FIG. 17A depicts results for Construct 9. FIG. 17B depicts results for Construct 10. FIG. 17C depicts results for Construct 11. FIG. 17D depicts results for Construct 12. 6. DETAILED DESCRIPTION 6.1. Definitions

[0061] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. Exemplary methods and materials are described below, although methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure. In case of conflict, the present specification, including definitions, will control. Generally, nomenclature used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics, 15 WO 2024 / 163957 PCT / US2024 / 014331 analytical chemistry, synthetic organic chemistry, medicinal and pharmaceutical chemistry, and protein and nucleic acid chemistry and hybridization described herein are those well-known and commonly used in the art. Enzymatic reactions and purification techniques are performed according to manufacturer’s specifications, as commonly accomplished in the art or as described herein. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Throughout this specification and embodiments, the words “have” and “comprise,” or variations such as “has,” “having,” “comprises,” or “comprising,” will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers. All publications and other references mentioned herein are incorporated by reference in their entirety. Although a number of documents are cited herein, this citation does not constitute an admission that any of these documents forms part of the common general knowledge in the art.

[0062] Gene-Edited Target Cell: As used herein, the term “gene-edited target cell” refers to a cell engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide of the disclosure from a STEL locus, e.g., via introduction of a targeting construct of the disclosure, or its descendants and progeny. A gene-edited target cell need not be of the same cell type as the cell into which the targeting construct was initially introduced. For example, the targeting construct may be introduced into a stem cell, such as an iPSC or a hESC, upon which the nucleotide sequence flanked by the homology arms of the targeting construct is integrated into the STEL locus of the stem cell. The stem cell can then be differentiated to produce a differentiated cell type, for example any of the cell types disclosed in Section 6.4. Both the stem cell and the differentiated cell are referred to herein as a “gene-edited target cell”. In addition to encoding a modified ERT2 peptide-suicide protein fusion polypeptide of the disclosure, the gene-edited target cell may include a transgene. In some embodiments, the transgene is introduced via the same targeting construct as the fusion polypeptide coding sequence and both the transgene and the fusion polypeptide are expressed from the same allele of the STEL gene (whether on a heterozygous or homozygous basis). In other embodiments, the fusion protein coding sequence and the transgene are positioned in different alleles of the STEL gene. In yet other embodiments, the fusion protein coding sequence is in a STEL gene and the transgene is in a different locus, whether a different STEL locus or a non-STEL locus.

[0063] iPSC: The term “induced pluripotent stem cell” or “iPSC” refers to a type of pluripotent stem cell artificially prepared from a non-pluripotent cell, such as an adult somatic cell, partially differentiated cell or terminally differentiated cell, such as a fibroblast, a cell of hematopoietic lineage, a myocyte, a neuron, an epidermal cell, or the like, by introducing or 16 WO 2024 / 163957 PCT / US2024 / 014331 contacting the cell with one or more reprogramming factors. iPSCs can be derived from multiple different cell types, including terminally differentiated cells. iPSCs have an embryonic stem (ES) cell-like morphology, growing as flat colonies with large nucleo-cytoplasmic ratios, defined borders and prominent nuclei. In addition, iPSCs express one or more key pluripotency markers known by one of ordinary skill in the art, including but not limited to Alkaline Phosphatase, SSEA3, SSEA4, Sox2, Oct3 / 4, Nanog, TRA160, TRA181, TDGF 1, Dnmt3b, Fox03, GDF3, Cyp26al, TERT, and zfp42.

[0064] Examples of methods of generating and characterizing iPSCs may be found in, for example, US Patent Publication Nos. US20090047263, US20090068742, US20090191159, US20090227032, US20090246875, and US20090304646, and PCT patent publications W02013177133 and WO2022204567, the disclosures of which are incorporated herein by reference. Generally, to generate iPSCs, somatic cells are provided with reprogramming factors (e.g., Oct4, SOX2, KLF4, MYC, Nanog, Lin28, efc.) known in the art to reprogram the somatic cells to become pluripotent stem cells.

[0065] Kill Switch: In the context of the present disclosure, the term “kill switch” refers to an inducible suicide gene or protein, for example a drug-inducible suicide gene or protein. Exemplary drug-inducible suicide proteins include the modified ERT2 peptide-suicide protein fusion polypeptides of the disclosure. The addition of appropriate drugs (e.g., estrogen antagonists such as tamoxifen in the context of modified ERT2 peptide-suicide protein fusion polypeptides disclosed herein) triggers the suicide proteins and kills the cells that express them. These features allow clinicians to kill off exogenously administered cell therapies, for example if cytokine release syndrome (CRS) develops or the cells become tumorigenic.

[0066] Linker or Linker Sequence: The terms “linker” or “linker sequence” as used in reference to a fusion polypeptide, refers to a part that connects two or more domains, parts, or entities. In some embodiments, the linker may comprise an amino acid or a peptide. Generally, linkers have no specific biological activity other than to join or to preserve some minimum distance or other spatial relationship between the parts.

[0067] Nucleic Acid: The terms “nucleic acid” or “oligonucleotide” or “polynucleotide” as used herein means at least two nucleotides covalently linked together. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a nucleic acid also encompasses the complementary strand of a depicted single strand. Many variants of a nucleic acid may be used for the same purpose as a given nucleic acid. Thus, a nucleic acid also encompasses substantially identical nucleic acids and complements thereof. A single strand provides a probe that may hybridize to a target sequence under stringent hybridization 17 WO 2024 / 163957 PCT / US2024 / 014331 conditions. Thus, a nucleic acid also encompasses a probe that hybridizes under stringent hybridization conditions.

[0068] Nucleic acids may be single stranded or double stranded, or may contain portions of both double stranded and single stranded sequence. The nucleic acid may be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids may be obtained by chemical synthesis methods or by recombinant methods.

[0069] Operably linked: The term “operably linked” refers to a functional relationship between two or more peptide or polypeptide domains or nucleic acid (e.g., DNA) segments. In the context of transcriptional regulation, the term refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence. For example, a promoter or enhancer sequence is operably linked to a coding sequence if it stimulates or modulates the transcription of the coding sequence in an appropriate host cell or other expression system.

[0070] Polypeptide, peptide, and protein: The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.

[0071] Pluripotent: As used herein, the term “pluripotent” or “pluripotency” refers to the capacity of a cell to self-renew and to differentiate into cells of any of the three germ layers: endoderm, mesoderm, or ectoderm. “Pluripotent stem cells” or “PSCs” include, for example, embryonic stem cells derived from the inner cell mass of a blastocyst or derived by somatic cell nuclear transfer, and iPSCs derived from non-pluripotent cells.

[0072] STEL: The terms “sustained transgene expression locus” or “STEL” refer to a locus in the genome of a cell that enables persistent and stable expression of a transgene in that cell, e.g., through differentiation of the cell from one state or type to another state or type. STEL of the present disclosure include, without limitation, loci of robustly expressed endogenous genes, for instance certain housekeeping genes that are active in multiple cell types such as those involved in gene expression (e.g., transcription factors and histones), cellular metabolism (e.g., GAPDH and NADH dehydrogenase), or cellular structures (e.g., actin), or those that encode ribosomal proteins (e.g., large or small ribosomal subunits, such as RPL13A, RPLPO and RPL7). Additional examples of STEL include those that form ribonucleoprotein complex, focal adhesion, cell-substrate adherens junction, cell-substrate junction, cell anchoring, extracellular exosome, extracellular vesicle, intracellular organelle, or anchoring junction. Some of the 18 WO 2024 / 163957 PCT / US2024 / 014331 proteins are involved in RNA binding, nucleic acid binding (e.g., rRNA or mRNA binding), or protein binding.

[0073] STEL Protein, STEL Polypeptide: The terms “STEL protein” and “STEL polypeptide” are used interchangeably herein to refer to a polypeptide encoded by a STEL gene, or a polypeptide having at least 85% (e.g., at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%) sequence identity thereto.

[0074] Target Cell: The term “target cell” refers to a host cell into which is introduced a targeting construct that following integration into the host cell genome results in the production of a recombinant nucleic acid encoding a modified ERT2 peptide-suicide protein fusion polypeptide disclosed herein. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Such progeny need not be identical to the parent cell into which the expression vector or targeting construct was initially introduced but include counterparts and progeny of the cell which carry the expression cassette or into which the targeting construct has integrated, as well as cells differentiated therefrom. Such counterparts and progeny are still included within the scope of the term “target cell” as used herein.

[0075] Targeting Construct: The term “targeting construct” refers to a recombinant nucleic acid molecule that can specifically interact with a STEL locus and which may further comprise a nucleotide sequence encoding a modified ERT2 peptide-suicide protein fusion polypeptide disclosed herein. Recombination of the targeting construct and the STEL locus leads to the modification of the STEL locus, e.g., to introduce a modified ERT2 peptide-suicide protein fusion polypeptide disclosed herein into the STEL locus. Typically, a targeting construct comprises homology arms that allow integration of the targeting construct into a particular STEL locus.

[0076] Transfection: The term “transfection” refers to the introduction of nucleic acid molecules, such as targeting constructs, into cells, e.g., into eukaryotic cells. In the context of the present disclosure, the term “transfection” encompasses any method known to the skilled person for introducing nucleic acid molecules into cells, e.g., into eukaryotic cells, such as into mammalian cells. Such methods encompass, for example, electroporation, nucleofection, lipofection, e.g., based on cationic lipids and / or liposomes, calcium phosphate precipitation, nanoparticle-based transfection, virus-based transfection, or transfection based on cationic polymers, such as DEAE-dextran or polyethylenimine. 6.2. Targeting Constructs 19 WO 2024 / 163957 PCT / US2024 / 014331

[0077] The present disclosure provides targeting constructs comprising nucleotide sequences encoding modified ERT2 peptide-suicide protein fusion polypeptides disclosed herein (“fusion polypeptide coding sequences”’) flanked by homology arms that direct the integration of the fusion polypeptide coding sequences into a STEL locus in a target cell genome.

[0078] The targeting constructs may be in the form of vectors. The term “vector” as used herein refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a “plasmid”, which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.

[0079] A targeting construct in the form of a vector may be linearized or released from a circular vector prior to its introduction into a target cell.

[0080] Alternatively, a targeting construct may be synthesized in vitro, e.g., using a DNA polymerase such as T7 prior to its introduction into a target cell.

[0081] Exemplary STEL loci are disclosed in Section 6.2.1.

[0082] Suitable homology arms are disclosed in Section 6.2.2.

[0083] The targeting constructs may further comprise nucleotide sequences encoding separator sequences, as described in Section 6.2.3, that allow the fusion polypeptide coding sequences to be positioned under common transcriptional regulatory control with a STEL protein (e.g., a protein encoded by the endogenous STEL locus) but allows the separate translation of the fusion polypeptide and the STEL protein or the post-translational cleavage of the fusion polypeptide and the STEL protein. Targeting constructs may further comprise one or more ribonucleoprotein (RNP) cut sites that flank the outer sides of the homology arms. These RNP cut sites allow for the endonuclease to cleave the targeting constructs, e.g., to linearize a circular targeting construct. In some embodiments, the targeting construct comprises no RNP cut sites, one RNP cut site, or two RNP cut sites.

[0084] Target cells into which the targeting constructs can be introduced are disclosed in Section 6.4.

[0085] In some embodiments, genome editing of a cell with any one of the targeting constructs disclosed herein results in insertion of more than one copies (e.g., 1, 2, 3, 4, or 5 or 20 WO 2024 / 163957 PCT / US2024 / 014331 more copies) of any one of the nucleotide inserts disclosed here that comprise a nucleotide sequence encoding the fusion polypeptides disclosed herein. 6.2.1. STEL Loci

[0086] Sustained Transgene Expression Loci (“STEL loci’) are genetic loci endogenous to a target cell that are expressed robustly and consistently at a sustained level across and between different cell types (for example, as a cell differentiates, such as from a PSC to PSC derived cell). For example, the expression level of the endogenous gene does not change (e.g., decrease) by more than 50%, more than 40%, more than 35%, more than 30%, more than 25%, more than 20%, more than 15%, more than 10%, or more than 5% over five or more, ten or more, or 15 or more passages or as the cell state changes (e.g., state of pluripotency and / or differentiation).

[0087] In some embodiments, a STEL locus is a gene that is associated with cellular metabolism, such as GAPDH, NADH dehydrogenase, and phosphoglycerate kinase 1 (PGK1).

[0088] In some embodiments, a STEL locus is a ribosomal protein gene or ribosomal protein gene locus, such as an RPL or RPS gene locus. Examples of RPL genes are RPL1IO, RPL / 3, RPS18, RPL3, RPLP1, RPLI3A, RPLI5, RPL41, RPLI1, RPL32, RPLISA, RPL19, RPL28, RPL29, RPL9Y, RPL8, RPL6, RPLI8, RPL7, RPL7A, RPL21, RPL37A, RPL12, RPL5, RPL34, RPL35A, RPL30, RPL24, RPL39, RPL37, RPL14, RPL27A, RPLP2, RPLPO, RPL23A, RPL26, RPL36, RPL35, RPL23, RPLA, and RPL22. Examples of RPS genes are RPS2, RPS19, RPS14, RPS3A, RPS12, RPS3, RPS6, RPS23, RPS27A, RPS8, RPS4X, RPS7, RPS24, RPS27, RPS15A, RPS9I, RPS28, RPS13, RPSA, RPS5S, RPS16, RPS25, RPS1I5, RPS20, and RPSII.

[0089] In some embodiments, a STEL gene encodes a mitochondrial protein. Examples of such genes are MT-CO1, MT-C02, MT-ND4, MT-ND1, and MT-ND2.

[0090] In some embodiments, a STEL gene encodes a cytoskeletal protein, such as actin. Examples of actin genes are ACTG / and ACTB.

[0091] In some embodiments, a STEL gene encodes a eukaryotic translation elongation factor, such as EEFIA / and EEF2, or a eukaryotic translation initiation factor, such as EJF J.

[0092] In some embodiments, a STEL gene encodes a histone, such as H3F3A or H3F3B.

[0093] In other embodiments, a STEL gene is selected from FTL, FTH1, TPT1, IMSB10, PTMA, GNB2L1, NACA, YBX1, NPM1, FAU, UBA52, HSP90AB1, MYL6, SERF2, and SRP / 4.

[0094] In some embodiments, a modified ERT2 peptide-suicide protein fusion polypeptide sequence disclosed herein is introduced into a STEL gene, so that the STEL gene is modified to include the modified ERT2 peptide-suicide protein fusion polypeptide, optionally separated from the coding sequence of the STEL protein via a separator sequence. In some embodiments, the STEL locus is the GAPDH gene. In some embodiments, a modified ERT2 peptide-suicide 21 WO 2024 / 163957 PCT / US2024 / 014331 protein fusion polypeptide sequence disclosed herein in introduced into a STEL gene, by generating a break in an exon of a STEL site that is required for cell survival, such that if proper integration of the modified ERT2 peptide-suicide protein fusion polypeptide sequence does not occur, cells having such improper integration do not survive. Such screening of improper integration events may be performed in accordance with methods described in WO 2021 / 226151, which is incorporated herein by reference. 6.2.2. Homology Arms

[0095] Targeting constructs that are intended for integration into a STEL locus of a target cell genome typically comprise a heterologous sequence that is not present in the target cell genome, e.g., a nucleotide sequence encoding a modified ERT2 peptide-suicide protein fusion polypeptide disclosed herein.

[0096] The targeting constructs typically include one or more regions that are homologous to regions of DNA within or near (e.g., flanking or adjoining) a STEL locus sequence. These homologous regions are referred to here as “homology arms.” For ease of reference, the homology arms are referred to herein as first and second (i.e., 5’ and 3', upstream and downstream, or left and right) homology arms. This terminology relates to the relative position of the homology arms to the nucleic acid insert within the targeting construct. The first and second homology arms correspond to regions within or near (e.g., flanking or adjoining) a STEL locus sequence, which are referred to herein as “first region of homology” and “second region of homology,” respectively. The regions within or near (e.g., flanking or adjoining) a STEL locus sequence are sometimes referred to herein as “target” sequences.

[0097] The current disclosure provides a targeting construct comprising a first homology arm that corresponds to a first region of homology, a nucleic acid insert, and a second homology arm that corresponds to a second region of homology to a STEL locus.

[0098] A homology arm and a target sequence “correspond” or are “corresponding” to one another when the two regions share a sufficient level of sequence identity to one another to act as substrates for a homologous recombination reaction, whereby the homology arms are suitable for directing recombination of a nucleic acid insert with a desired target sequence to facilitate genomic integration and / or replacement of endogenous sequence.

[0099] The term “homology” includes DNA sequences that are either identical or share sequence identity to a corresponding sequence. The sequence identity between a given target sequence and the corresponding homology arm found in the exogenous donor nucleic acid can be any degree of sequence identity that allows for homologous recombination to occur. For example, the amount of sequence identity shared by the homology arm of the exogenous donor 22 WO 2024 / 163957 PCT / US2024 / 014331 nucleic acid (or a fragment thereof) and the target sequence (or a fragment thereof) can be at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, such that the sequences undergo homologous recombination. Moreover, a corresponding region of homology between the homology arm and the corresponding target sequence can be of any length that is sufficient to promote homologous recombination. In some targeting vectors, the intended mutation in the target genomic locus is included in an insert nucleic acid flanked by the homology arms.

[00100] In some embodiments, the first homology arm is between 50 to 250 nucleotides in length. In some embodiments, the first homology arm is between 50-2000 nucleotides in length. In some embodiments, the first homology arm is between 50-1500 nucleotides in length. In some embodiments, the first homology arm is between 50-1000 nucleotides in length. In some embodiments, the first homology arm is between 50-500 nucleotides in length. In some embodiments, the first homology arm is between 150 to 250 nucleotides in length. In some embodiments, the first homology arm is 2000 nucleotides or less in length. In some embodiments, the first homology arm is 1500 nucleotides or less in length. In some embodiments, the first homology arm is 1000 nucleotides or less in length. In some embodiments, the first homology arm is 700 nucleotides or less in length. In some embodiments, the first homology arm is 650 nucleotides or less in length. In some embodiments, the first homology arm is 600 nucleotides or less in length. In some embodiments, the first homology arm is 550 nucleotides or less in length. In some embodiments, the first homology arm is 500 nucleotides or less in length. In some embodiments, the first homology arm is 400 nucleotides or less in length. In some embodiments, the first homology arm is 300 nucleotides or less in length. In some embodiments, the first homology arm is 250 nucleotides or less in length. In some embodiments, the first homology arm is 200 nucleotides or less in length. In some embodiments, the first homology arm is 150 nucleotides or less in length. In some embodiments, the first homology arm is less than 100 nucleotides in length. In some embodiments, the first homology arm is 50 nucleotides in length or less. In some embodiments, the first homology arm is 250, 200, 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, or 20 nucleotides in length. In some embodiments, the first homology arm is at least 20 nucleotides in length. In some embodiments, the first homology arm is at least 40 nucleotides in length. In some embodiments, the first homology arm is at least 50 nucleotides in length. In some embodiments, the first homology arm is at least 70 nucleotides in length. In some embodiments, 23 WO 2024 / 163957 PCT / US2024 / 014331 the first homology arm is at least 100 nucleotides in length. In some embodiments, the first homology arm is at least 200 nucleotides in length. In some embodiments, the first homology arm is at least 300 nucleotides in length. In some embodiments, the first homology arm is at least 400 nucleotides in length. In some embodiments, the first homology arm is at least 500 nucleotides in length. In some embodiments, the first homology arm is at least 600 nucleotides in length. In some embodiments, the first homology arm is at least 700 nucleotides in length. In some embodiments, the first homology arm is at least 1000 nucleotides in length. In some embodiments, the first homology arm is at least 1500 nucleotides in length. In some embodiments, the first homology arm is at least 2000 nucleotides in length. In some embodiments, the first homology arm is about 20 nucleotides in length. In some embodiments, the first homology arm is about 40 nucleotides in length. In some embodiments, the first homology arm is 250 nucleotides in length or less. In some embodiments, the first homology arm is about 100 nucleotides in length. In some embodiments, the first homology arm is about 200 nucleotides in length.

[00101] In some embodiments, the second homology arm is between 50 to 250 nucleotides in length. In some embodiments, the second homology arm is between 50-2000 nucleotides in length. In some embodiments, the second homology arm is between 50-1500 nucleotides in length. In some embodiments, the second homology arm is between 50-1000 nucleotides in length. In some embodiments, the second homology arm is between 50-500 nucleotides in length. In some embodiments, the second homology arm is between 150 to 250 nucleotides in length. In some embodiments, the second homology arm is 2000 nucleotides or less in length. In some embodiments, the second homology arm is 1500 nucleotides or less in length. In some embodiments, the second homology arm is 1000 nucleotides or less in length. In some embodiments, the second homology arm is 700 nucleotides or less in length. In some embodiments, the second homology arm is 650 nucleotides or less in length. In some embodiments, the second homology arm is 600 nucleotides or less in length. In some embodiments, the second homology arm is 550 nucleotides or less in length. In some embodiments, the second homology arm is 500 nucleotides or less in length. In some embodiments, the second homology arm is 400 nucleotides or less in length. In some embodiments, the second homology arm is 300 nucleotides or less in length. In some embodiments, the second homology arm is 200 nucleotides in length or less. In some embodiments, the second homology arm is 150 nucleotides in length or less. In some embodiments, the second homology arm is 100 nucleotides in length or less. In some embodiments, the second homology arm is 50 nucleotides in length or less. In some 24 WO 2024 / 163957 PCT / US2024 / 014331 embodiments, the second homology arm is 250, 200, 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, or 20 nucleotides in length. In some embodiments, the second homology arm is at least 20 nucleotides in length. In some embodiments, the second homology arm is at least 40 nucleotides in length. In some embodiments, the second homology arm is at least 50 nucleotides in length. In some embodiments, the second homology arm is at least 70 nucleotides in length. In some embodiments, the second homology arm is at least 100 nucleotides in length. In some embodiments, the second homology arm is at least 200 nucleotides in length. In some embodiments, the second homology arm is at least 300 nucleotides in length. In some embodiments, the second homology arm is at least 400 nucleotides in length. In some embodiments, the second homology arm is at least 500 nucleotides in length. In some embodiments, the second homology arm is at least 600 nucleotides in length. In some embodiments, the second homology arm is at least 700 nucleotides in length. In some embodiments, the second homology arm is at least 1000 nucleotides in length. In some embodiments, the second homology arm is at least 1500 nucleotides in length. In some embodiments, the second homology arm is at least 2000 nucleotides in length. In some embodiments, the second homology arm is about 20 nucleotides in length. In some embodiments, the second homology arm is about 40 nucleotides in length. In some embodiments, the second homology arm is 250 nucleotides in length or less. In some embodiments, the second homology arm is about 100 nucleotides in length. In some embodiments, the second homology arm is about 200 nucleotides in length.

[00102] The first and second homology arms can be of the same length or can differ in length. In some embodiments, the first and second homology arms are amplified to allow for the quantitative assessment of gene editing events, such as targeted integration, at a target nucleic acid. In some embodiments, the assessment of the gene editing events may rely on the amplification of both the 5’ junction and 3’ junction at the site of targeted integration by amplifying the whole or a part of the homology arm using a single pair of PCR primers in a single amplification reaction. Accordingly, although the length of the first and second homology arms may differ, the length of each homology arm should be capable of amplification (e.g., using PCR), as desired.

[00103] In some embodiments, the length of the first and second homology arms does not differ by more than 75 nucleotides. Thus, in some embodiments, when the first and second homology arms differ in length, the length difference between the homology arms is less than 70, 60, 50, 40, 30, 20, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 nucleotides or base pairs. In some embodiments, 25 WO 2024 / 163957 PCT / US2024 / 014331 the first and second homology arms differ in length by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, or 75 nucleotides. In some embodiments, the length difference between the first and second homology arms is less than 70, 60, 50, 40, 30, 20, 10, 9, 8, 7, 6,5, 4, 3, 2, 1 base pairs. In some embodiments, the first and second homology arms differ in length by at least 1, 2, 3, 4,5, 6, 7, 8,9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, or 75 base pairs.

[00104] Homology arms are capable of directing recombination of a nucleic acid insert within or near a desired target STEL gene to facilitate genomic integration and / or replacement of endogenous sequence, e.g., integrate a modified ERT2 peptide-suicide protein fusion polypeptide sequence disclosed herein into a STEL gene. Regardless of the format used, a donor template can be designed to avoid undesirable sequences. In certain embodiments, one or both homology arms can be shortened to avoid overlap with certain sequence repeat elements, e.g., Alu repeats, LINE elements, etc.

[00105] In some embodiments, the homology arms are designed such that, following integration of the targeting construct, the modified ERT2 peptide-suicide protein fusion polypeptide coding sequence is positioned 3' to the STEL polypeptide coding sequence. In other embodiments, the homology arms are designed such that, following integration of the targeting construct, the modified ERT2 peptide-suicide protein fusion polypeptide coding sequence is positioned 5' to the STEL polypeptide coding sequence. Typically, the STEL polypeptide coding sequence and the modified ERT2 peptide-suicide protein fusion polypeptide coding sequence are separated by a separator sequence, such as an IRES or a 2A peptide coding sequence. 6.2.3. Separator Sequences

[00106] The targeting constructs and recombinant target cell genomes described herein can also comprise a separator sequence between STEL polypeptide coding sequence and the modified ERT2 peptide-suicide protein fusion polypeptide coding sequence. Such separator sequences can allow separate expression of the STEL polypeptide and the modified ERT2 peptide-suicide protein fusion polypeptide under common control of STEL gene regulatory elements. 26 WO 2024 / 163957 PCT / US2024 / 014331

[00107] In some embodiments, the separator sequence is an internal ribosome entry site (IRES), which allows the STEL polypeptide to be translated separately from the modified ERT2 peptide-suicide protein fusion polypeptide.

[00108] In some embodiments, the separator sequence is a self-cleaving peptide, associated with ribosomal skipping during translation, in which the ribosomes skip the peptide bond between a C-terminal Gly and Pro, resulting in the production of two separate polypeptides, 1.e., the STEL polypeptide and the modified ERT2 peptide-suicide protein fusion polypeptide. A self-cleaving peptide causes ribosomal skipping during translation. Examples of self-cleaving peptides are 2A peptides, which are viral derived peptides with a typical length of 18-22 amino acids. 2A peptides include T2A, P2A, E2A, F2A, PQR (Lo et al., 2015, Cell Reports 13:2634- 2644), Opt2A, and Opt2A_2.0. By way of example, P2A is a peptide of 19 amino acids; after the cleavage, a few amino acid residues from the P2A are left on the upstream polypeptide and a proline is left at the beginning of the second polypeptide. 2A residues left on the STEL polypeptide and the modified ERT2 peptide-suicide protein fusion polypeptide do not affect their functionality.

[00109] In some embodiments, a 2A peptide a P2A peptide. In some embodiments, a P2A peptide comprises an amino acid sequence as set forth in SEQ ID NO: 195. In some embodiments, a P2A peptide comprises an amino acid sequence as set forth in SEQ ID NO: 11. In some embodiments, a P2A peptide is encoded by a nucleic acid sequence as set forth in SEQ ID NO: 52. P2A amino acid sequence: ATNFSLLKQAGDVEENPGP (SEQ ID NO: 11) P2A nucleic acid sequence: GCGACGAATTTTAGTCTACTGAAACAAGCGGGAGACGTGGAGGAAAACCCT GGACCT (SEQ ID NO: 52)

[00110] In some embodiments, a 2A peptide comprises a T2A peptide. In some embodiments, a T2A peptide comprises an amino acid sequence as set forth in SEQ ID NO: 53. In some embodiments, a T2A peptide is encoded by a nucleic acid sequence as set forth in SEQ ID NO: 54. T2A amino acid sequence: EGRGSLLTCGDVEENPGP (SEQ ID NO: 53) T2A nucleic acid sequence: GAAGGGCGCGGGTCTCTCCTCACTTGTGGAGATGTTGAGGAAAATCCAGGAC CA (SEQ ID NO: 54)

[00111] In some embodiments, a 2A peptide comprises an E2A G4S T2A (Opt2A) peptide. In some embodiments, an E2A G48 T2A (Opt2A) peptide comprises an amino acid sequence as set 27 WO 2024 / 163957 PCT / US2024 / 014331 forth in SEQ ID NO: 55. In some embodiments, an Opt2A peptide is encoded by a nucleic acid sequence as set forth in SEQ ID NO: 56. Opt2A amino acid sequence: QCTNY ALLKLAGDVESNPGPGSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 55) Opt2A nucleic acid sequence: CAGTGCACAAATTATGCACTGCTGAAGCTCGCCGGGGATGTCGAGAGTAACC CAGGACCTGGAAGCGGAGAAGGTCGTGGTAGTCTACTAACGTGTGGTGATGT AGAAGAAAATCCTGGACCT (SEQ ID NO: 56)

[00112] In some embodiments, a 2A peptide comprises a P2A 3-T2A 2 (Opt2A_2.0) peptide. In some embodiments, a P2A 3-T2A 2 (Opt2A_2.0) peptide comprises an amino acid sequence as set forth in SEQ ID NO: 12. In some embodiments, an Opt2A_2.0 peptide is encoded by a nucleic acid sequence as set forth in SEQ ID NO: 57. Opt2A_2.0 amino acid sequence: (SEQ ID NO: 12) ATNFSLLKQAGDVEENPGPGSGEGRGSLLTCGDVEENPGP Opt2A_2.0 nucleic acid sequence: (SEQ ID NO: 57) GCGACGAATTTTAGTCTACTGAAACAAGCGGGAGACGTGGAGGAAAACCCT GGACCTGGAAGCGGAGAAGGTCGTGGTAGTCTACTAACGTGTGGTGATGTA GAAGAAAATCCTGGACCT 6.3. Modified ERT2 peptide-suicide protein fusion polypeptides

[00113] The modified ERT2 peptide-suicide protein fusion polypeptides disclosed herein allow for temporal control of activity of a suicide protein that is activated upon dimerization. The modified ERT2 peptide can allow reversible control over their activity by administrating or removing an inducing agent such as tamoxifen or a metabolite thereof, for example, 4- hydroxytamoxifen (4-OHT), N-desmethyltamoxifen, tamoxifen-N-oxide, and endoxifen. For example, without being bound by theory, it is thought that in the absence of an inducing agent, the modified ERT2 peptide domains, together with their suicide protein fusion partner, remain largely in monomeric form, such that they cannot induce apoptosis. In the presence of tamoxifen or a metabolite thereof, however, it is believed that the modified ERT2 peptide can then dimerize, allowing the suicide protein components to also dimerize and initiate apoptosis.

[00114] The modified ERT2 peptide-suicide protein fusion polypeptides disclosed herein comprise (a) a modified ERT2 peptide disclosed herein, (b) a suicide protein disclosed herein, and (c) an optional linker separating the modified ERT2 peptide and suicide protein. In some embodiments, the modified ERT2 peptide-suicide protein fusion polypeptide comprises a modified ERT2 peptide N-terminal to the suicide protein. In some embodiments, the modified 28 WO 2024 / 163957 PCT / US2024 / 014331 ERT2 peptide-suicide protein fusion polypeptide comprises a modified ERT2 peptide C- terminal the suicide protein. In yet further embodiments, a modified ERT2 peptide-suicide protein fusion polypeptide comprises a modified ERT2 peptide both N-terminal and C-terminal to the suicide protein. The N- and C-terminal modified ERT2 peptides can be the same or different. In each case, the suicide protein and the modified ERT2 peptide sequence may be separated by a linker sequence.

[00115] Modified ERT2 peptides are set forth in Section 6.3.1 below.

[00116] Suicide proteins are set forth in Section 6.3.2 below.

[00117] Exemplary linker sequences are set forth in Section 6.3.3 below. 6.3.1. The Modified ERT2 Peptide

[00118] Estrogen receptor (ER) is a ligand-dependent transcription factor that binds endogenous hormone ligands such as estrogen and estradiol. Synthetic ligands that bind to ER, such as tamoxifen and its active metabolites, e.g., 4- OHT, N-desmethyltamoxifen, tamoxifen-N- oxide, and endoxifen, have been developed for treating ER-positive cancers.

[00119] Suicide protein activity can be regulated by fusing the suicide protein to a modified ER-LBD (also referred to herein as modified ERT2 peptide). The modified ERT2 peptide comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and comprises a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: (i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, Gi) an L391V substitution, a N413D substitution, a Q414E substitution, a $463P substitution, and a H524F substitution, (ii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, aM421L substitution, aM517A substitution, and a H524F substitution, (iv) an L354] substitution, a L391¥V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, 29 WO 2024 / 163957 PCT / US2024 / 014331 (v) an L391¥V substitution, a Q414E substitution, an N413D substitution, an $463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an MS517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354] substitution, an L384M substitution, and an H524L substitution, or (viii) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution.

[00120] Fusing a suicide protein to a modified ERT2 peptide is believed to maintain the suicide protein in monomeric form in the absence of a modified ERT2 peptide inducer, such that the suicide protein cannot induce apoptosis. In the presence of estrogen receptor antagonists (e.g., tamoxifen), the modified ERT2 peptide, and consequently the suicide protein, can dimerize, activating the apoptosis-inducing capability of the suicide protein. This dimerization can be achieved by administering one or more estrogen receptor antagonists. Exemplary estrogen receptor antagonists include, but are not limited to, tamoxifen and its metabolites, e.g., 4-OHT, N-desmethyltamoxifen, tamoxifen-N-oxide, and endoxifen.

[00121] It is to be understood that the additional amino acid substitutions to the modified ERT2 peptide disclosed herein are with reference to SEQ ID NO: 1.

[00122] In some embodiments, the hormone binding domain of a reference human estrogen receptor sequence corresponds to positions 282-595 of human estrogen receptor (SEQ ID NO: 1). It is to be understood that the hormone binding domain does not necessarily require all of amino acid residues 282-595 of SEQ ID NO: 1. By way of example only, it is to be understood that positions 283-594 of SEQ ID NO: 1, or other functional truncations or fragments thereof, may function as the hormone binding domain.

[00123] In some embodiments, the additional amino acid substitutions comprise: an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:?2.

[00124] In some embodiments, the additional amino acid substitutions comprise: an L391V substitution, a N413D_ substitution, a Q414E substitution, a S463P substitution, and a H524F 30 WO 2024 / 163957 PCT / US2024 / 014331 substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:3.

[00125] In some embodiments, the additional amino acid substitutions comprise: an L3541 substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, aM517A_ substitution, and a H524F substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:4.

[00126] In some embodiments, the additional amino acid substitutions comprise: an L3541 substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:5.

[00127] In some embodiments, the additional amino acid substitutions comprise: an L391V substitution, a Q414E substitution, an N413D substitution, an $463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:40.

[00128] In some embodiments, the additional amino acid substitutions comprise: an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:41.

[00129] In some embodiments, the additional amino acid substitutions comprise: an N413D substitution, an S463P substitution, an L354] substitution, an L384M substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:42.

[00130] In some embodiments, the additional amino acid substitutions comprise: an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:43. 31 WO 2024 / 163957 PCT / US2024 / 014331 Name Sequence SEQ ID NO: Estrogen Receptor MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIP] 1 (Reference Amino Acid JLERPLGEV YLDSSKPAV YNYPEGAA YEFNAAAA Sequence) ANAQVYGQTGLPY GPGSEAAAFGSNGLGGFPPL INS VSPSPLMLLHPPPQLSPFLQPHGQQVPY Y LENE) Italics = amino acid PSGYTVREAGPPAFYRPNSDNRRQGGRERLASTN positions 282-595 IDKGSMAMESAKETRYCAVCNDY ASGYHYGVW SCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRR KSCQACRLRKCYEVGMMKGGIRKDRRGGRMLK IHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMI RSKKNSLALSLTADQMVSALLDAEPPILYSEYDP TRPFSEASMMGLLTNLADRELVHMINWAKRVPG VDLTLHDQVHLLECA WLEILMIGLVWRSMEHP GKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATS RFRMMNLOQGEEFVCLKSULLNSGVYTFLSSTL SLEEKDHIHRVLDKITDTLIHLMAKAGLTLOGQGOQ QRLAQLLLILSHIRHMSNKGMEHLYSMKCKNV VPLYDLLLEMLDAHRLHAPTSRGGAS VEETDQS LATAGSTSSHSLQKYYITGEAEGFPATV ERT2*mut81 IAAGDMRAANLWPSPLMIKRSKKNSLALSLTADQM| 2 'VSALLDAEPPILYSEYDPTRPFSEASMMGLLTNL AADRELVHMINWAKRVPGFVDLTLHDQVHLLEC IAWMEILMIGV VWRSMEHPVKLLFAPNLLLDRDQ GKCVEGLVEIFDMLLATSSRFRMMNLQGEEFVC LKSULLNSGVYTFLPSTLKSLEEKDHIHRVLDKIT DTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHM SNKGMELLYSMKCKNVVPLYDLLLEAADAHRL IHAPTSRGGAS VEETDQSHLATAGSTSSHSLOKY Y ITGEAEGFPAT ERT2*mut88 IAAGDMRAANLWPSPLMIKRSKKNSLALSLTADQM| 3 'VSALLDAEPPILYSEYDPTRPFSEASMMGLLTNL AADRELVHMINWAKRVPGFVDLTLHDQVHLLEC IAAWLEILMIGV VWRSMEHPVKLLFAPNLLLDRDE GKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVC LKSULLNSGVYTFLPSTLKSLEEKDHIHRVLDKIT DTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHM SNKGMEFLYSMKCKNVVPLYDLLLEAADAHRL IHAPTSRGGAS VEETDQSHLATAGSTSSHSLOKY Y ITGEAEGFPAT ERT2*mut63 IAAGDMRAANLWPSPLMIKRSKKNSLALSLTADQM| 4 'VSALLDAEPPILYSEYDPTRPFSEASMMGLLTNL IADREIVHMINWAKRVPGFVDLTLHDQVHLLECA LEILMIGV VWRSMEHPVKLLFAPNLLLDRDEG KCVEGLVEIFDMLLATSSRFRMMNLQGEEFVCL KSULLNSGVYTFLSSTLKSLEEKDHIHRVLDKITD TLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHAS INKGMEFLYSMKCKNVVPLYDLLLEAADAHRLH 32 WO 2024 / 163957 PCT / US2024 / 014331 AAPTSRGGASVEETDQSHLATAGSTSSHSLOKYYI TGEAEGFPAT ERT2*mut41 IAGDMRAANLWPSPLMIKRSKKNSLALSLTADQM| 5 VSALLDAEPPILYSEYDPTRPFSEASMMGLLTNL AADREIVHMINWAKRVPGFVDLTLHDQVHLLECA LEILMIGVVWRSMEHPVKLLFAPNLVLDRDEG KCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCL KSULLNSGVYTFLSSTLKSLEEKDHIHRVLDKITD TLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMS INKGMELLYSMKCKNVVPLYDLLLEAADAHRLH AAPTSRGGASVEETDQSHLATAGSTSSHSLOKYYI TGEAEGFPAT ERT2*mut51 AAGDMRAANLWPSPLMIKRSKKNSLALSLTADQM| 40 VSALLDAEPPILYSEYDPTRPFSEASMMGLLTNL AADREIVHMINWAKRVPGFVDLTLHDQVHLLECA MEILMIGVVWRSMEHPVKLLFAPNLLLDRDEG KCVEGLVEIFDMLLATSSRFRMMNLQGEEFVCL KSULLNSGVYTFLPSTLKSLEEKDHIHRVLDKITD TLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMS INKGMELLYSMKCKNVVPLYDLLLEAADAHRLH AAPTSRGGASVEETDQSHLATAGSTSSHSLOKYYI TGEAEGFPAT ERT2*mut37 IAGDMRAANLWPSPLMIKRSKKNSLALSLTADQM| 41 VSALLDAEPPILYSEYDPTRPFSEASMMGLLTNL AADREIVHMINWAKRVPGFVDLTLHDQVHLLECA LEILMIGVVWRSMEHPVKLLFAPNLLLDRDQG KCVEGLVEIFDMLLATSSRFRMMNLQGEEFVCL KSULLNSGVYTFLPSTLKSLEEKDHIHRVLDKITD TLINLMAKAGLTLQQQHORLAQLLLILSHIRHAS INKGMELLYSMKCKNVVPLYDLLLEAADAHRLH AAPTSRGGASVEETDQSHLATAGSTSSHSLOKYYI TGEAEGFPAT ERT2*mut94 IAGDMRAANLWPSPLMIKRSKKNSLALSLTADQM| 42 VSALLDAEPPILYSEYDPTRPFSEASMMGLLTNL AADREIVHMINWAKRVPGFVDLTLHDQVHLLECA MEILMIGLVWRSMEHPVKLLFAPNLLLDRDQG KCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCL KSULLNSGVYTFLPSTLKSLEEKDHIHRVLDKITD TLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMS INKGMELLYSMKCKNVVPLYDLLLEAADAHRLH AAPTSRGGASVEETDQSHLATAGSTSSHSLOKYYI TGEAEGFPAT ERT2*mut41v2 IAGDMRAANLWPSPLMIKRSKKNSLALSLTADQM| 43 VSALLDAEPPILYSEYDPTRPFSEASMMGLLTNL AADREIVHMINWAKRVPGFVDLTLHDQVHLLECA LEILMIGVVWRSMEHPVKLLFAPNLVLDRDQG KCVEGLVEIFDMLLATSSRFRMMNLQGEEFVCL KSULLNSGVYTFLPSTLKSLEEKDHIHRVLDKITD TLINLMAKAGLTLQQQHORLAQLLLILSHIRHAS 33 WO 2024 / 163957 PCT / US2024 / 014331 IAPTSRGGAS VEETDQSHLATAGSTSSHSLQKY YI TTGEAEGFPAT

[00131] In some embodiments, the modified ERT2 peptide further comprises an N-terminal serine (S) residue.

[00132] In further embodiments, the modified ERT2 peptide may also include a V595A amino acid substitution. 6.3.2. The Suicide Protein

[00133] The modified ERT2 peptide-suicide protein fusion polypeptides comprises a caspase 9 domain or derivative or functional fragment thereof (“suicide protein’).

[00134] The activity of the suicide protein is inducible by dimerization. Thus, in some embodiments, the suicide protein is inactive or has low / reduced activity in monomeric form, but has suicide protein activity in dimeric form.

[00135] In some embodiments, the caspase 9 sequence is a truncated caspase 9 (“truncCasp9”) with its Caspase Activation and Recruitment Domain (CARD) motif removed. In the presence of an estrogen antagonist such as tamoxifen or its metabolites, the ERT2 domain dimerizes, which is believed to subsequently cause homodimerization of truncCasp9 and induction of apoptosis.

[00136] The dimerization of modified ERT2 peptide-tuncCasp9 fusion polypeptides can be achieved by administering one or more estrogen antagonists. Exemplary estrogen antagonists include tamoxifen and / or its metabolites, such as 4-OHT, N-desmethyltamoxifen, tamoxifen-N- oxide, and endoxifen. Without being bound by theory, it is believed that administering a combination of two or more estrogen antagonists (such as a combination of tamoxifen and one or more of its metabolites or a combination of two or more tamoxifen metabolites) can result in synergism, thereby lowering the minimally effective dosage of each agent included in the combination. Consequently, apoptosis can be achieved by administration of pharmacologically relevant concentrations of each agent in a combination.

[00137] In some embodiments, ERT2 peptide-truncCasp9 fusion polypeptide dimerization is achieved by administering only one estrogen antagonist, such as tamoxifen, 4-OHT, N- desmethyltamoxifen, tamoxifen-N-oxide, or endoxifen. In other embodiments, ERT2 peptide- truncCasp9 fusion polypeptide homodimerization is achieved by administering any combination of two or more estrogen antagonists, such as tamoxifen and / or its metabolites, including but not limited to 4-OHT, N-desmethyltamoxifen, tamoxifen-N-oxide, and endoxifen, in any combination. In some embodiments, a combination comprising 4-OHT and endoxifen is 34 WO 2024 / 163957 PCT / US2024 / 014331 administered. In some embodiments, the dose of each agent administered in combination is less than the dose that would be administered to achieve dimerization using a single agent.

[00138] Anexemplary truncCasp9 sequence is set forth below as SEQ ID NO:6:

[00139] The derivative of the caspase 9 domain may comprise at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity, or 100% identity to SEQ ID NO: 6. MDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSS LHFMVEVKGDLTAKKMVLALLELARQDHGALDCCVVVILSHGCQASHLQFPGAVYGT DGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEP DATPFQEGLRTFDQLDAISSLPTPSDIFVS YSTFPGFVSWRDPKSGS WY VETLDDIFEQW AHSEDLQSLLLRVANAVS VKGIYKQMPGCFNFLRKKLFFKTS 6.3.3. The Linker

[00140] The modified ERT2 peptide-suicide protein fusion polypeptide of the disclosure may comprise an optional linker sequence between the modified ERT2 peptide and the suicide protein sequence.

[00141] Suitable linkers for use in the fusion polypeptide of the present disclosure are well known to those of skill in the art and include peptide linkers. In particular embodiments, the linker is used to separate the modified ERT2 peptide and the suicide protein sequence by a distance sufficient to ensure that the suicide protein retains its function. Preferred peptide linker sequences adopt a flexible extended conformation and do not exhibit a propensity for developing an ordered secondary structure.

[00142] Typical amino acids in flexible peptide linkers include Gly, Asn and Ser. Accordingly, in particular embodiments, the linker comprises a combination of one or more of Gly, Asn and Ser amino acids. Other near neutral amino acids, such as Thr and Ala, also may be used in the linker sequence. Exemplary linkers are disclosed in Maratea et al.,1985, Gene 40: 39-46; Murphy ef al., 1986, Proc. Nat’l. Acad. Sci. USA 83: 8258-62; U.S. Pat. No. 4,935,233; and U.S. Pat. No. 4,751,180, the contents of which are incorporated herein in their entireties.

[00143] Peptide linkers can be one amino acid sequence or repeats of one or more amino acid sequences. In some embodiments, a sequence can be used in repeats of 2. In some embodiments, a sequence can be used in repeats of 3. In some embodiments, a sequence can be used in repeats of 4. In some embodiments, a sequence can be used in repeats of 5 or more.

[00144] In some embodiments, the peptide linker is between | and 30 amino acids in length. In various aspects, the peptide linker is between | and 3 amino acids in length, between 3 and 8 amino acids in length, between 3 and 10 amino acids in length, between 5 and 15 amino acids in 35 WO 2024 / 163957 PCT / US2024 / 014331 length, between 11 and 20 amino acids in length, between 15 and 25 amino acids in length, between 21 and 30 amino acids in length, or is a length range bounded by any pair of the forgoing values (e.g., between 3 and 15 amino acids in length, between 8 and 20 amino acids in length, between 25 and 30 amino acids in length, and so on and so forth).

[00145] Non-limiting examples of linker sequences are set forth in Table 2 below. 6.4. Construct Sequences

[00146] In some embodiments, a targeting construct comprises one or more modified ERT2 peptide sequences and one or more suicide proteins. In some embodiments, a targeting construct comprises | or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, or 8 or more distinct modified ERT2 peptide sequences. In some embodiments, a targeting construct comprises | or more, 2 or more, 3 or more, 4 or more, or 5 or more copies of a single modified ERT2 peptide sequence. In some embodiments, a targeting construct comprises | or more, 2 or more, 3 or more, 4 or more, 5 or more copies of distinct modified ERT2-Caspase9 constructs. In some embodiments, a targeting construct comprises | or more, 2 or more, 3 or more, 4 or more, 5 or more copies of distinct modified ERT2-truncCaspase9 constructs.

[00147] Insome embodiments, a targeting construct comprises an ERT2*mut81 sequence and an ERT2*mut88 sequence. In some embodiments, a targeting construct comprises an ERT2*mut81 sequence and an ERT2*mut63 sequence. In some embodiments, a targeting construct comprises an ERT2*mut81 sequence and an ERT2*mut41 sequence. In some embodiments, a targeting construct comprises an ERT2*mut81 sequence and an ERT2*mut5 1 sequence. In some embodiments, a targeting construct comprises an ERT2*mut81 sequence and 36 WO 2024 / 163957 PCT / US2024 / 014331 an ERT2*mut37 sequence. In some embodiments, a targeting construct comprises an ERT2*mut81 sequence and an ERT2*mut94 sequence. In some embodiments, a targeting construct comprises an ERT2*mut81 sequence and an ERT2*mut41v2 sequence. In some embodiments, a targeting construct comprises an ERT2*mut88 sequence and an ERT2*mut63 sequence. In some embodiments, a targeting construct comprises an ERT2*mut88 sequence and an ERT2*mut41 sequence. In some embodiments, a targeting construct comprises an ERT2*mut88 sequence and an ERT2*mut51 sequence. In some embodiments, a targeting construct comprises an ERT2*mut88 sequence and an ERT2*mut37 sequence. In some embodiments, a targeting construct comprises an ERT2*mut88 sequence and an ERT2*mut94 sequence. In some embodiments, a targeting construct comprises an ERT2*mut88 sequence and an ERT2*mut41v2 sequence. In some embodiments, a targeting construct comprises an ERT2*mut63 sequence and an ERT2*mut41 sequence. In some embodiments, a targeting construct comprises an ERT2*mut63 sequence and an ERT2*mut51 sequence. In some embodiments, a targeting construct comprises an ERT2*mut63 sequence and an ERT2*mut37 sequence. In some embodiments, a targeting construct comprises an ERT2*mut63 sequence and an ERT2*mut94 sequence. In some embodiments, a targeting construct comprises an ERT2*mut63 sequence and an ERT2*mut41v2 sequence. In some embodiments, a targeting construct comprises an ERT2*mut41 sequence and an ERT2*mut51 sequence. In some embodiments, a targeting construct comprises an ERT2*mut41 sequence and an ERT2*mut37 sequence. In some embodiments, a targeting construct comprises an ERT2*mut41 sequence and an ERT2*mut94 sequence. In some embodiments, a targeting construct comprises an ERT2*mut41 sequence and an ERT2*mut41v2 sequence. In some embodiments, a targeting construct comprises an ERT2*mut51 sequence and an ERT2*mut37 sequence. In some embodiments, a targeting construct comprises an ERT2*mut51 sequence and an ERT2*mut94 sequence. In some embodiments, a targeting construct comprises an ERT2*mut51 sequence and an ERT2*mut41v2 sequence. In some embodiments, a targeting construct comprises an ERT2*mut37 sequence and an ERT2*mut94 sequence. In some embodiments, a targeting construct comprises an ERT2*mut37 sequence and an ERT2*mut41v2 sequence. In some embodiments, a targeting construct comprises an ERT2*mut94 sequence and an ERT2*mut41v2 sequence.

[00148] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 37 WO 2024 / 163957 PCT / US2024 / 014331 99.9% identical to an amino acid sequence set forth in SEQ ID NO: 13, 15, 17, 19, 21, 23, 25, 27, 44, 46, 48, or 50.

[00149] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 13. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 13.

[00150] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 38 WO 2024 / 163957 PCT / US2024 / 014331 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 15. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 15.

[00151] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% 39 WO 2024 / 163957 PCT / US2024 / 014331 identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 17. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 17.

[00152] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% 40 WO 2024 / 163957 PCT / US2024 / 014331 identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 19.

[00153] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% 4] WO 2024 / 163957 PCT / US2024 / 014331 identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 21. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 21.

[00154] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% 42 WO 2024 / 163957 PCT / US2024 / 014331 identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 23. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 23.

[00155] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 25. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID 43 WO 2024 / 163957 PCT / US2024 / 014331 NO: 25. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 25.

[00156] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 27. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 27.

[00157] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 44 WO 2024 / 163957 PCT / US2024 / 014331 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 44. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 44.

[00158] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% 45 WO 2024 / 163957 PCT / US2024 / 014331 identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 46. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 46.

[00159] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% 46 WO 2024 / 163957 PCT / US2024 / 014331 identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 48. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 48.

[00160] In some embodiments, a targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 80% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 91% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 92% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 93% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 94% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 96% 47 WO 2024 / 163957 PCT / US2024 / 014331 identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 97% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 98% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 99% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.5% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises an amino acid sequence at least 99.9% identical to the amino acid sequence set forth in SEQ ID NO: 50. In some embodiments, a targeting construct comprises the amino acid sequence set forth in SEQ ID NO: 50. 6.5. Target Cells

[00161] In some embodiments, a targeting construct is introduced into target cells or populations of target cells in order to produce engineered target cells in which a modified ERT2 peptide-suicide protein fusion polypeptide coding sequence is integrated into and expressed from a STEL locus.

[00162] In some embodiments, the methods of the disclosure may be employed to express a modified ERT2 peptide-suicide protein fusion polypeptide in mitotic or post-mitotic target cells in vivo and / or ex vivo and / or in vitro (e.g., to produce engineered target cells that can be reintroduced into an individual).

[00163] Any type of cell that may be of interest may be engineered to incorporate a modified ERT2 peptide-suicide protein fusion polypeptide coding sequence into a STEL locus. In various embodiments, the target cell is a stem cell, e.g., a human embryonic stem cell (hESC), an induced pluripotent stem cell (iPSC), a germ cell; a somatic cell, e.g., a fibroblast, a hematopoietic cell, a neuron, a muscle cell, a bone cell, a hepatocyte, a pancreatic cell; an in vitro or in vivo embryonic cell of an embryo at any stage, e.g., a 1-cell, 2-cell, 4-cell, 8-cell, etc. stage zebrafish embryo; efc.). Cells may be from established cell lines, or they may be primary cells, where “primary cells”, “primary cell lines”, and “primary cultures” are used interchangeably herein to refer to cells and cells cultures that have been derived from a subject and allowed to grow in vitro for a limited number of passages, e.g., splittings, of the culture. For example, primary cultures include cultures that may have been passaged 0 times, 1| time, 2 times, 4 times, 5 times, 10 times, or 15 times, but not enough times to go through the crisis stage. Primary cell lines can be maintained for fewer than 10 passages in vitro. Target cells are, in 48 WO 2024 / 163957 PCT / US2024 / 014331 some embodiments, unicellular organisms, or are grown in culture. Preferably, the target cells are of human origin.

[00164] In some embodiments, a cell engineered to incorporate a modified ERT2 peptide- suicide protein fusion polypeptide coding sequence is a cell therapy modality. In some embodiments, the cell therapy modality is an autologous cell therapy modality. In some embodiments, the cell therapy modality is an allogeneic cell therapy modality.

[00165] If the cells are primary cells, such cells may be harvested from an individual by any suitable method. For example, leukocytes may be suitably harvested by apheresis, leukocytapheresis, density gradient separation, etc., while cells from tissues such as skin, muscle, bone marrow, spleen, liver, pancreas, lung, intestine, stomach, efc. are most suitably harvested by biopsy. An appropriate solution may be used for dispersion or suspension of the harvested cells. Such solution will generally be a balanced salt solution, e.g., normal saline, phosphate-buffered saline (PBS), Hank’s balanced salt solution, efc., suitably supplemented with fetal calf serum or other naturally occurring factors, in conjunction with an acceptable buffer at low concentration, e.g., from 5-25 mM. Suitable buffers include HEPES, phosphate buffers, lactate buffers, etc. The cells may be used immediately, or they may be stored, frozen, for long periods of time, being thawed and capable of being reused. In such cases, the cells will generally be frozen in 10% dimethyl] sulfoxide (DMSO), 50% serum, 40% buffered medium, or some other such solution as is commonly used in the art to preserve cells at such freezing temperatures and thawed in a manner as commonly known in the art for thawing frozen cultured cells.

[00166] In some embodiments, a targeting construct is introduced into a target cell via nucleofection, as part of a gene editing system (e.g., a CRISPR / Cas-based gene editing system) design to cleave target sequences within or near (e.g., flanking or adjoining) a STEL locus to facilitate homologous recombination of the targeting constructs of the target sequences. In some embodiments, the gene editing system comprises an endonuclease (e.g., a Cas nuclease), a guide RNA (e.g., single guide RNA or sgRNA), as well as the targeting construct. In some embodiments, the gene editing system is in the form of a composition known as a ribonucleoprotein or RNP complex. An RNP complex is assembled by combining an endonuclease with a ribonucleic acid. 6.5.1. Stem Cells

[00167] In some embodiments, the target cells that are engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide from a STEL locus are stem cells, particularly pluripotent stem cells (PSCs) such as induced pluripotent stem cells GPSCs) or human embryonic stem cells (hESCs), which are the starting point for the potential generation of large 49 WO 2024 / 163957 PCT / US2024 / 014331 numbers of a specific cell type that can be delivered for regenerative medicine in patients with many different diseases. In some embodiments, the stem cells are human stem cells.

[00168] Following engineering to a PSC to express a modified ERT2 peptide-suicide protein fusion polypeptide the PSC can be differentiated into a cell type of interest for cell therapy.

[00169] The PSCs, e.g., ESCs or recombinant PSCs can be differentiated into cells suitable for therapy, including the cells in the endoderm (e.g., lung, thyroid, or pancreatic cells, or progenitors thereof), ectoderm (e.g., skin, neuronal, or pigment cells, or progenitors thereof), and mesoderm (e.g., cardiac cells, skeletal muscle cells, red blood cells, smooth muscle cells, or progenitors thereof) lineages.

[00170] In some embodiments, the PSCs, e.g., ESCs or recombinant PSCs are differentiated into cardiovascular cells (cardiovascular cells (e.g., cardiomyocytes, pacemaker cell, cardiac fibroblasts, epicardial cells, endocardial cells, valvular interstitial cells, cardiac and vascular smooth muscle cells, cardiac and vascular endothelial cells, Purkinje fibers, or His-bundle cells)

[00171] In some embodiments, the PSCs, e.g., ESCs or recombinant PSCs are differentiated into cells in the endoderm (e.g., lung, thyroid, or pancreatic cells, or progenitors thereof), ectoderm (e.g., skin, neuronal, or pigment cells, or progenitors thereof) or mesoderm (e.g., cardiac cells, skeletal muscle cells, red blood cells, smooth muscle cells, or progenitors thereof) lineages.

[00172] In some embodiments, a recombinant PSC of the disclosure is differentiated into a cardiac cell, or a precursor or progenitor cell thereof. In various embodiments, the cardiac cell is a cardiac progenitor cell or a mature or immature (atrial or ventricular) cardiomyocyte. In other embodiments, the cardiac cell is a cardiac endothelial cell or a nodal cell.

[00173] In some embodiments, a recombinant PSC of the disclosure is differentiated into a regulatory T cell, a myeloid cell, a dendritic cell, a macrophage (e.g., an immunosuppressive macrophage), a myeloid progenitor cell, or a precursor or progenitor cell thereof. Details on differentiation of PSCs into myeloid progenitor cells can be found in International (PCT) Publication Numbers WO 2023 / 150089 Al and WO 2017 / 152081 Al.

[00174] In some embodiments, a recombinant PSC of the disclosure is a neural cell or a precursor or progenitor cell thereof. In some embodiments, a neural cell is a microglia, a macroglia (e.g., oligodendrocytes, an astrocytes, a Schwann cells, or an enteric glia) and neurons, or neural stem and precursor cells or progenitor cells of any of the foregoing cells. In some embodiments, a recombinant PSC of the disclosure is differentiated into an oligodendrocyte progenitor cell or an oligodendrocyte. 50 WO 2024 / 163957 PCT / US2024 / 014331

[00175] In some embodiments, a recombinant PSC of the disclosure is differentiated into a neural lineage cell, for example a neural crest cells, an astrocyte, a dopaminergic neuron progenitor cell, a dopaminergic neuron cells, a midbrain dopaminergic neuron progenitor cell, a midbrain dopaminergic neuron, an authentic midbrain dopamine (DA) neuron, a dopaminergic neuron precursor cell, a floor plate midbrain progenitor cell, a floor plate midbrain DA neuron.

[00176] In some embodiments, a recombinant PSC of the disclosure is differentiated into a cell of the ocular system, such as a photoreceptor cell, a photoreceptor precursor cell, a retinal pigmented epithelium cell, a neural retinal cell, a neural retinal progenitor cell, or a precursor or progenitor cell thereof.

[00177] In further embodiments, a recombinant PSC of the disclosure is differentiated into a microglial cell or a microglial progenitor cell.

[00178] In further embodiments, a recombinant PSC of the disclosure is differentiated into a cell in the human metabolic system, optionally selected from a hepatocyte, a cholangiocyte, and a pancreatic beta cell, or a precursor or progenitor cell thereof.

[00179] In further embodiments, a recombinant PSC of the disclosure is differentiated into an enteric progenitor cell or an enteric cell. 6.5.2. Differentiated Cells

[00180] In various embodiments, a cell at any stage of differentiation is engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide. The differentiated cell may be derived from an engineered iPSC disclosed herein.

[00181] Exemplary differentiated cell types that can be engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide include the cells in the endoderm (e.g., lung, thyroid, or pancreatic cells, or progenitors thereof), ectoderm (e.g., skin, neuronal, or pigment cells, or progenitors thereof) and mesoderm (e.g., cardiac cells, skeletal muscle cells, red blood cells, smooth muscle cells, or progenitors thereof) lineages. Alternatively, PSCs can be differentiated into cells in these lineages and then engineered with a targeting construct of the disclosure.

[00182] In some embodiments, a cardiac cell is engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide. In some embodiments, the cardiac cell is a cardiac progenitor cell or a mature or immature (atrial or ventricular) cardiomyocyte. In other embodiments, the cardiac cell is a cardiac endothelial cell or a nodal cell.

[00183] Differentiated cell types can include cardiovascular cells (e.g., cardiomyocytes, pacemaker cell, cardiac fibroblasts, epicardial cells, endocardial cells, valvular interstitial cells, 51 WO 2024 / 163957 PCT / US2024 / 014331 cardiac and vascular smooth muscle cells, cardiac and vascular endothelial cells, Purkinje fibers, or His-bundle cells).

[00184] In some embodiments, a human immune cell selected from a regulatory T cell, a myeloid cell, a dendritic cell, and / or a macrophage (e.g., an immunosuppressive macrophage), or a precursor or progenitor cell thereof is engineered to express a modified ERT2 peptide- suicide protein fusion polypeptide.

[00185] In some embodiments, a neural cell or a precursor or progenitor cell thereof, is engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide. In some embodiments, a neural cell is a microglia, a macroglia (e.g., oligodendrocytes, an astrocytes, a Schwann cells, or an enteric glia) and neurons, or neural stem and precursor cells of any of the foregoing cells. In some embodiments, an oligodendrocyte progenitor cell or an oligodendrocyte is engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide.

[00186] In some embodiments, a neural lineage cell is engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide. In various embodiments, the neural lineage cell is a neural crest cell, an astrocyte, a dopaminergic neuron progenitor cell, a dopaminergic neuron cells, a midbrain dopaminergic neuron progenitor cell, a midbrain dopaminergic neuron, an authentic midbrain dopamine (DA) neuron, a dopaminergic neuron precursor cell, a floor plate midbrain progenitor cell, a floor plate midbrain DA neuron.

[00187] In some embodiments, a cell of the ocular system or a precursor or progenitor cell thereof is engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide. In various embodiments, the cell of the ocular system is a photoreceptor cell, a photoreceptor precursor cell, a retinal pigmented epithelium cell, a neural retinal cell, or a neural retinal progenitor cell.

[00188] In further embodiments, a microglial cell or a microglial progenitor cell is engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide.

[00189] In further embodiments, a cell in the human metabolic system is engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide. In various embodiments, the cell in the human metabolic system is optionally selected from a hepatocyte, a cholangiocyte, and a pancreatic beta cell or a precursor or progenitor cell thereof.

[00190] In further embodiments, an enteric progenitor cell or an enteric cell is engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide.

[00191] In some embodiments of any of the aforementioned cells, the cell is a human cell.

[00192] Any of the foregoing differentiated cell types can be differentiated from PSCs prior to engineering them to express a modified ERT2 peptide-suicide protein fusion polypeptide. 52 WO 2024 / 163957 PCT / US2024 / 014331 6.6. Methods of Administration

[00193] The present disclosure provides methods of using the therapeutic cells disclosed herein for treating a patient in need of cell therapy. The methods comprise administering to the patient a gene-edited target cell engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide from a STEL locus, for example a gene-edited target cell as disclosed in Section 6.4 or any subsection thereof. In some embodiments, the gene-edited target cell is comprised in a pharmaceutical composition comprising a pharmaceutically acceptable carrier.

[00194] The methods can further comprise controlling the gene-edited target cell population in the patient by (a) optionally monitoring the gene-edited target cell population in the patient; and / or (b) administering an inducer of the modified ER-LBD (e.g., an estrogen antagonist) if the patient experiences adverse events related to the gene-edited target cell population.

[00195] The present disclosure further provides methods of mitigating adverse events or a safety risk associated with cell therapy in the form of gene-edited target cells engineered to express a modified ERT2 peptide-suicide protein fusion polypeptide from a STEL locus, e.g., gene-edited target cell as disclosed in Section 6.4 or any subsection thereof, comprising administering to a patient who received the gene-edited target cells an inducer of a modified ER- LBD (e.g., an estrogen antagonist) if the patient experiences adverse events or a safety risk related to the gene-edited target cells or pharmaceutical composition.

[00196] In some embodiments, the inducer of the modified ER-LBD is an estrogen agonist such as tamoxifen or a tamoxifen metabolite.

[00197] In some aspects, the methods comprise administering a single inducer of the modified ER-LBD. In some embodiments, the single inducer of the modified ER-LBD is tamoxifen, 4-OHT, N-desmethyltamoxifen, tamoxifen-N-oxide, or endoxifen.

[00198] In some aspects, the methods comprise administering a combination of two or more inducers of the modified ER-LBD. In some embodiments, the combination of inducers of the modified ER-LBD comprises one or more of, or optionally two or more of, tamoxifen, 4-OHT, N-desmethyltamoxifen, tamoxifen-N-oxide, and endoxifen, in any combination (e.g., a combination comprising 4-OHT and endoxifen). Without being bound by theory, it is believed that administering a combination of two or more inducers of the modified ER-LBD can result in synergistic activity, thereby lowering the dosages required to achieve apoptosis as compared to administration of a single agent. 7. ADDITIONAL EMBODIMENTS 1. A targeting construct comprising: 53 WO 2024 / 163957 PCT / US2024 / 014331 (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (i) a modified estrogen receptor ligand binding domain (ER-LBD); and (i1) a caspase 9 domain or derivative or functional fragment thereof; (c) a second homology arm corresponding to a 3' target sequence comprising second region of homology to the target genomic locus wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the modified ER-LBD comprises a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: (i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, Gi) an L391V substitution, a N413D substitution, a Q414E substitution, a $463P substitution, and a H524F substitution, (ii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, aM421L substitution, aM517A substitution, and a H524F substitution, (iv) an L354] substitution, a L391¥V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, 54 WO 2024 / 163957 PCT / US2024 / 014331 (v) an L391¥V substitution, a Q414E substitution, an N413D substitution, an $463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an MS517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354] substitution, an L384M substitution, an H524L substitution, or (viii) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element. 2. The targeting construct of embodiment | or 108, wherein the additional amino acid substitutions comprise: an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of (SEQ ID NO:2). 3. The targeting construct of embodiment 2, wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:2. 4. The targeting construct of embodiment 2, wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:2. 5. The targeting construct of embodiment | or 108, wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:2. 55 WO 2024 / 163957 PCT / US2024 / 014331 6. The targeting construct of embodiment | or 108, wherein the additional amino acid substitutions comprise: an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:3. 7. The targeting construct of embodiment 6, wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:3. 8. The targeting construct of embodiment 6, wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:3. 9. The targeting construct of embodiment | or 108, wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:3. 10. The targeting construct of embodiment | or 108, wherein the additional amino acid substitutions comprise: an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, aM421L substitution, aM517A substitution, and a H524F substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:4. 11. The targeting construct of embodiment 10, wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:4. 12. The targeting construct of embodiment 10, wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:4. 56 WO 2024 / 163957 PCT / US2024 / 014331 13. The targeting construct of embodiment | or 108, wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:4. 14. The targeting construct of embodiment | or 108, wherein the additional amino acid substitutions comprise: an L354] substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:5. 15. The targeting construct of embodiment 14, wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:5. 16. The targeting construct of embodiment 14, wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:5. 17. The targeting construct of embodiment | or 108, wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:5. 18. The targeting construct of embodiment | or 108, wherein the additional amino acid substitutions comprise: an L391V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:40. 19. The targeting construct of embodiment 18, wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:40. 57 WO 2024 / 163957 PCT / US2024 / 014331 20. The targeting construct of embodiment 18, wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:40. 21. The targeting construct of embodiment | or 108, wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:40. 22. The targeting construct of embodiment | or 108, wherein the additional amino acid substitutions comprise: an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:41. 23. The targeting construct of embodiment 22, wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:41. 24. The targeting construct of embodiment 22, wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:41. 25. The targeting construct of embodiment | or 108, wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:41. 26. The targeting construct of embodiment | or 108, wherein the additional amino acid substitutions comprise: an N413D substitution, an S463P substitution, an L354I substitution, an L384M substitution, an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:42. 58 WO 2024 / 163957 PCT / US2024 / 014331 27. The targeting construct of embodiment 26, wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:42. 28. The targeting construct of embodiment 26, wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:42. 29. The targeting construct of embodiment | or 108, wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:42. 30. The targeting construct of embodiment | or 108, wherein the additional amino acid substitutions comprise: an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:43. 31. The targeting construct of embodiment 30, wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:43. 32. The targeting construct of embodiment 30, wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:43. 33. The targeting construct of embodiment | or 108, wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:43. 34. The targeting construct of any one of embodiments | to 33 or 108, wherein the modified ERT2 peptide further comprises an N-terminal serine (S) residue. 35. The targeting construct of any one of embodiments | to 34 or 108, wherein the modified ER- LBD comprises the V595A amino acid substitution. 59 WO 2024 / 163957 PCT / US2024 / 014331 36. The targeting construct of any one of embodiments | to 35 or 108, wherein the caspase 9 domain or derivative or functional fragment thereof does not comprise a Caspase Activation and Recruitment Domain (CARD) domain sequence . 37. The targeting construct of any one of embodiments | to 36 or 108, wherein the caspase 9 domain or derivative or functional fragment thereof comprises (SEQ ID NO:6). 38. The targeting construct of any one of embodiments | to 37 or 108, wherein the modified estrogen receptor ligand binding domain (ER-LBD) is N-terminal to the caspase 9 domain or derivative or functional fragment thereof. 39. The targeting construct of any one of embodiments | to 38 or 108, wherein the modified estrogen receptor ligand binding domain (ER-LBD) is C-terminal to the caspase 9 domain or derivative or functional fragment thereof. 40. The targeting construct of any one of embodiments | to 39 or 108, wherein the fusion polypeptide comprises a linker between the modified estrogen receptor ligand binding domain (ER-LBD) and the caspase 9 domain or derivative or functional fragment thereof. 41. The targeting construct of any one of embodiments | to 40 or 108, which is configured such that upon its recombination with the target genomic locus, the STEL gene is modified such to incorporate the fusion polypeptide coding sequence 3' to the STEL protein coding sequence. 42. The targeting construct of any one of embodiments 1 to 40 or 108, which is configured such that upon its recombination with the target genomic locus, the STEL gene is modified such to incorporate the fusion polypeptide coding sequence 5' to the STEL protein coding sequence. 43. The targeting construct of any one of embodiments | to 41 or 108, wherein the nucleotide insert further comprises a nucleotide sequence encoding a separator sequence. 44. The targeting construct of embodiment 43, which is configured such that upon recombination of the targeting construct with the target genomic locus, the separator sequence coding sequence is positioned between the coding sequence of the STEL protein and the fusion polypeptide coding sequence. 60 WO 2024 / 163957 PCT / US2024 / 014331 45. The targeting construct of embodiment 43 or embodiment 44, wherein the separator sequence is an internal ribosome entry site (“IRES”). 46. The targeting construct of embodiment 43 or embodiment 44, wherein the separator sequence is a self-cleaving peptide. 47. The targeting construct of embodiment 46, wherein the self-cleaving peptide is a 2A peptide. 48. The targeting construct of embodiment 46 or embodiment 47, wherein the self-cleaving peptide is T2A, P2A, E2A, F2A, PQR, Opt2A, or Opt2A_2.0. 49. The targeting construct of any one of embodiments | to 48 or 108, wherein the STEL gene encodes a polypeptide involved in one or more of: glycolysis, ribonucleopolypeptide complex formation, focal adhesion, cell-substrate adherens junction, cell-substrate junction, cell anchoring, extracellular exosome, extracellular vesicle, intracellular organelle, anchoring junction, RNA binding, nucleic acid binding (e.g., rRNA or mRNA binding), and polypeptide binding. 50. The targeting construct of any one of embodiments | to 49 or 108, wherein the STEL gene encodes a ribosomal polypeptide. 51. The targeting construct of embodiment 50, wherein the STEL gene is RPLI3A, RPLPO, RPL1O, RPL13, RPSJ8, RPL3, RPLP1, RPL15, RPL41, RPL11, RPL32, RPL18 A, RPL19, RPL28, RPL29, RPL9, RPL8, RPL6, RPL18, RPL7, RPL7A, RPL21, RPL37A, RPL 12, RPLS5, RPL34, RPL35A, RPL30, RPL24, RPL39, RPL37, RPL14, RPL27A, RPLP2, RPL23A, RPL26, RPL36, RPL35, RPL23, RPL4, or RPL22. 52. The targeting construct of any one of embodiments | to 50 or 108, wherein the STEL gene encodes a ribosomal polypeptide small subunit (RPS). 53. The targeting construct of embodiment 52, wherein the STEL gene is RPS2, RPS19, RPS14, RPS3A, RPS12, RPS3, RPS6, RPS23, RPS27A, RPS8, RPS4X, RPS7, RPS24, RPS27, RPSI5A, RPS9, RPS28, RPS13, RPSA, RPS5, RPS 16, RPS25, RPS15, RPS20, or RPS11. 54. The targeting construct of any one of embodiments | to 49 or 108, wherein the STEL gene encodes a mitochondrial polypeptide. 61 WO 2024 / 163957 PCT / US2024 / 014331 55. The targeting construct of embodiment 54, wherein the STEL gene is MT-CO1, MT-CO2, MT-ND4, MT-ND1, or MT-ND2. 56. The targeting construct of any one of embodiments | to 49 or 108, wherein the STEL gene encodes an actin polypeptide. 57. The targeting construct of embodiment 56, wherein the STEL gene is ACTG1 or ACTB. 58. The targeting construct of any one of embodiments | to 49 or 108, wherein the STEL gene encodes a eukaryotic translation factor. 59. The targeting construct of embodiment 58, wherein the STEL gene is EEF1A1, EEF2, or EIF1. 60. The targeting construct of any one of embodiments | to 49 or 108, wherein the STEL gene encodes a histone. 61. The targeting construct of embodiment 60, wherein the STEL gene is H3F3A or H3F3B. 62. The targeting construct of any one of embodiments | to 49 or 108, wherein the STEL gene is FTL, FTH1, TPT1, IMSB10, GAPDH, PTMA, GNB2L1, NACA, YBX1, NPM1, FAU, UBA52, HSP90AB1, MYL6, SERF2, or SRP14. 63. The targeting construct of embodiment 62, wherein the STEL gene is GAPDH. 64. The targeting construct of embodiment 62, wherein the STEL gene is RPLI3A. 65. The targeting construct of embodiment 62, wherein the STEL gene is RPL7. 66. The targeting construct of embodiment 62, wherein the STEL gene is RPLPO. 67. The targeting construct of any one of embodiments | to 66 or 108, wherein the nucleotide insert further comprises a transgene. 68. The targeting construct of embodiment 67, wherein the transgene is linked to the fusion polypeptide coding sequence. 62 WO 2024 / 163957 PCT / US2024 / 014331 69. The targeting construct of embodiment 68, wherein the fusion polypeptide coding sequence and transgene are connected via a nucleotide sequence encoding a separator sequence. 70. The targeting construct of embodiment 69, wherein the separator sequence is an internal ribosome entry site (“IRES”). 71. The targeting construct of embodiment 69, wherein the separator sequence is a nucleotide sequence encoding a self-cleaving peptide (the “self-cleaving peptide coding sequence’’). 72. The targeting construct of embodiment 71, wherein the self-cleaving peptide is a 2A peptide. 73. The targeting construct of embodiment 71 or embodiment 72, wherein the self-cleaving peptide is T2A, P2A, E2A, F2A, PQR, Opt2A, or Opt2A_2.0. 74. The targeting construct of any one of embodiments 67 to 73, wherein the transgene encodes a therapeutic polypeptide. 75. A system comprising: (a) the targeting construct of any one of embodiments | to 74, or 106-108; (b) a CRISPR-associated endonuclease (“Cas polypeptide”) or a nucleic acid encoding a Cas polypeptide; and (c) a guide RNA (“gRNA”) comprising a scaffold for binding the Cas polypeptide and a spacer sequence corresponding to the STEL gene, or a nucleic acid encoding the gRNA. 76. The system of embodiment 75, wherein the guide RNA is a single guide RNA (“sgRNA”). 77. The system of embodiment 75 or embodiment 76, which comprises the Cas polypeptide and gRNA. 78. The system of any one of embodiments 75 to 77, which is in the form of a ribonucleoprotein particle (“RNP”). 79. A method of producing a gene-edited target cell, comprising: 63 WO 2024 / 163957 PCT / US2024 / 014331 (a) introducing the system of any one of embodiments 75 to 78 into a target cell; and (b) culturing the target cell under conditions in which gene editing occurs, thereby producing gene-edited target cell. 80. The method of embodiment 79, wherein the target cell is a stem cell or a cell differentiated from a stem cell. 81. The method of embodiment 79 or embodiment 80, wherein the target cell is a stem cell. 82. The method of embodiment 81, wherein the stem cell is a human embryonic stem cell, an induced pluripotent stem cell (“iPSC”) or a cell differentiated therefrom. 83. The method of any one of embodiments 79 to 81, wherein the target cell is: (a) a regulatory T cell, a myeloid cell, a dendritic cell, a macrophage (e.g., an immunosuppressive macrophage), a myeloid progenitor cell, or a precursor or progenitor cell thereof; (b) a cell in the human nervous system, optionally selected from dopaminergic neuron, a microglial cell, an oligodendrocyte, an astrocyte, a cortical neuron, a spinal or oculomotor neuron, an enteric neuron, a Placode-derived cell, a Schwann cell, and a trigeminal or sensory neuron, or a precursor or progenitor cell thereof; (c) a cell in the human cardiovascular system, optionally selected from a cardiomyocyte, an endothelial cell, and a nodal cell, or a precursor or progenitor cell thereof; (d) a cell in the human metabolic system, optionally selected from a hepatocyte, a cholangiocyte, and a pancreatic beta cell, or a precursor or progenitor cell thereof, or (e) a cell in the human ocular system, optionally selected from a retinal pigment epithelial cell, a photoreceptor cone cell, a photoreceptor rod cell, a bipolar cell, a ganglion cell, or a precursor or progenitor cell thereof. 84. The method of any one of embodiments 79 to 83, wherein the gene-edited target cell is of ectoderm lineage, optionally wherein the gene-edited target cell is a neuron. 64 WO 2024 / 163957 PCT / US2024 / 014331 85. The method of any one of embodiments 79 to 83, wherein the gene-edited target cell is of mesoderm lineage, optionally wherein the gene-edited target cell is a cardiomyocyte. 86. A gene-edited target cell obtained or obtainable by the method of any one of embodiments 79 to 85. 87. A gene-edited target cell comprising a STEL gene that comprises a nucleic acid encoding a fusion polypeptide under the transcriptional control of a STEL gene regulatory element, the fusion polypeptide comprising: (a) a modified estrogen receptor ligand binding domain (ER-LBD); and (b) a caspase 9 domain or derivative or functional fragment thereof, wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the modified ER-LBD comprises a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: (i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, (ii) an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution, (iii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, aM517A_ substitution, and a H524F substitution, (iv) an L354] substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, 65 WO 2024 / 163957 PCT / US2024 / 014331 (v) an L391¥V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L354I substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354I substitution, an L384M substitution, an H524L substitution, or (viii) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution. 88. The gene-edited target cell of embodiment 87, wherein the modified ER-LBD is as defined in any one of embodiments 2 to 35. 89. The gene-edited target cell of embodiment 87 or embodiment 88, wherein the caspase 9 domain or derivative or functional fragment thereof is as defined in any one of embodiments 36 to 37. 90. The gene-edited target cell of any one of embodiments 87 to 89, wherein the fusion polypeptide is as defined in any one of embodiments 38 to 40. 91. The gene-edited target cell of any one of embodiments 87 to 90, wherein the STEL gene is configured as defined in any one of embodiments 41 to 66. 92. The gene-edited target cell of any one of embodiments 87 to 91, which further comprises a transgene in the STEL gene. 93. The gene-edited target cell of embodiment 92, wherein the transgene is as defined in any one of embodiments 67 to 74. 94. The gene-edited target cell of any one of embodiments 87 to 93, wherein the target cell is as defined in any one of embodiments 80 to 86. 95. A pharmaceutical composition comprising the gene-edited target cell of any one of embodiments 86 to 94 and a pharmaceutically acceptable carrier. 66 WO 2024 / 163957 PCT / US2024 / 014331 96. A method of treating a patient in need thereof, comprising administering to the patient the gene-edited target cell of any one of embodiments 86 to 94 or a pharmaceutical composition the gene-edited target cell of any one of embodiments 86 to 94 and a pharmaceutically acceptable carrier. 97. The method of embodiment 96, which further comprises controlling the gene-edited target cell population in the patient by: (a) Monitoring, optionally, the gene-edited target cell population in the patient; and / or (b) administering an inducer of the modified ER-LBD if the patient experiences adverse events related to the gene-edited target cell population. 98. A method of mitigating adverse events or a safety risk associated with cell therapy in the form of the gene-edited target cells any one of embodiments 86 to 94 or the pharmaceutical composition of embodiment 95, the method comprising administering to a patient who received the gene-edited target cells or pharmaceutical composition an inducer of a modified ER-LBD if the patient experiences adverse events or a safety risk related to the gene-edited target cells or pharmaceutical composition. 99. The method of embodiment 97 or embodiment 98, wherein the inducer of the modified ER- LBD is tamoxifen or a tamoxifen metabolite. 100. The method of embodiment 99, wherein the inducer of the modified ER-LBD is tamoxifen. 101. The method of embodiment 99, wherein the inducer of the modified ER-LBD is a tamoxifen metabolite. 102. The method of embodiment 101, wherein the inducer of the modified ER-LBD is 4- hydroxytamoxifen, N- desmethyltamoxifen, tamoxifen-N-oxide, or endoxifen. 103. The method of any one of embodiments 81 to 85, wherein a combination of two or more inducers of the modified ER-LBD is administered. 67 WO 2024 / 163957 PCT / US2024 / 014331 104. The method of embodiment 103, wherein the combination comprises 4-OHT and endoxifen. 105. The method of embodiment 103 or embodiment 104, wherein the combination has a synergistic effect and / or utilizes reduced dosing (e.g., reduced dosing amount and / or frequency) than would be required a single inducer of the modified ER-LBD. 106. The targeting construct of any one of embodiments 1-74 or 108, wherein the targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to an amino acid sequence set forth in SEQ ID NO: 13, 15, 17, 19, 21, 23, 25, 27, 44, 46, 48, or 50. 107. The targeting construct of embodiment 107, wherein the targeting construct comprises an amino acid sequence set forth in SEQ ID NO: 13, 15, 17, 19, 21, 23, 25, 27, 44, 46, 48, or 50. 108. A targeting construct comprising: (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (i) a first modified estrogen receptor ligand binding domain (ER- LBD); (i1) a first caspase 9 domain or derivative or functional fragment thereof; (iii) asecond modified estrogen receptor ligand binding domain (ER-LBD); and (iv) | asecond caspase 9 domain or derivative or functional fragment thereof; 68 WO 2024 / 163957 PCT / US2024 / 014331 (c) a second homology arm corresponding to a 3' target sequence comprising second region of homology to the target genomic locus, wherein the first modified ER-LBD and the second modified ER-LBD each comprise an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the first modified ER-LBD and the second modified ER-LBD each independently comprise: a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: (i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, Gi) an L391V substitution, a N413D substitution, a Q414E substitution, a $463P substitution, and a H524F substitution, (ii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, aM421L substitution, aM517A substitution, and a H524F substitution, (iv) an L354] substitution, a L391¥V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, (v) an L391¥V substitution, a Q414E substitution, an N413D substitution, an $463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an MS517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354I substitution, an L384M substitution, an H524L substitution, or (viii) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, 69 WO 2024 / 163957 PCT / US2024 / 014331 wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element. 8. EXAMPLES 8.1. Example 1: Design and Generation of modified ERT2 peptide-Suicide Protein Constructs

[00199] Kill switch constructs of the disclosure were designed to trigger apoptosis in response to tamoxifen and / or its metabolites, which are small drugs (e.g., that may already be in routine clinical use) and may be able to penetrate through the blood-brain barrier. However, implementation of such kill switches in pluripotent stem cell (PSC)-derived cell products can be difficult because expression of transgenes can be lost after differentiating a PSC to another cell type (e.g., an immune cell such as a T cell or macrophage, a CNS cell such as a neuron, microglia, macroglia, or precursor thereof, or a cardiovascular cell). Thus, to implement such kill switches in pluripotent stem cell (PSC)-derived cell products, constructs were designed such that a modified ERT2 peptide-suicide protein fusion polypeptide sequence was flanked by homology arms complementary to genomic sequences of a sustained transcription expression locus (STEL) (FIG. 1A). See WO2021072329A1, which is incorporated herein by reference in its entirety.

[00200] Four modified ERT2 peptides (ERT2 mutants) were selected to be fused to Caspase- 9 (Table 3). All four engineered ERT2-Casp9 candidates showed greater than 95% killing efficiency after the addition of 1 uM 4-OHT, a tamoxifen metabolite in HEK293T cells within 48 hours of induction (data not shown). The resulting four kill-switch fusion polypeptide encoding sequences were inserted between the left and right homology arms targeting the GAPDH STEL with a T2A peptide sequence linking a modified ERT2 peptide-suicide protein fusion polypeptide encoding sequence to the left homology arm. (FIG. 2A). 70 WO 2024 / 163957 PCT / US2024 / 014331 ome) ss aa o 3 Feseor Sak BG = E258e 382254 GZ FES ES Se BTALS ge HAW eBAAKRHE SB S ~ ee lOO Z < a 2% SaEeESze2eSESOSEZS 2 8 Oa eEeMaARLvTDE AL Z 2A SEzS222 255% 25 PugsHR Se oa ES = oO A > 7 7s) BPreery 5s oO mw YH Se = > oh & S255 229S5s ay Zz. <TERPEFSERQEE fo > Z < x = ea < n YY > ez e o Zab ERSeEEESSE Sr>nes ozo Ez o iIGkH OE FRORRYG 2) FREESE QSERE an) S Sin >FOaAn ~ a, Fy S|4 46a MR Ook On © ® 7) pH OF | vA |< 2 J QA > ae 25822252582 22325842235 “AzieZ OEE R Eee e# eet oS we A = < > 5 3] |BESSESS e288 : r= BSCR AZAY SER = .. - SZ 22288025 B 3 : onl im 41 > n S Seo Fe ose oO fe = Q ZREL2SBSESE= a S a § eee 22555884 5S = & 2 i nN Ar Fe BD OO Ss os 8 Seen zgsgegeS Ze g rr ls = S o yr > 2a Tt 3s s g¢ 8 SSS LEZ R B2PRS s 3 3 8 aw Done ~*~ Un Wy Z eo os of 2 ) <n eo 3 eo o v 38 a ola a S| & a 15 7 | & a] 5 m= OIlN = 5|5 E |o é Zs S| 0 es 4 |¢ BIS WO 2024 / 163957 PCT / US2024 / 014331 ome) ae Ba 0 ROR QOOURYD HHOU,AD OO 26 | S8OS= Secu sUSecEeeecSEseesbsenge: in & is VOYeDRUSURSA SOEVEQDOKOSEEQVOS a LOQROVR EE O E ZOORgO Ot HPO K ZOSE 34 OL LVR REP RY COS SS OOF SUG AP UF OUUGES< Zs FOOC OVOS EYES ZG RSOZE UCR ECHO SZEOZOSE Bz tRO SGU SUB EURO EU K<OSUUU SOE 5 3 OQOUGVOSSSROYOSOR KAP OROSCRYEOOUCE OOS gM ROOD ZV OSE SEK fA eOGU SUE VO ZU0K KON VU < a8 ZEZOSGREYESUUYUSTEO SEUSS z00 ZOO SS59 2a OZR Ze SOS EO te OC GOO GOOU TOR ZSSe9 Bs teen 007oVUoxe¥eZo OUS << § HESYVESzZOsO < < EH teUO0 te UOUOYV 2 LOUSHE PO GVRRR SUE BPHERP ORY ORDOES DO<ZG SEO SES ZIROVOUOFOOEVORUESYO< CGE SR OR cZE TORSO SESS ZC SORE RH OSESE COZ BU OOSCGE USSU ABE SRS OREO CH YOO RED LOQUUOF e€EG ZEHLOVDOVEV EH Ove SORsyro O20 SP SOR SCROOUVUR COZ Se OU Vee SOE i: RRR HOSP OP Ree eS OR eG ee eGo Sse eUTr ROR ZU LHYoOUGEULYOUE 3 ot FOUARFEY KOK SOS RVR ROR Ct OV OO eS OP RMU OSEOCOLEDS OHDRVPOVOS tT 5O0OC ee OSE ese <9d teeZP Re COEUR BUGS HK Z250 25040950 Oe et OS onR GEEK ZHRLORZIOSOCO LUE ROSES OVOP OVOSEEA << O SOV EGE SOB AAR BAB ESE SCH ORVOKESE ORK FOV SK KP E ZO ORO ROVE SOU OE ZS SZOESZY CRC a ESE -E- BRO RSNA ECR OS ic Ean EES ERC E-ECROR>ECEORCRGES DOK SSE CEREBRO ROU URO SY EU OFP SKY EGgo ROUSSE ZEKE KP RG OOYV OK EPPS ORO SUS OZ VOR Eee OOS <cUZVzU9s oy S9OOR°ODzZ5SY DO e SO EO SE eF OGRE SOO SOSGOSgS LOVERS YOORZSZES ACR SE RZ OR OSOUS S SGOVSSSSEDR GU KEU KS SEP USVOLSASEED5= OB ES HO SEO OU EO USK SOO Ee zc ec SOE OSD S SOC TSO OS SEES ees SUG COOROS] a HOS SER ts KBD OS SEO SUDO SE SOG Zz0z8 é <P OOO SO EO ER ee SK OSOSOE EYED LOOSE SIH RF ZOSSEE SZ SOOSUROLSOE5 <O9505 Sh LOBE LOE GO COP O SE VOOL SO SSP Ooo StU SS Gt EPUO Ze ORAZ OREO TZ ZOROGV HOARSE ODE tC ORUU ACE SOU OSU ZUROZ SEE EUVUOOSZED OOS LLOOYVU KO ZORStTECRURU REE SOU OFELOD OLEKOGOR ELE RSH AUS OV ECF OUVOOUKVSOOROOO Re PORVOO A COL OUVOUYPOSCVEBVOTFOVOVOOVOZE ORE RE HLOOQUVUEBEDRORULSZUOVOOOROVURRUAHD Povvg0 toe fee OVocyvrctogr yvotuud PEE SSESSE SPEBSSER CUS EUR ERS B ees <0 < GOV choke Choke CRORGROROE: WO 2024 / 163957 PCT / US2024 / 014331 o° es Ae = 38 BORO SEAS PSQuee Se tyu 2 |< |ZESSSSESE So E20 RS CER EE° x a my &< Ee) 2 O laRpeRaoyitrsoa hm HS Oo ORS = g E ZnzZnQare 5S aPZO255sexc - HME EUEOZS2ZGe mode SVEOR gy 24 Y eS ez nzOngsge Heo e@YVOOR Y 8 2 S$ [SakeALO eave S85 S5SEF09Y a 8 > Bete Oe boy 9 9 tte s oe) < [3% Aw LS SSOSUCOR SE > O aS < HAVO 3 &0 a Bou < = Ho Qe Tee gxe0FOatoOEU< < § F |RRAeeoxX ea SH gs g0L2d0E <0E = EER SI5902¢ SSRECGGRHOE = |ASSeREGeaEx eect QVEOeEese - [a Arxe Soeur €ho< 22659 RP IRB SeQgktoLogs seeUVGgGesoY HK |2meanhReEaonaZ Shee ODVOEHRY Q |\BREKESZAZES > PLR RS KUOE = |SR ROSES <6LS 2eVoVoVera <q |SRR R55 <20=7°2 S8<OSoeere < |5SRGESGRZTESS Se0<850455 < ree oeate BSz09ZEOGE < |ERBOEZEROZRYG HESESSYLEO 2 |2e222bc2es2 PLE SSE bse O |R&F Re r<uee SERSLSOOLS Oo |\ZAZOELEOAOED HZOEOCOCOVOS vO Seesasovoasg SSOTHRR AOU O |axMoRessna75 S8RFUEROUOS RF |S ApeAe ee H®SOVHOLOR SU O |nEaRERZzSASS qa PhP RErkogos O |27 He BeRn45G<= 3 & YORE SUEF |\SEZE4o8gs Az mo BM OODUURZE bE — =m Bh POUR AES < |SENZZR<872> SHZ0208 298 < Sree aeke se gonmectezUnod a |MAZ RSA O85 BA PS sELoseVoc KR |SQpeeretosed 5S hme SPOeou RK jae te et Zancai 95 Meet OHvtoc O |aaerReeog4as PSSGDOEURD cn O |M@aere tb yaad DPPSHSRRKICHS é a DN SWONNISM SS # .. sH9SMOUQOUUHE bX Be eZAROINZaLA ct % YS SHWVRLOHO O|IBEPZ3ANo>ae 8 5 bsSSeeeQoyuo OelOoaxAgeacher = GQ gsMOPEtEUS!SE e“S|ZnEeoesesse A 8 + FE ZEORE OUD UdS / 45H BS6RLERA S 2£ Ff 8 HPSOULORV5O<< iS) 7 >> mAas SJ Z SS 2SOQRUARERD Of|SSeu<R005H9 KF SF & BS BIROZOEDSO RO Sansa esR70boe SF 1 FC BS PHRHZH AAAS <i) ZR ORSEESZES No, tf § B8eSOe0<oe GE\SSSEELSEzLAS FS FE BY GCHESSSSSSY SIAR ROGSHYUGZIZ BS Z <2 LORS O Qo 3 ee (oa) 3 = * N i= y aa) N Oo & a O ° ° Ww 2 a 3957 a S BE EE ? oo eh 8 36 T E E = AS w u 2 Z 2 S e a3 = ; bo SP =| > Be H Ho PCT / U S2 5 a E BE S 024 / 01 4 = L PZ SE S 331 O 7E EE LE BH e8 8 os Z o e e SE TE RE E g a + e a l H T H A T je = Sg Ea s E T A P u a be 8 a Ti) 9 & 1S) E 2 2 5 2 S e t t e r 5 e B O S e r e e r r r la Cy oO s £2 55 2 2: S aj — 2 2 8 5 a e A T H I E L H H T a “a. cee ace QO Rg l a g Ae s Ra gs n y o e 4 la a u l H E E L : S E S S n e T H L E y A as S2 5 8 TE AL a § 2 8 < - a OF oe) H a a t SE g 5 = a x n a : O x5 $ 2 6 U e R > ae = = 3% Oo 5D BD ep o 0 Oo > a a) Oo a ) A z = HK 2 < oo E P a y < gS E OE E G a u t T H L c b s u a y A T E Ss) H L M4 BS AO E e e F I T L L L E L E B a n i 7 2a 2 G 33 5 O EE LE TE ep SP bb S2 6 s < = ~ 5 2 A n n Q A T iv, T B A 25 i i a A T H C H E E 5 2 S : BE oO Ee W U SB E > < NM 5 2a g b0 2 by 3) Pia) oa = QO 7 T n aE L E oO fot) 2 8 s S S S U E SR Z ne ef H u s U H d e Ay 1 Oo 2 J C TE E L E P u r EE EE LE EE Py e 2 s 2 29 Ss = 2 22 S Ao S f 5 8 <t 555 2 Be 62 % B2 e5 8 é pS Se a a = 8 B a A = SE BE S 7 8 Bo 4 S ge 35 H i i be ig e 28 22 8 ~ = & 6 & DN O Qo 3 Sal rat 3 — F N i= a aa is) 5 = ° oO Oo wo 2 02 2 4 / 16 3957 ma n 238 as no ‘> of jot) 3 Zz a w= 0 PC ee 2S, B o < z T / US202 4 / 014 BS | egg eseu e = 331 tsa LL, 28 3 QE OS Oo 5 a S BB = = = F e r e e a u i i om O Z a 9 o Y Oo k wD) [B gb ie 1 : ms Bn <Q RC RS P EE TT IE LL Y pA e e e a i Ez He e i Zz P e t S (e ee a u Ae 0 pE Z0 So Us S a r o ga te p eS sb g e e e H r t a = fe te n o e t M i e e e a t > f a r e n t i o fe e a r n g y e a t | g H e U n a = e a H <t f e e e h A G E Zz e8 Oo <2 SIS ACR OES E T T TE E < 8 23 80 F E LL > l Y A ep eo ee ss s E E R E +] l 4 y PA o e e e t R H <4 la 328 FSo us E D E L a 22 85 5 < E T T ET a fe e t h ss 5 5 & 9 s ur es < = fo) H e = a 2 e i ) or > 5 9 SS 350 82 = PA TE L E TE 2 & 2 a 7 = S 2 2 a | = nes e C E E A SO a) a aan) 2E SO SE SS 5S 38 55 32 8 % _] = S II om) boo 8 oO O° P E T T Y In S 8 & © a e a y é S S 3 H e a H t ae =) 2 H Y © OF T E L E Zz, 3% 8 59 08 c= S Y g 2 oe) < So 9s e2 as 3 &, & OO < SP EL T ET TE E E G S e r e el PT ET EI EE ge ea ce as e 5 8 82 & a8 WO 2024 / 163957 PCT / US2024 / 014331 one) es aa 2a ob me ele ee eQy Se 7a mee |e 4 Se 33 < <6 2% wSs jaaePeaseirso bee RORS on Ses — 4 AAnHS Se MpIUVzo Rs 2s |288 |FRSCESs <2 3 S SECEDE S2 |bg2 |BSE22829S 35 BES S9S0E ou Sao ons" i 2200 << Aa’ = = ASe<<Sbreay »2OLG450 76 |BBE [2SRSS22555% PaSA9 SSF << § 28 4 av mR&seaza 33 etctoOH 2 bo 3 QemtRous iv, HaeaRProueey = < =.= Oss e820 Qo Ys > ae n> a4 oo 2 AOR S28 |8ogaS<206652 28G2<<55 222 |SSZERESUSR5 ECREEEE $22 |S53E2F 922255 BES EB G 2 Hs Bom S On d See seoxyete bos |SoSazGZ95ane Se<On9E< BS S oaszé ZEn>sS S20<8 004 22s eovsa se208 5 ho |e Rect reu en SSR OL555 a2 of =1-0< MAS YEOULN0SES |ReOCBLGOHOED wo SOE OUOR meso |Seueseasothoaw esOotVRre xs = SO MHOFARAS BSBUPROO 925 Sere naa 2 SEOEE oOwor 228 Insane sesnes ErIst -aao Qo 8 9 as Hetanso«ae OM SYVROse 3 69 8 RENAE A 5 POO Sas |MZASOnESLaz Ho BOOPUE 352 |ZESRPeersoa= BEPZRE SE ese |METOnBZOASEOe BhaerecZos moo |YFFOStatsea gesh osteo = ob SEoQae ere < = 5 2 ok & See |2n<Fe<z52aeZ DSP<<OeS £25 |ESSSEEEOESS BSE2SFEsz] & 2 ee |For So“2ZSn54z9a F 3 BPSEROSS gee |FZSPeRrgalea F&F 2 £2 29295 S2EQ / R5RASeACAES § S SMPECEODS 80D Bot ml SRatsoat # ~ = Os SHURE Bp ©) BO “OBR ORS EARS Be =~ B 2 wHePEeOtoVg SPsZ\s S4=aeF zw OS 2 o SOoOPMWOORVUE S 2s S2Y¥<“ DORADO s Ss RSHOtURD 2H sO Sure sR70heo-. SF | FC SB PHReHZHASE ob So ZR RORSEESZES No 2 tb 8 S38 BOOFO< 2929 i, PEQUeZOOo. S € g OMPOUVod LEESISSCEBESESESS SS 2 2 EPEeoees nN Qo a Y +t S po * N i= iY aa) + Oo 5 = ° S) Es gs WO 2 i 024 / 16 ; 395 Og eg: | oo : Eg 0H: BZ eau < ay gS 3 2 e We 23 $ae52 2a eal | Sf TT | aH : 5 nue : ce PELE a) Bp rots) a Hn e ay 258 5 On ae ED U e 4 / 0 14 Oo | A aE TELE i] ane 5s ne ; THT i n 2 3 : pee: a Ni a Wa £8 PEE ae 5 a= Qo = BY A a we Bre: 5 2 1 of & oe: a | We a a ed cf gBan: oO s 92 A aa a 2822 = 2 2, 3 5 u Te : TAHA I . PEELE HTH CONE HeHuy ge g TYEE 2 ag 3 BSie WO 2024 / 163957 PCT / US2024 / 014331

[00201] Another set of constructs were designed to include a transgene sequence after a separator sequence downstream to the modified ERT2 peptide-suicide protein fusion polypeptide (FIG. 1B), wherein the transgene might be a reporter gene or a therapeutic gene. Hence, four more constructs were generated using the modified ERT2 peptide-suicide protein fusion polypeptides presented in Table 3 by the insertion of an IRES sequence and an RFP sequence between the kill switch polypeptide and the right homology arm targeting the GAPDH locus (FIG. 2B).

[00202] The sequences of the left and right homology arms for targeting the GAPDH locus are shown below as SEQ ID NOs:7 and 8, respectively. TTGGTATCGTGGAAGGACTCATGGTATGAGAGCTGGGGAATGGGACTGAGGC TCCCACCTTTCTCATCCAAGACTGGCTCCTCCCTGCCGGGGCTGCGTGCAACC CTGGGGTTGGGGGTTCTGGGGACTGGCTTTCCCATAATTTCCTTTCAAGGTGG GGAGGGAGGTAGAGGGGTGATGTGGGGAGTACGCTGCAGGGCCTCACTCCTT TTGCAGACCACAGTCCATGCCATCACTGCCACCCAGAAGACTGTGGATGGCC CCTCCGGGAAACTGTGGCGTGATGGCCGCGGGGCTCTCCAGAACATCATCCC TGCCTCTACTGGCGCTGCCAAGGCTGTGGGCAAGGTCATCCCTGAGCTGAAC GGGAAGCTCACTGGCATGGCCTTCCGTGTCCCCACTGCCAACGTGTCAGTGG TGGACCTGACCTGCCGTCTAGAAAAACCTGCCAAATATGATGACATCAAGAA GGTGGTGAAGCAGGCGTCGGAGGGCCCCCTCAAGGGCATCCTGGGCTACACT GAGCACCAGGTGGTCTCCTCTGACTTCAACAGCGACACCCACTCCTCCACCT TTGACGCTGGGGCTGGCATTGCCCTCAACGACCACTTTGTCAAGCTCATTTCC TGGTATGTGGCTGGGGCCAGAGACTGGCTCTTAAAAAGTGCAGGGTCTGGCG CCCTCTGGTGGCTGGCTCAGAAAAAGGGCCCTGACAACTCTTTACATCTTCTA GGTATGACAACGAATTTGGCTACAGCAACAGGGTGGTGGACCTCATGGCCCA CATGGCCTCCAAGGAG (SEQ ID NO:7) GACCCCTGGACCACCAGCCAAAGCAAGAGCACAAGAGGAAGAGAGAGACC CTCACTGCTGGGGAGTCCCTGCCACACTCAGTCCCCCACCACACTGAATCTC CCCTCCTCACAGTTGCCATGTAGACCCCTTGAAGAGGGGAGGGGCCTAGGGA GCCGCACCTTGTCATGTACCATCAATAAAGTACCCTGTGCTCAACCAGTTACT TGTCCTGTCTTATTCTAGGGTCTGGGGCAGAGGGGAGGGAAGCTGGGCTTGT GTCAAGGTGAGACATTCTTGCTGGGGAGGGACCTGGTATGTTCTCCTCAGAC TGAGGGTAGGGCCTCCAAACAGCCTTGCTTGCTTCGAGAACCATTTGCTTCC CGCTCAGACGTCTTGAGTGCTACAGGAAGCTGGCACCACTACTTCAGAGAAC AAGGCCTTTTCCTCTCCTCGCTCCAGTCCTAGGCTATCTGCTGTTGGCCAAAC ATGGAAGAAGCTATTCTGTGGGCAGCCCCAGGGAGGCTGACAGGTGGAGGA AGTCAGGGCTCGCACTGGGCTCTGACGCTGACTGGTTAGTGGAGCTCAGCCT GGAGCTGAGCTGCAGCGGGCAATTCCAGCTTGGCCTCCGCAGCTGTGAGGTC TTGAGCACGTGCTCTATTGCTTTCTGTGCCCTCGTGTCTTATCTGAGGACATC GTGGCCAGCCCCTAAGGTCTTCAAGCAGGATTCATCTAGGTAAACCAAGTAC 78 WO 2024 / 163957 PCT / US2024 / 014331 CTAAAACCATGCCCAAGGCGGTAAGGACTATATAATGTTTAAAAATCGGTAA AAATGCCCACCTCGCATAGT (SEQ ID NO:8)

[00203] The Sequences 7 and 8 are positioned 3’ or 5’ of GAPDH RNP flanking or cut sites TTTCATCTTCTAGGTATGACAACGATTACA (SEQ ID NO: 58) and TGTAATCGTTGTCATACCTAGAAGATGAAA (SEQ ID NO: 59), respectively, which allow the nucleic acid to be cut by the endonuclease at the sequence flanking the LHA towards its 5’ end and the sequence flanking the RHA towards its 3’ end. That is, SEQ ID NO: 7 is positioned 3' of the 5' GAPDH RNP flanking or cut site TTTCATCTTCTAGGTATGACAACGATTACA (SEQ ID NO: 58), and SEQ ID NO: 8 is positioned 5' of the 3’ GAPDH RNP flanking or cut site TGTAATCGTTGTCATACCTAGAAGATGAAA (SEQ ID NO: 59). The cut site is designed to be within exon 9 of GAPDH. Having a cut site in an exon of GAPDH allows for enrichment and selection of cells with proper targeted integration, because cells with improper integration results in cell death (see WO2021226151).

[00204] The IRES-RFP nucleotide sequence is as follows:

[00205] ttggatagttgtggaaagagtcaaatggctctcctcaagcgtattcaacaaggegctgaaggatgcccagaagetacccc attgtatgggatctgatctgggecctcgetecacatgctttacatgtetttagtcgagettaaaaaacetctag gccccccg cacge es acetgettttcctttgaaaaacacgatgataatgeccacagaaticatgetgagcaageecgaggagctgatcaaggagaacatgcacag caagctgtacctggaagecagcetgaacgeccaccagttcaagtecacccacgaage ggageecaagccctacgaggecacccaga ccaacaggatcaag ete otggageeageccccctecceticgcaticgacatcctggeccaccatgtttatgtacgggagcaageccticat caagtaccccaaggecctccccgattattttaagcagtccttccctgaggecticacatgggagagagicatgeteticgaagacggeggec gtectgacceccacccaggacaccagcctccaggacgectgcctcatctacaacgtgaagctgagagegetgaacticccagccaacg gccccgtgatgaagcagacaacactggectgggagcccagcaccgagaccctgtaccccectgacgececcctggaagecagatgce acatgeccctgaagctcetggecesegeccacctgcactgcaacticaagaccacatacaaatccaagaaacccgctacaaacctcaag atgcccgecetccactacetggaccecagactggaaagaatcaaggageccgacaacgagacctacgicgagcagcacgagetgsct gtggccagatactgcgacctccctagcaaactggggcacaaacttaategCATGGACGAGCTGTACAAGtiga (SEQ ID NO: 9) 8.2. | Example 2: Pooled Screening for Targeted Integration of modified ERT2 peptide-suicide protein fusion polypeptide Sequences at the GAPDH Locus

[00206] Modified ERT2 peptide-suicide protein fusion polypeptide encoding constructs were delivered to human iPSCs via Nucleofection with a GAPDH targeting ribonucleoprotein (RNP) complex comprising of Cpfl endonuclease and a single guide RNA (sgRNA) targeting the coding sequence of the GAPDH gene. The sgRNA comprised a sequence 5' ATCTTCTAGGTATGACAACGA 3’ (SEQ ID NO: 60). Briefly, iPSCs were cultured in 79 WO 2024 / 163957 PCT / US2024 / 014331 Essential 8 (E8) medium and maintained at 37 °C at 5% COz level between passages. Passages were done at 75 to 80% confluency. On the day of Nucleofection, iPSCs were thawed and immediately Nucleofected in Lonza P3 Primary Cell Nucleofection buffer. 7.5 ug of each plasmid construct (BRCO0058-61) were Nucleofected into iPSCs using GAPDH Cpfl RNP with LONZA 4D Nucleofector. The Nucleofected cells were then plated at 50,000 cells / cm? per well of a 6-well plate and grown in E8 medium (plus Rock inhibitor Y-27632 from Tocris) for 72 to 96 hours. Knock-in pools were screened for integration 7d post-Nucleofection using ddPCR, as well as conventional PCR.

[00207] Junction GAPT2A ddPCR analysis revealed that in the absence of ERT2-activating drug 4-OHT, a tamoxifen derivative, fusion polypeptide sequence integration was between 4.5% and 10.9% (FIGS. 4A and 4B) in pools of iPSCs transfected with one of the four constructs. Whereas the integration dropped from 5.7% to 1% in Construct 1-transfected cell pools and from 4.5% to 0.7% in Construct 2-transfected cell pools when treated with InM 4-OHT (FIG. 4A). Similarly, 1InM 4-OHT treatment reduced integration from 6% to 1.4% and from 10.9% to 2.3% in Construct 3- and Construct 4-transfected cell pools, respectively (FIG. 4B).

[00208] Agarose gel photographs displaying the results of a conventional PCR assessment showed reduced intensity in bands for the iPSC pools treated with 1 nM 4-OHT (FIGS. 5A and 5B). These results confirmed that 4-OHT treatment reduced the amount of cells that carried integration of the kill-switch fusion sequences at the GAPDA locus. 8.3. Example 3: Screening of Clones for Targeted Integration of modified ERT2 peptide-suicide protein fusion polypeptide Sequences at the GAPDH Locus

[00209] Individual clones successfully transfected with each of the four constructs in Table 3, Construct 1, Construct 2, Construct 3, or Construct 4, were screened using PCR, assessed for integration at the 5’ junction, 3’ junction, as well as zygosity of the integrated sequence.

[00210] Select clones were further evaluated using ddPCR. Junction GAPT2A ddPCR was used to determine zygosity. All clones selected for testing with this assay displayed approximately two GAPDH-T2A junctions / genome indicating that all clones contain bi-allelic integrations of constructs Construct 1, Construct 2, Construct 3, or Construct 4 (FIG. 6). 8.4. Example 4: Apoptosis Induction via 4-OHT Treatment in iPCSs Transfected with Modified ERT2 Peptide-Suicide Protein Constructs

[00211] To determine whether modified ERT2 peptide-suicide protein fusion polypeptides of the disclosure were able to induce apoptosis, iPSCs transfected with constructs in Table 3 of the disclosure were treated with InM 4-OHT for up to two days and monitored by microscopy and Incucyte tracking. 80 WO 2024 / 163957 PCT / US2024 / 014331

[00212] In unedited control cells, there were no differences in cell growth and density between untreated and 4-OHT-treated cells at any time point (FIG. 7A), indicating that 4-OHT at this concentration has no detectable effect on cell health and growth. In cells transfected with Construct 1, Construct 3, or Construct 4, treatment with 1nM 4-OHT lead to apoptosis, so that cells were completely killed by day 2 (FIGS. 7B, 7D, and 7E). However, 1 nM 4-OHT treatment did not induce apoptosis in cells transfected with Construct 2 (FIG. 7C).

[00213] In another set of assessments, Construct 1 or Construct 2 transfected iPSCs were harvested for flow cytometric analysis. The primary antibody used was an anti-human / mouse cleaved Caspase-3. The primary antibody detects human and mouse Caspase 3 cleaved at Asp175. The results confirmed that the Construct 1 fusion polypeptides were able to induce apoptosis in the majority of the cells when treated with 1nM 4-OHT (FIG. 8) but Construct 2 fusion polypeptides failed to do so at this concentration of 4-OHT (FIG. 9). Later assessments showed that Construct 2 fusion polypeptides were able to induce apoptosis at 5nM 4-OHT (FIG. 10A) and 10nM Endoxifen (FIG. 11A), at least for one of the Construct 2-derived clones (c. 21). 8.5. Example 5: Comparison of 4-OHT-Induced Apoptotic Efficacy in Individual Construct Clones

[00214] Next, individual clones that were determined to be suitable for further assessments were evaluated for 24 hours in the presence of 4-OHT at two different concentrations. When treated with 5nM 4-OHT, all clones except one Construct 2 clone, displayed killing efficacy (FIG. 10A). However, when treated with 1InM 4-OHT, Construct 1 clones displayed higher efficacy than Construct 2-4 clones (FIG. 10B). 8.6. Example 6: Comparison of Endoxifen-Induced Apoptotic Efficacy in Individual Construct Clones

[00215] Individual Construct 1-4 clones were also assessed for their responses to another tamoxifen metabolite, Endoxifen. Clones were evaluated for 24 hours in the presence of Endoxifen at three different concentrations. When treated with 10nM Endoxifen, all clones except Construct 2 clone displayed killing compared to a hygromycin kill control (FIG. 11A). Yet, when treated with 1nM Endoxifen, most clones failed to induce apoptosis, except Construct 1 clones, which approached the level of apoptosis by hygromycin control at 24 hours (FIG. 11B). 8.7. Example 7: Evaluation of Apoptotic Efficacy in Construct 1 c.165 Treated with Combinations of 4-OHT and Endoxifen 81 WO 2024 / 163957 PCT / US2024 / 014331

[00216] Tamoxifen is a prodrug that is broken down into its active metabolites in vivo. To model predicted drug concentrations in a patient, the clone Construct 1 c.165 was treated with various combinations of 4-OHT and Endoxifen, wherein 1.25nM Endoxifen was combined with a concentration of 4-OHT ranging between 0.125nM to InM (FIG. 12A). All tested combinations resulted in comparable apoptotic efficacy (FIG. 12A). In the next evaluation, 0.125nM 4-OHT was combined with either 0.625 or 1.25nM Endoxifen (FIG. 12B). The combination with 1.25nM Endoxifen was associated with apoptotic efficacy comparable to that observed in FIG. 12A. However, the reduction of Endoxifen concentration to 0.625nM diminished the apoptotic efficacy of the 4-OHT-Endoxifen combination (FIG. 12B), indicating that the lowest effective concentrations for 4-OHT-Endoxifen combination were 0.125nM and 1.25nM, respectively. 8.8. Example 8: Evaluation of Apoptotic Efficacy in PSC-derived Microglia Precursor Cells or myeloid progenitor cells

[00217] To validate conservation of kill switch function after PSCs are differentiated to precursor cells or myeloid progenitor cells, PSCs engineered to incorporate the modified ERT2 peptide-suicide protein fusion polypeptide constructs outlined in Table 3 were differentiated into microglial precursor cells or myeloid progenitor cells. Thereafter PSC-derived microglial precursor cells or myeloid progenitor cells are treated with Endoxifen, 4-OHT or media alone and tested for incorporation of the modified ERT2 peptide-suicide protein fusion polypeptide in the STEL site.

[00218] To test function of the modified ERT2 peptide-suicide protein fusion polypeptide constructs in PSC-derived microglial precursor cells or myeloid progenitor cells, cells are cultured, then treated with either 1nM, 5nM, 50 nM, or 100nM 4-OHT, or 5nM, 10nM, 50 nM, or 100 nM Endoxifen, before assessment of apoptosis. It is found that treatment of PSC-derived microglial precursor cells or myeloid progenitor cells with 4-OHT or Endoxifen resulted in apoptosis. 8.9. Example 9: Evaluation of Apoptotic Efficacy in PSC-Derived Dopaminergic Neurons

[00219] To validate conservation of kill switch function after PSCs are differentiated to dopaminergic neurons, PSCs engineered to incorporate the modified ERT2 peptide-suicide protein fusion constructs outlined in Table 3 are differentiated into dopaminergic neurons. Thereafter PSC-derived dopaminergic neurons are treated with Endoxifen, 4-OHT or media alone and tested for incorporation of the modified ERT2 peptide-suicide protein fusion polypeptide construct in the STEL site. 82 WO 2024 / 163957 PCT / US2024 / 014331

[00220] To test function of the modified ERT2 peptide-suicide protein fusion polypeptides in PSC-derived dopaminergic neurons, dopaminergic neurons are cultured, then treated with either nM, 5nM, 50nM, or 100nM 4-OHT; or 5nM, 10nM, 50nM, or 100nM Endoxifen, before assessment of apoptosis. It is found that treatment of PSC- dopaminergic neurons with 4-OHT or endoxifen resulted in apoptosis. 8.10. Example 10: Evaluation of Apoptotic Efficacy in PSC-derived Myeloid Progenitor Cells

[00221] FIG. 13A shows a schematic of an experimental workflow performed to validate conservation of kill switch function after differentiation of PSCs to myeloid progenitor cells.

[00222] A hPSC line engineered with TamCasp9 Construct | and an unedited parental control hPSC line were differentiated into myeloid progenitor cells through the addition of various growth factors and small molecules. Differentiated cells were plated at 1x 10° cells / cm? in an ultra-low attachment cell culture plate for further myeloid cell maturation. After 7 days in maturation medium, cells were collected and frozen down.

[00223] FIG. 13B shows flow cytometry evaluation of the differentiated cells, indicating successful differentiation into myeloid progenitor cells.

[00224] For testing of TamCasp9 Safety Switch activation, myeloid cells were plated at 1.5x 10° cells / cm? in a 96-well tissue culture plate with a 1:750 dilution of ViaStain AOPI Staining Solution (Nexcelom) in X-VIVO 15 Medium with 10ng / mL GM-CSF. The kill switch was induced with 0, 1, 10 or 100uM of Endoxifen over 3 days and images were collected every 6 hours on the Incucyte SX5 (Sartorius).

[00225] FIG. 13C shows brightfield images with fluorescence overlay. Cells were stained with AO / PI, with dead cells appearing darker after uptake of Propidium Iodide.

[00226] FIG. 13D shows quantitation of the kill switch activity in myeloid progenitor cells following differentiation of unedited PSCs at the indicated endoxifen treatment conditions.

[00227] FIG. 13E shows quantitation of the kill switch activity in myeloid progenitor cells following differentiation of TamCasp9-edited PSCs, at the indicated endoxifen treatment conditions.

[00228] Taken together, the results indicate conservation of the safety switch function post- differentiation, as hPSCs engineered with Construct 1 were differentiated into myeloid progenitor cells and shown to have induced apoptosis following endoxifen treatment. 8.11. Example 11: Evaluation of Apoptotic Efficacy in PSC-derived Microglia Precursor Cells or Myeloid Progenitor Cells Containing Construct 1 c.165 Treated with Combinations of 4-OHT and Endoxifen 83 WO 2024 / 163957 PCT / US2024 / 014331

[00229] To better model predicted drug concentrations in a patient by testing activation of the kill switch against a range of tamoxifen metabolites, the PSC clone Construct 1 c.165, engineered to incorporate an exemplary modified ERT2 peptide-suicide protein fusion polypeptide construct (Table 3), was differentiated to myeloid progenitor cells as depicted in FIG. 13A. Differentiated cells were plated at 1x 10° cells / cm? in an ultra-low attachment cell culture plate for further myeloid cell maturation. After 7 days in maturation medium, cells were collected and frozen down. For testing of TamCasp9 Safety Switch activation, myeloid cells were plated at 1.0 x 10° cells / cm? in a 96-well tissue culture plate with a 1:750 dilution of ViaStain AOPI Staining Solution (Nexcelom) in X-VIVO 15 Medium with 10 ng / mL GM-CSF. The kill switch was induced with varying concentrations of combination 4-OHT and Endoxifen treatment over 4 days and images were collected every 4 hours on the Incucyte SX5, with 12 hour timepoints plotted on a graph (Sartorius) (Fig. 14). Either 2.5 nM or 5 nM of Endoxifen was tested in combination with either 0.5 nM, 1 nM or 10 nM of 4-OHT. 100 nM Endoxifen was added as positive killing control as per FIG. 13E. All tested combinations resulted in greater than 80% apoptotic efficacy in differentiated myeloid progenitor cells, with the lowest tested combination being 2.5 nM Endoxifen and 0.5 nM 4-OHT. Treatment with 5 nM Endoxifen and 10n M 4-OHT killed all cells by 4 days, comparable to the 100 nM Endoxifen positive killing control. Treatment of unedited differentiated myeloid progenitors did not induce apoptosis. These data demonstrate that synergistic activation of TamCasp9 using a combination of 4-OHT and Endoxifen can lower the minimally effective dosage of both metabolites in PSC-derived Microglia Precursor Cells or Myeloid Progenitor Cells. 8.12. Example 12: Design and Generation of improved modified ERT2 peptide- Suicide Protein Constructs, and Evaluation of Apoptotic Efficacy in PSCs and in PSC-derived Myeloid Progenitor Cells

[00230] An additional four modified ERT2 peptides (ERT2 mutants; Constructs 5-8) are selected to be fused to Caspase-9. All four additional engineered ERT2-Casp9 candidates show killing efficiency after the addition of 2.5 nM Endoxifen, in HEK293T cells within 48 hours of induction (data not shown). In this context, Constructs 5-8 are designed to include a separator sequence, an optimized 2A linker (Opt2a), followed by a puromycin resistance (PuroR) marker SEQ ID NO: 10 to allow for puromycin selection after transfection of constructs into iPSCs, downstream to the modified ERT2 peptide-suicide protein fusion polypeptide (Table 4). The resulting four kill switch fusion polypeptide encoding sequences are inserted between the left and right homology arms targeting the GAPDH STEL with a T2A peptide sequence linking a modified ERT2 peptide-suicide protein fusion polypeptide encoding sequence to the left homology arm (Fig. 15). 84 WO 2024 / 163957 PCT / US2024 / 014331

[00231] Opt2a- linker amino acid sequence (SEQ ID NO: 61): GSGQCTNY ALLKLAGDVESNPGPGSGEGRGSLLTCGD VEENPGP

[00232] PuroR amino acid sequence (SEQ ID NO:62) MTEYKPTVRLATRDDVPRAVRTLAAAFADY PATRHTVDPDRHIERVTELQELFLTRVG LDIGKVWVADDGAAVAVWTTPES VEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAP HRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYER LGFTVTADVEVPEGPRTWCMTRKPGA 85 PCT / US2024 / 014331 II ~ WO 2024 / 163957 ZEST AL =a PofhreYauads S ae o¢ pee gS g5 25222885 6 ag oy ne ea yuen aa am 7 aa ats aS 2S S9obR ose Oz 28 RERSSS oS 220255 Q =P, as BZ EARSZ CEES OAS = my mE KSBeeamooeo wm oO =i Z, BEBE SE KROL OOKEE aa n a Siebel SC 246 As PRZESEE IOS zro< n. Ea) gz BE San ESSE 2 C8592 a, =A com ECE EE ELEELEE v a 6 SS55E2 5552625 Z la 38 eee A @s Ba Naas Tevewoage 7 rs < § aaa alge ea SEE me > fs js Ane e Sees oon 425s A ae o ene e ROR eS ERY GS ce SER ERE CRS SazH4s S es iz Pas orp AOSSZAS06S¢ js ae em SEES ZEI2582 S to) 3 Ae Se SSS SE GESS O ae SESn ae ceSe Beene om ran 3 |e R45 2 Zz Pats eS < =) ay Aas eg- ames a fs a RE RAE SRREOYE SS a 2 e A |e G2aveaZz< 20 aS N D <a Came&<<y at oe CESK Eg Cee REe SSE S ss SES REALL 22224285 Z >S ZEZE RGSS Se ZR 2S 32 A =2e 2 CER aGh Stans ra o> SE SSESSS CRE ERuS > £2 RC ARISE Og 2885 la > =i SRa<fARRS ro S) ae) Bogen cee sEISeee a z A® BS SARERSOSAZESEE = a a © Ae SH SRAEOOS RE RS = y, Ee 2 % R2S E2242 <>my 2 4 < + o58E 222240565562. 3 = Qe 2 SSSR SEEGER SE SSSR a | re < nai 2 5 BBSZRESESS CaT hyo > 5 2S a Zoan Onyon ZASTFOR SS 25 KM aa tS 80985 GazaR TOL ww &§ A’ va) EZ5ESESEST eG eRe o2 i II Ont Fa tne < ” N ee SSO ee 6o6oe i <9) al ov jon a e|a aE a 2 / 9 meio ea} eit 3 ‘3 / 5 a s Va) a |0O e) 2 wo w e 2 6% ae 024 / a S 16 > A. 395 aE A ’ iG ES 2 Za Hy £2 3 aK : —] 2 4 a t S e B e 2 0 P P R I E S as a 5 LP P SE E 8 2 A a Be = e G E E C E 96 s " I W e e 3 2 va A < = 5 5 ag a n ° 9) $9 H e h G = eh e H e e s FH es : BD aH 2 PC > SB , & er) r a i n y T / 2 e l US2 02 o O 4 / 0 So YW o S & 1S) w a l ara) 2 < H a e ty) l e % 8 <G 6 & E E E Ss) c h e e l e a y Gx o & og o & r= < a as “5 a F E H R : H e De es a y 83 3 5 BO o Y o 8 2 mY eth) p g s = e 25 ,3 = aw | a s c b s t o e ae — > 2 oO 22 35 < < yp o o H a S Rast S 3 5 ja D e e s u k 2 ¥ BO = 2 Pa n 7 T e e e a 2B 2b 5 B a < e 5 S s pO gp $3 3 8 . =) s2 t e : Ee A y E e e mo l S a e 9 9 8 = a < > re os 2 8 2 H a s S H a a o B 3 2 B E D u e s 2 g F a g 2 Q E L E “o O 2 3 oS P2 5 8 a g 4G 5 ou 3 e p e e iS) p e e s H E H wo = o e o) 2S e re & 3 e oY con 7 ra s 3 E E E HH < E e KS) e e < a T A 8: 5 Si 2 Z ) P P e U T E S < e e O g g = 5 r s 2 5 8 25 H e g) & 7 g2 eg 5 ona n H 32 2s s H P E L e G g 3) a t at oY 22 35 ae ) T e r g 29 s E E GE E t L e A L T A R S s E E = E E eo 2 2 2 0 9 L S U B s O O F A n SE S H e e a e n o g O 8g O n e 2 3 8 3 u < op T H E 2 8 E E E SE : { H E o Be E g e a c e DS Q po = P ia] < W v Q & ™ r e e < & E E E QO a & o 2 S E 4 9 e e e T a a L Se i Q WO 2024 / 163957 PCT / US2024 / 014331 O° op oh BD o = I = S PS mt |Roazoaene2OYeyr nar I x oy Si |ee22 (EBSSaSu sec Ba <8 2 52 i 2 PS kp OM ass oy) Sil ZS 7 ve mm nS Smo yg = ee) a mow fe) are / ae &) 6) Bp bp Se QArUTHAKOR ne Hosee9 fa Baas ORVOFR Zz no i Z 38 ts Nov Jee Ss AOR QS Os oN 5 = S oN SO) 4 One) Ls ft 2 ¢ Zs ao ey 2 8 oe Afeastvace non oS 5 a 60 9 Sm | eeEQov2Htgn So = 2a semo |RR EP RPRSEZZ=S> one sSm ma Ee 5 3 99089 Jame t hr osSesahaersoug n cs Aa’ o 2 Sp be BeReEZDAArsa<S o WA 2a Bo be [Ke ees azave5yeis o m4 a ASeyvr ea ean tCOSez om <= 92 OSGI RABBZOADOVEMEZ aS Z Kx 2 » Se tISSE 7, OS Ger HKSED (a) Ss) bo PS a5 SSees< Jann dacto ra SSP HOIAREZORSE RAYS S eres > OS mH SosO;SaeRR Sea 2b Zo0acd OQ acizs Sa2HelSsSeRonctoo<mesge © ea mS OPOlRaP ARO SAH Zar oeweea FS me OS PSem Sore ananshOugrare 4 <5 = aPox SS9OA86509 x = meme olQVeMREZrVetenseyonk O ane) met gi neSesta«vernokacs’l a S) Oo OD of nH Zz ae 4 < oh we mle a gonracS2oeatec O xe moo Bet OM BZ OOR ZOU AZ ae at ra i> op SP & O ) fouvoaangrta < HOo2o 8|n AR ReZOnDCHS AVM rn to 2538S DEER SSOCCSEeA ec iw Se Hoo ae|4e ome s YnezoeitnoFk iS ySHS 8 S|\ZeRRPEPSSSeaeesy 5 Be sm oo S| MP ATE SNS VE OUAHOS Z 2 > S09 2 / 4 Bt +390 m itaiee n <t< mess 3S Ree neax<eARPIeeas a e he sos BARR as ta Zac Xehae < So op) 50 P| BSenOG > en fal > mes MEM AZ E ARS GAT ZESY Go As os PSH eID OAS es AZS=«58 8 SAZ85 ML rFaRnseezseeursoa < 3PHOS RARE OZo an a> in ~ oO moss SOISRR ESA Ae Smoot se es in vy BO 228 SZ / ERRatoSeo arson S a 4 <s % 228 S8FASSEOSMERS OR SAA & 3 t= * sb PAGS I Re Ojoses 20kroO F = we 2S 55 MN SSZOSR SM IZGZOKA oa Ss 2 7 5 eo Hs Oo Sz ae Poke eteets> yw S&S 4 Zs FY HozsasaRge & OR 2<443NGs0e0b BT OO FE BO go S / R SER ORSZ ORR ES SUS Me boot oO SoRSPSSSSressecgeuraes FS € SS ES oo 2 bh SIFMENNEORETSYVoTS s&s S| fe OO SF a ° al S Pa < Q jor © a Qo a Y va 3 po * N i= oY aa \O Oo 5 = ° oO O° wo 28 202 4 / 1 63 wa a 957 ane Be an gwe x ne a % 2 3, 59 — 3 2 pe A a a [o) Oo 1S) Ee a 2 A r e tay PCT ae oY) S ob a a8 © S U / US202 4 3, I Qo 9 29 S) SE R P RE SS os / 01 Zs wa $3 SO & U e Ee ng n H S <O < o) By Bp eo r a8 8 3} A U 7, gs 2 oN O << Og He s bp = i) m2 sg m2 8 jaa) 2 Bo b ml << 2 0 bp 3 e a = e & 6) ja SH S HE E oi} Oo > 2 5 2 5 3 fe 33 92 S y aa 5 SS R ED B s on no A 2 Pe s 2a a, E 52 v n cz H E S E < Be ee 25 B I H 5 2 & ae C c e y sO oY o 8 Se o s ag a oy 2 6 & Sa i e ® KH << ao 8 t s a 80 9 = e0 23 58 © 5 5h Bo & =, © s ~ o & n y, » S E H S ax s % PSS 5 5 PE AT E 5 = BE ER P EE a t t i a y O e oO oY =e 12 52 98 00 5 E E 2 8 oh = a an v e e 53 08 5 Be =o H 2 Bb Bb on s = ae = ola n E H H A G x 222 208 T U E O2 8 5 > > E e e e a Pan H e T e y > T a2 © _j e33 2 8 2 = o O B 2 2 4 2 0 8 8 2 3 3 8 =< tS 3 a. Ss) Pu P eg eg e os s eP EC E EL B IE S = ae 3 MO = U oo 3 H e re & aA V n ! SS LP RL g e 23 5 H e : S S ze < = $5 5 2 32 96 5 e 53 8 > 5 9 out) as} oe 3 > SF E Z, S3 5 85 by oe W a n e 2s — ot) BD < we S & 8b e B S Ye 2 Rs s za 3 5 e S < I ae Ee PE EE EE a_ i og 2 ey Q |S) ey 82 So 2 o F o) 58 <t Ss) vo s O & Qo a <¢ § 3) < bp 2 ° < 1S) SE LR EL EL PS — ey on 'o) OS BS M i e 3 O S U : 2 ? &D se s os es v FI EU LE ET ED E 'S) oP oo 60 ss 's) << eh Se P e a BD x Oo 8 AP EE FE LE < 8 beo h ce e = 3 9° Ox Be OD on or to Oz a Q &8 a3 e 3 Eb WO 2024 / 163957 PCT / US2024 / 014331 ome) bp oD oh OP oe 7 x _ II ob 5 ARNANyYHAaP fo [#232 |EREZSSeszcSBA<5 g Ss S95 Eb oo as <on OF a2 .. as Sho 2 Seet ev orks Z2>uZ jo) EY 4 S) 6h Sp Sy = CDAPVETAayY av, nme Seo oO ea] Bee = 'o) OD aa Z on om Ss Of MONEBQEXOY aida < 2 As ao ey 2 8 OmeAeBoAVAse non 3 BO 60S bp ian aeenonrshigoe oy 2% BS Bp 82 9 meee Se zeae onesn sa 3 3 o 3 50 9 ee Ser os eee ee Osn n Oo oth) Oo 8 —O Od < ww °2 |ae8, |ZESERSSE oor Ca<= : aa 9 S = <3 |e283o |SRBECSAOGSSE ZR = = moa =5--—panen aon no) e; ea O Pooh PS 2neSss4enrs ener bacte A a3 850 [HES BZORORA RASS TAKS > a 3 5 2 oa PHY are <0 a n2 350 SRAoeees ah Z5aa O Sem= |S 5EBROR<9O<Rh254 O B29 oy Bea asiesareoaorta & 923 Pam BOF nDasSrOrSerarzs = 2 “POMS EASY AASEOD Memeo |yeMeRrVEeC DA yo oe cs mm es o ASSISLayrenOKkacc Se g S) oO 8) Onak Z. aes fae nS nose |ae OGnrActentopa«tec je me2o8 (tH OMG OORZOUIZaAzs ay Fa of = Oh O mie So CHYODARS <a Hoso8 [Aes Z < Ly Bs O mHoo9 8 BRR eae ZOanOODS AVM n 95 25m |IZZun GOO>kS toy DoS Fs Ven as< Yaezreastnoe 'o) SePss |BMenAtHeXSlCezotsy a Bp ob HO SO iid i--Ro dann movin: Os Z go%oS 2 |Meax 25$8oqgm5H42 a Has 5 h Seer NAtTAARP ESE AS o) os so s ARAseas to Zack sha SO oH 60 9 me Seer pDUa > en a) a) & eo H¥Z5EA QAres sO BSeSm (RSS ARS ZC Pizsege 2 He 2es |REREOSLE<4R0S Zee G g QO 9 3) < Oo | -) 398 & 8 BPASs ez onaur aed OA E = @ o8 50 op Oe nee odohe7OxeeoeF =z nS 85 & SSZO09R S452 GZ0 KA tN TY a _ #2283 |seSSEe5m RPBSABOSE eRe S| B BSB go HHS 2 == Se Pore Btecet> we S| §€ 24 HoZ5 & aaa SPARS GMipae BT oO OBS oH 29 Y En = rPHROosznOatSS oy II o- yeeee |ASARORSFORSESELZE u J | Ox Song |Seesreeseceurges a3 2 ZS a2 mS |WeeRN BOE TTSYYOToe &2 Ss 2 OO ~ S > Py < Q a © oN foe a Y Ct lag) 3 po * CN i= ~ a Ct Oo & = jo) oO Es WoO 20 cs ew FE 987 AE 524 36 AOE 2, 25 Cs Bo s B2 B3 2 B24 45 % e e 44 ms ~ # 2 5 9 < 3 2 as BE T Eg ee om 8 a e e t ae “O S i i t PCT / 5 BA <2 49 42 32 3 OO g § S2 28 US2 Ss) Sa at T E 1433 w e 22 25 2 8 aad e e : 1 a lo) Zo & a e P ss 22 2¢ 8 0 x FA e = 3 = << Oo = 3 8 & & =I op & O e r SES S e con ® re re 4 < H O G H E E L Sa ag SB 78 7S 8 U E 22 58 cec t ge eo s BS T L © BES S a e E25 6 E mo A PE LE RE R e ey L L GB ES 23 25 2 25 B2 8 8: 3) <a Ss 3 i e2 # CE SO s ap 2 = 23 82 32 OR 28 6 L E ES e d G 5 a ano s C e ao e LE S RS EE t e bE a & & 9 B T E E E BE 2 53 % jaa a EE RE fad : e 22 28 rs on EE E Ss H H wo s = ae = a as a Ra a e Ag rs RA E Ba as . SE TA B EE S H i n e ! SSa e 8 a RE S 5 C T Po e 5. e e Z ne 5) EV EE CE G a n e 6 & a 5 aD zs Sh b g ee = ? i Ss) ME aS 2 Bo se ) y ea s 6 OA s a) P E E one T G G a H e a O Q ZZ e a e c e c e & B SS Se y e < GO ED op e oO < < r n i e T u y : Oo _ F E E ES H O D E E H o l e oO 6 oO Bo x WO 2024 / 163957 PCT / US2024 / 014331 2° as o oo bo pO BD oe Hee Me 4 | ag |SRereR / ExSSe Qe ecu ouee - o8 5 S08 8 Sy o0 BRSM SSeS KEIM ASH © aaa S 8 Bo 55 & Ep Mes ateogeeay ren nme Oo DS SO oO ea] Bem SYSoe ons Zz e & 2 & Oo nr Les — 4 |2eee88 JASFERZSSSL UR ZRZ : 2 |Be2ees JERE Rael S455 58% g 1 oD te 23 829 2 0g Be SARE Zt Er Sonate ie A’ a YO yg BOS EROS Ore ZE ROS ie 2 8 Bo 2S 3 EB By “PSESQeEezrnjarezogey © < s BDO eS 8S RASar eons oConge Fa G Sho pes (PA ReRAAZOn evr M R YA 4 Sm2eHi6 |SAwaeeelecoReceas re sma5 Bw |WE Omi nonzwg > B328522 \esn Er CRI ee aea as eB 2 mo 9 8 2 Tats Ureasee 22HEnsrO (AaSOnOeS ZO <50aS<d x 93 F9 ban ne FS o = ns Mo moO | RBEROAACOAKMOOKOA n 99 M2 YS 5 On Noy Ho O o 2 HY HS = eax qMouwR7Ae roam Smeoers w ee Qe Cr ie Zi Zora a oper eso (ieee SaonzoGteess O me mood 8 7) REZatAVOAzZ Kee n SPo5 Sh |ZERPAEFOROGZe<<G o) Bo Yo RI s MSH enet osne rons x, oOo 8 MSS Menen- Vv ae FO one, 2h oS 8 g, Dee e eee zo aaH z m2 Oo Ss by HO BS BRIS eee ote ie os 2 | Se} OR ony MPs & Mato RregeY LnAMS na oes Sms |SKRRop ace RqAeovsasg > 922s 8285 |SSnene5keSEaASeys a e2hsamo® IRA SMAZRESROKFOREE AS o S383 hHasaeyZd =n. y 98so05 8 38 SUT szhROSeneZacteryg fo v, 25228 9 HRASHAeS SHOR SSSCR = = S mPesoe Ss |pRSek¥s ose? S e a ae 8 5p > QO>Vauss & 4 292 2b (2oen kane anes f SOML OLS A2enmnoscens herve echoeh ey gw CU er) 9 Oo 9 & = 1S) 4zeornoe oxa < anes) b) 6 29 89 5 Oo 9 a ZI!ns O<F BS CG oO29D MS O NO JZHKALA a & wa Zz rere SEEGSES SEG rae? BS 5 6 Bh =, Oo OD EH a > & ann < lI ll (oBeae) |S2SsnSszORke ose ss 2 35 8 jor Se Baoes IAESSSBZoCooezss$¥6 SS = G6 a g S Pa < Q jor © a Qo Ee Y mt Q 3 = * > oY aa ioe) Oo 5 = ° oO ie) Ww © O2 0 2 ZF 4 / 163 957 NN 53 ew Be 52S 2 ws cae A OF HH % 2 O6 ZA 3 RO S PP RE SU RS ao CL E 38 32, 0 < on ) g 4 Roja & UB REE S s SP EL T US202 A 82 ca se v e e t i t e 4 / 01 43 A ach o 24 28 s T E 31 Baw ay 5 2 D8 F e <¢ BA S - e n t a l Ss me a £5 35 & < < Be s 22 8 5 BE SS ° mS a e Ag es (2 Bg e5 25 : H i g las <2 H OX e e P O9 6 C E E e =a oO S88 E 8 S a H e t ee 299 289 5 B E Zas a R Kae l e t < ae 13 74 85 58 SBS a ag o* N A G E <ack e ES S H e u a t e 2436 T H 2ig3 «f ae 25 3 ge A H Pea ke s& h T e T e SELE S e e 2268 W n ans} a bb =e e> s s H e a S558 Ast tS SE 88 U H ORE B e e 225 2 BO S -s e e so a 8 2 5 = S E A U Sez = T e e coa n 5 a SSr E © i mOZr § e eEOoo ud S sos ¢ < U 9 PES k “ae 3) 8233 BH S) |S) Sa s & Oo oO << oN o 3 & 99 & of Z = 50 x = 2 6) 8) 3 4 5 22 82 26 7, S2 2 85 <9 O5 9 ® e a e of S) 3 of = = < e S LB 2 38 5 ame ae 2 oN 23 32 2 o) H E T R U H H E & U e 58 48 24 02 8 ae Sh A i e EP EE TE < eB 25 Bob O< © E§ z wo gs _ 202 i z 4 / 1639 oO oe ae a At : oe ft eee : a eee gs iy , h : e Ba ee : c | ae : a AE le aE WE | | T / U W S iy 1G | ee | EL no H Baa O W nt wa Hy ee HL Oe Hy ie a THE q a ql Se Bly fae A se a b e L SPee . e c a 3) t ayaePyAEE zB 2 a WO 2024 / 163957 PCT / US2024 / 014331

[00233] The modified ERT2 peptide-suicide protein fusion polypeptide encoding constructs (Constructs 5-8) are delivered to human iPSCs via Nucleofection with a GAPDH targeting ribonucleoprotein (RNP) complex comprising of Cpfl endonuclease and a single guide RNA (sgRNA) targeting the coding sequence of the GAPDH gene, as per Example 2. Individual clones are derived from the transfected pools via puromycin selection and apoptotic efficacy is determined in individual clones edited with Constructs 5-8 by screening clones in the presence of a range of 4-OHT and Endoxifen in PSCs and PSC-derived Myeloid Progenitor cells, as per Example 11. 8.13. Example 13: Design and Generation of Tandem modified ERT2 peptide- Suicide Protein Constructs, and Evaluation for Improved Apoptotic Efficacy in PSCs and in PSC-derived Myeloid Progenitor Cells

[00234] To determine if apoptotic efficacy could be improved by the presence of tandem copies of the modified ERT2 peptides (ERT2 mutants) fused to Caspase-9, two exemplary constructs, Construct 1 (ERT2*mut81-Casp9) and Construct 5 (ERT2*mut41v2-Casp9-Opt2A- PuroR) (Table 3) are designed as tandem copies linked by a separator sequence (SS), either a P2A sequence (SEQ ID NO: 11) or an optimized 2A linker designated Opt2A_2.0 (SEQ ID NO: 12) (Table 5). The sequences of the separator sequences are shown below:

[00235] All four designed constructs (Constructs 9-12) are also designed to include a separator sequence, an optimized 2A linker (Opt2a), followed by a puromycin resistance (PuroR) marker SEQ ID NO: 10 to allow for puromycin selection after transfection of constructs into iPSCs, downstream to the modified ERT2 peptide-suicide protein fusion polypeptide (Table 5). The resulting four kill switch fusion polypeptide encoding sequences are inserted between the left and right homology arms targeting the GAPDH STEL with a T2A peptide sequence linking the tandem modified ERT2 peptide-suicide protein fusion polypeptide encoding sequence to the left homology arm (Fig. 16). 95 WO 2024 / 163957 PCT / US2024 / 014331 O° an K4szo 2EY Ole One Gre olGokgeys a: BE eer Pia ee ee 7a Ee >a SAS 3G MSEMSSSGSORER RR SSS SSS Sh Pha 8 Go” => i n BOORSsS S >mMOFEOR A 3 Ate SAAC OOR SOE aac OCHAZSSS 24 ASHER SOR SH LZ iS MzGOorOREE 5 2 EER RRS 2OCSER SR eae Ke ooesoneZ <5 ESE G RZ ZS POS LORS SOR FEEDS ae ea BE2ZriIap —| to Be trrOonn << § <5 SSS AZ AGS ORR SENOS SEE IESE a ASSZFgESGES VREREEAaZIAOSAN< S) = > EMA > Zawneeoo SEI ae a227sg6488250 SEE RGeOZosZI<e MeRSOsegoce aP aes ers onl ze eaeas ones ac COPEGEORIA SOR REARS EO COs oe PREM SOAS SSP INES SSeS oe e5Ee 25 CR ehh Tb G29F Fa Rye oR Aer eeE SESE SS Seas SaaS eral <sVe< AOR Ea Base oe OSSore Sa xcOnekas K<EQ BRE SSSARCSEBESSA aasgaa 2 Hew ane Zuo OO ena aae kone oa SIH me SetuMow~noOaeiye RéZza5 na 2 MOR Reet OSHe Re SAVE etorea a i OnASS 7, SEaSy Seyoieve S(t SOM ZOORFONS ae S ae StMEMAGMS 2 esRKASP ac OAGanY GOnrxSaoree 2 |AFARZEAT AR BAO SE BOARZOREH Z a> > = IZmaAZaz GESLS aS Cr ESA KERR Ze AURA ESMERA ES RM ORE CAE RE RE ZRROR REY MEF ESE Sar eS eZ En ke zocor ees os QDeZeenr anss Soni Seetas Se eR BOR SSA OU EF Es ara retook MBE MAT SRO MASE ECR RSEAE LSB FRAZER RIES ZR THRESH ISSR GT <e Bauer earl hark BAG Re SEes cae a SMA QEOARO -a—i a7 SpyinZd deve Ney wn Mere oeocans eA 4Z5 aH ZO > iIO0nOS 5 ©2 e eGR eM AR BO ae Case 2 SER ASO SRS SE Se eae ees ene = SS EOwnSOsSeTAa Dre Atong tN Ew> e Sl MeOnweeroaeraaaaAe Samra Soe RARE SIO SSO BetUS AevASUss SSZOLASMIZGORTSEMAZORKMEAHOAS MSmbeqonte gas HoaeZzotohe9008K ZESESESOESGEZSSROROUORESS Mae Ss & = ye Ona =f2r>nkotno<sMe Er SRUOLTHAUAZES < TOFOn SEaROROKnNCAL< aceon ZORAES PHOARO<SYo Ae OCnOGSreSeCERd” N =| > MaOOSMsS ar Ronror,onakt FES SSESS SSE SESS ESSE AZSRAEEE v a 33 1 oot eB B / 090 ~ s / n alee S Bs| ee SelAAw BS SSE F [poe é loa Z ls 2 |2 z [0 WO 2024 sc / 163957 PCT / US2024 / 014331 = 5 ae -] I S 3 ~ Quoi CULE 3 2 z = fae Be SOeELS<h 838 ne = ~ TO“ SSCOSSVRCER ELE 0g > 5 Zoe 82020 S0HGHYL PSs 8B oe S nncan SSOROSOE ZHU 8 w a = oan P3Qotehsezey 38 gz 5 a Ofiy SZOROULVER SON 3S 22 « / e > Ske ePOO OSS ESOU eg: 2a a Zz 2 2O 4 BS <2 5S5ERR S59 88 a 2 le “Oe ill PS e00 teFoU es 2 B a py WaASS SZSORZUSLEDESS ce 2 Eaee PSE RLGRSORTS PeSs 2 < ZA 8829 SESCUSLY SLO RS 2 2 6#8o Hee SZ<5USUES Bs =| Q UVURUR< E = A £899 S295zh Ss00uc gs 3a A Fone see tOUGSeozo<d 8s 2 A © THla SEVSESLOCCAY BB £5 F ete T BSESESEORz2Z04 28 <5 = mks SSR SPR 5OVUOK< Be = S28 SQUPOLHSEaE ES > 2 Dn eto e SSD00FERSZESO BE 28 S SOg SSRRE OSES SEs HS Lo 2 Q252% Z2QVR5LOOSSE BS ir O <0 3 3 HO 4EO0<<0 wy 52 g €S25 ssa9FEcssggzae 5 Z 2889 BP ROS ZELO TEL GB ne o <ane 2 SSESS5HSR99S SB 6 FB AAS SSSCERESESS SS & ~ Ou. = aS |S) be 2 3 a x ane SPE<OOSV<eOLGGS 3g S S55 ZgSeesgoeszss = A $s58 SHSE<EEORORO SS AS ic At <> YP SESESLEZO= g & A = aga 28 8225559000 2s oo 8 2 ES2E g SBESSooESesue | ° fs * etit> 2 SESCEZOA4S 025 OS => £ . 2 JEG g 22 H< SASS ZEOY & & S28 Ja fy SE4S F g2F08ege5 egy rz ao & S a Z4 MMe 9 SOEORSLOR<K<E SS aa T De MOFH & » > ROVSSSEOSS we 250 Joa 82 FASr 8 SHISSESSS LOU ES aes aS = OQ ee < 522325585585 82 | 3S GSE Tj 8 EPHe SB & ZO S x 66 SSor 2 Z38525500 222 8s 1 2024 / 01433 PCT / US < SESBeee sé 255 Ee sae REEL EE Seg 2SEE Se GV Ee: 57 e 2024 / ar OO eee wo 2 SESeS5 > EO 322558 WO f e <5 <QO08 UHee e e SPEED EEE a O Wn 264 UP Sss 22 Het ee a 2 Pe te S388 2G CAS es OOS -SO5 OL ZY - 3 as BH oF = of 5 I SESS Ee ORS) a EOSES Be 9 SE ae) SR E = “5 So y Zs ae Bz 23 a8 uae Aes =, 8 We sists 585558388 ace ae C <BEG5< es <3 e o He pe ie eee psEg Eee AE eee O89 Ce OGRE mS 2 & I OSES Sam O < So) Te atts SOF <5 SHOE es nox ce SOB 2cEP c % Sets oS) SE8L AU Se SUP 26285 SES 3} x THE sinc 32955 <99 HRS a PEPEEEE. 2272398 << ES) 5 <9 elas << ees a BSSgs O50 m oS s ORY Tae O' 7 252¢ Oo sae iS) Sistas Or oO ) eo) 2205 SE Z0E S) e BEOSLE See 5 © FELL ROSSe S) ZQxs $05 eS eee CEES AVG 26392236 SESeces a Hz SY < nERE EE Rae 3 3 25482225 ae iS) < anes UO 'S) Q Se W SES SES HUME YES O Z8 $25 Pa oe FS be SO808 < a — Q T 200 O 6) oe) SSS x5 1@) Sa 2 VLEET et Sake an ee Se BEY e os = SOEO eo) an Os \e) s ZE8 <t Q Eo eseeas Q Tut: 2<5 EOL eo jaa x Pisic Ha xo Se VOL e Oo ie) OU A gs Hn ae Pee Ha oe errer Bs 8 WO 2024 / 163957 PCT / US2024 / 014331 one es a 5 URVU,< < loats oo Os ~ mo 2S |S29SPbSs5Sse00Gs 2359552 |ERegeSe ne LE DOOP SES OS RF 5OG AS PHOS aRSME0Rn 2 Z OPP RRO SOK SSCS SES hMSHHA8 8 ese tog gH = OL LT eZOGVAOGVES Os Bhs s mek ots ZA 3 QOVA SAO SOLKRF UBVOLAS 2HSs & Bee ee 5? 2% tO DOSS 20065 25 ZO BESS AQPERES 22 |Se REC LGR zz eV ER SR RE ES & SRLS SAs OE OR SOSH EUR UU SOS 8 HPS Bas SREP ASE aa OR ROUORF SRE OO SOV L588 MS Pae eeSTE RES B OFUOSV OR SP SOG SPP HS Ro 0--le non ence <5 tO OVO EBVO OLH SOS BP h hy & & bo eSaoene = aetePatPOUyreEneac Zoo 4d o& & Ssteaz Ss) KOoOtoa< VVG0UHMESRESS AQVeMr az GOV ES S5G GS ecUCAZUORAS MHS S & NAA SS ZOOUSZUSLZOYRORLED HS HE HO? NEESRRS OVOS SOLE SH SZEGED MHZHS HS GEES SES QUO SSO EP U Set eOSZmyesesS > 2 ESR COP eR SR SOS Od tO Sf 2H Ss aes SRSESRO GSVO ZOOS ZO VE GV GAS Hwy ws B Secreua JOUER ZOPG ZH ZOE OR H2OR MH BERL So SEER OZOS ESSE OE OV SS MHDS Sox Z4s5s GU OO SEP OO SK ZE OSS HAYS Bh KEge32a OVOO SEAR SE HOS R RS BEBZ s SSM S528 OPE OREORS OO SO OL SMHS HWS meOe Eas CE SRODULZELSOEEOR So ahae s ABZOREA OSU BRED SOP OOO RR EM aES 225405 OS SOF Ke PSOE SOOO PY Be Ss hh SeAR Ra OS tA OUUO OSS OOZOR SSE ES PM DEARZOE LEOVOSZAOROS EE ete ses egss ZZRnHAKS GOL LOCH ZR ZQGO OG AF Ze WMHS & VSS ates LEAOROGVUGHRE YU ZE ZO SPOS MS Benes?’ SVPYVORRFOUOZOCOSZEY ES SHS HS Hoe eee Ss OPSRSOFFOOVOOSOLP eso 828 hs eee Praets OPOVKOVULZOOSZO EOD me HHS Hh, (VRtr tay OVOPFURHFOUBESOSES S83 Sm3me3 SRaee non FOUaCY ae 2POGYSS wHHe5 M Klos SULSRGSSSOCR SOLE SHE SSS |SSSS5ES RPOOSULTSEOCOSR<OUG hs UMHHSS (RTH 4Z5BS USTRORKAOOR FOU DOU ESS 58883 [nee ex aeoa my RSEESSOSSSORSEESH sees uys |EEREORSE| ° VELHO SVG SSYSCHDRTS MOPS wME Ss HEASHA LGYVVOSZUF ROLLE SED LE MSHS S HA basse o5 LCOQVR AE SHOR OUO eZ TOO MS AT mMMENEGOFRAOGD GHOULS SEO KC HO SO StH MIR HHS S6 / SSZ0LSHS FROQOUUDRACOR Rf OFL ee eszoMses & as > ind DOULTOOVSLVG0CZEUGD HS PES HEA SROKG Cf fH ROOGIOSGCULOO SS HP HDZSO\SSZS ROARS <x 'S) os) oS) a oS Oo a DOD be 5b ea SOS ZO BS OZ EO Ge Sos Ss BS BS SOlGESOGES VERUQOVOUVOVAORVROSS SP Essel aeagasOoryd L£KULORBOROVORORUUL <3 8 hese SV Ae OeD << aq O° a ao Ss GY a. ZF ae) FE NN KES mmws ao & 2 Oo 5 = ° 0 WO 2024 / 163957 PCT / US2024 / 014331 ome) £8 WA Swe jae “MSnern “Po wAa I 26 |REZZASSE SLSR al eRk aes =a #g 2 |SSESSR CR SS S825 04 5o ee es ss GoW >moUSwvad SEZOZonap&eyk eo) 412 Zs SORESHSSRRSOZOLOARZS vO Z er a hs OmOw~ZEGaAa Ot 32 COO D RE AF RKOUS V Q S 53 OOnADOm OBOotrisevgoss = ms & 3 Azx~et ak esaenXngae eee? oO a A 8 Tons zn es e608 aes anaes na 4 pO Z=>eahQsgSS04FOoLrHAtE a zn <& OnnYy Ysas< oF894s9R45h ou aA = TIARA RUR AR OASORERE FTSZ oO cee ORROOF QAEDA 5FORCr RSs Z. xx eZ VORRES ROR Lees Pad fa As AOA IASPHR BRE Z aE SCRA > a RPInA=AAOe eos 5eEEMe OOH ja) ZO Hnec SHREZTAIAr AACE o) a LQOAGZKXAEA BpSaAaXxZ?UsNEAS 0 mw x HAAS Ost RSP aR OVEMES Ze x Bo SeOocmvYa ag AZ wear >oyarz 5 <> OA4OP OS ee Re eo ad hsO ZA ae ee eee Bg = Tm EZ4ZG6QeRESea GR aZeKEE GO <a Se Ga Zak SESS 5 ASS Bae s SG 8% we > be oArwH nr oo O> ene Ae ome sees 29805655 od AE MnaraS Sone Gkbasartea oO bY >> oe ONS ARSC AUS aoe a “es mo BREeeMonistesonete Z >S > SOE <P RA Gas eeazcese A 2% SQORSISES ST 22 OVURa4eza<y eA “> OREM MES LR RZAD SOBER ES Z &% TE ZRIR ERA eG Oe Ee zaCcUs RB 4¢ FORO ASS ee ESEY oe rAccaw So 2 ArOd rx SPB SORAOE x a2 =} ASAI SBeeeioapaezsedcoyes gc = a = Bene ZSoe tr eeghog <2g0 Ff M A eS RESS b ROR CRS an E << CO AS OR SHO SASSER ES SASF = am < SRHtzAAQOTIVACTE™ FE = i> MERE OCR SESE SCEEESRELARS AS a < i s LSAZZRE SARS ASSSaSSeRSS ES F EE Le = AO Wee ee oP PAs og SJ § &¢e 4 QAZASE OREO SSR E er toag SF i] FP OF KE OSS Z UZ CES TS Ae SAEUR SS aS Me I Ot 7a ZGRRESESSBZOCEESGE- SASSER ES GE SS ES CeSoeseSZOSe CONSE S GAS 5428 Y = 65 SS Ww g Oo O 2024 / 163957 ad nm A Ss Z p mo a= a = Hee HYL CT / US2024 / 014331 gg si PEPE REE re Z 6 mM eta e2ecucc eke 32 — m5 3 PORE SEEEFETILEEECE x3 Ce ee e 8 8 < 5 2m HO S OU LB be E ge 3Be ay (=) < mews Oe S2eePRos 1d) Q'3 og 23 RPV GES ao 8 $2589 Hs Hod® 72 «ee Hee re Bz C1 Aa ee: = La 5 wn PSE Us OVO mS bp 3 See S65 H3 2S He 222825295 L656 bo BB Ep Ss S) S 3S Sp bo oy & HE hHEOS a5 eo) aw 5) 59 2) bp Prater ie Oro <Z Peal tae = — io) >a He Bee 0 Aida an uo LT BESEe eg eee “508 = Aes U eee oN i zg Deen be Oe HES Re Ox P ae a LECT cae MS $35 2895 eee OVO 32 bs BoE Pas Habs Ege Mas e) SO Tee El os Fa e eee AE Wie aa l mn Uae: LG A ee ey Pd 5D 2 OE Her niinapi ee: S50 es O q SP bf Op 5) B20 Ms oa HPe ae > e n ee AA M e e e =< L ao 3 s ES eas oe 5) TUE UL eee ZG =F 2228 PSzO5 PPE CEPEEEEEE. FEgo a4 co) ® 5 OSE Sec eebae te pee ge eyo De - “iH os P e ee a> =F 22s & 8 FOO #588 22223 2295 LOY teh \o) eu 5 3 09F oP EEETE ICEL OO jan s gS RBPELES SOS beEL Le heE fee Gebe 55 8 U ee noe Ss PEP GSEGUS ae pa es OY 2 5 bo pEEPETETLEEET ELE OUftog 4 OSSSEUS BE EEE gcc ebg PEERS G Z E2E BRE ZES Poo 8 HS 8b Heo O 5 5 3 ee Sos sU a WO 2024 / 163957 PCT / US2024 / 014331 ome) es N J! 8% OU LURE Oo ODHDDOUEFHEDUS BF BSS e SEO See e SS CEE SSSE SSSR U SSS Sas ne < LCUU0HAR OYSBAALEE OUAt¥YOR 1 Ot 5d te GO OY SG OKOYY OvMoOos= PYRE S00 3& OUALTUUYD SQN EUROERROROSOCOLORHYPER Za Zz 3 BOE Ke SOB CE eH OD ZU SUO EUR OUSDU OVE AE OS 2 VF ®AOGOVUAHAOOF Pas 2% SRR RCECESE SOAR AeA SE-0-2 8 aod 0 -Eel SP acicl achanene tac 3 2 KE SPELOOSE RRP OOOOH SOSK<FUOEOEEOE EY a's eee St EE SV AO OF ZOU SERV KOU ZC OU KOEEY 2a GORY EUVOOS VS LZ5 RRR SES HELV OUZOUSUES <a & CS aCe CSc ee SESE SV Sty e<te OPE <ic O OO SGZU9D 5 SEUCOOSROD ESSERE KES <h tUK<sh QOEROSSRR SS df OSU EOE SVL SOR RILGRYU BOLO O SOV O BV eg OHV ec eH OO see tO Ob zea OO ZO GOV eH EVO SEE OS eet Gee eee oysgyeyd SEZ SSROO SS ee OPE OV SS e PSS OCOCORFEOSY GSU R SVR ZOE KE ZG EE OOOVU GUO SP SYS OUURES DYVOO RPSL EZVVA SP SOV SLE GRR OVYUVUFORLOS OS ZR Oe SOROS SOR ee U SEP OORYOLORG AS LQ GOO SOS GP SUB SPO SOE sO RS SR eed P RBOP eR eee U SO SE ee VS EUS KOO C9OS HR See ee oO CHOOSLtS zctuY HVOYUVSZdROOY SECROECECINECEORNECRC ESR ARUP AC ESEOLCR EB -ECR eR SSnCRenonone HO SO BEG S SEQ DOORS USB EOE EO Ze fU SOROS OR PSST IE CEPR OU OP UES OUt SRG KOSPUrSt SP ASICESECRCESECRONSTCEOE-ECRS ETE ic Son EOP Acres nCinE aa SK ZOOUTOSUSZOOUO SUF SESH OU OG ZOUOOF OH SESE KARR SE OO tS tO Bc OP SOU OROL ZS <5U SOSZI SHUR RLZOUOSPOSVO GRU O GV eZUFOEeyO<X OO SO RYOOUU TK OODDO SR OOP RFE OR GOROOYUOY ZOO LO SOAS TE KU V OP VO SVU ESI DOUO Ee <xO DORDOSOV SUGGS SOR Ce SCRE OS GAS ESV Often Ot ee GR eeesto COSY E ae RZt HO KOOKS AOA DA SOV GVO SOH <€OV ZOE SOSOV DO ZVGZO0ORVRZY VO BU OV OOS tH AH US COUR VRE He CLE UUOGE DOEOSEQOOSE ZR Zh eUOOSVU SO <RUOU SEYOBERT OVOOYO SOV SUPER SSORF ESOL OURS OYUDY N Sent eP eOhOore es tQOveetCofoo es t<0500rD = ROR GOS cE SOO K<UGE ESE SER OOZOZUURZOFY VCRVOOLS LZOO RSVURQOUUV REG AZOS5OLUEOHOD LtOR FOROS SEROUS CVOORAQOOUSZEOUSH ZEDOF OVE0 ete eeOgGReQoezVUCO SR eOH 20s<UekO DDODDOLDHUVYZVOD RS ULZO APRS GOOG OVO SUD CODUVLLE STOR OC KU SV OSG SE SA OVUORZLOOBRFSE LEQOR COL eK VOOUR OL COO OVS SUSE EOUEHROUOYY OPDDVUDODVODVOODVOVU LE RVUL F HSER OHVUEOOYS BORE <5 LZOOCOLLEOUDHOUROIC0OO<I = 5B CSSSSR Ss BCSS gees seuss UR aeeeSs PFROOUVORESLEREUAEOOU ELIA U ER OUUU L LEALE WO 2024 / 163957 PCT / US2024 / 014331 ome) gS SH 2 ol BY a nHnMnANVA eo) npn 25 |g 28 e982 |EESSASES Zc RCS ZORRSCS Es ne S2HSoosm lASS¥aeav ae Coethas nto akaw 298 mo S Bp a QDOor er ZH aZzonnk 40 on Oh ey MOY O ws oe CASOLESHKESUAODC EMTS a ZH225839 |B2RARZROOROREE S%Pobe 7 2 J Om A Sy ct JHS8on 24 Rs ees gs 2 ROR ERE KMOOYE SR eg ae SOS REZ 22 [OSSPaH ss (RPSZRRE TIS SS FREES RS ZOSES a8 te Yh MSO bo eR Oe Zz eS Oh eaters oeas 2a Geseos Bos |aatSr os ck uaeonery Azra Bou s ~) a Son ee eos a a OSs hResgs (BSA esZraor-s5Resaeteors Si UME S HOME | MER Aone UTORS SEA UOSCRESY OssHsrnys (AAaageongvesoaeeeressria Eo m2 Hoe BEET Anos oh se Ree eee as C2808 e828 (eA SSMS TS eA AAOSSE SSCL <BHSR8S8s (VRP ROR ORAGZAABAae one Sy“2S Ps so |PRAEeROnG eS R Ren eeO<o4S £598 HOR88 SeOgaBsuerne Z9SRES4%EzEIbaG OMPSSE&h OF RERORA ONKeRe eee oes <mmHeesss |fEOMRAZ4CORANOLACR SSE ZAOsessuws?s (PS eee tester tKAZezrgrvoyesgas 228523 % RES REY YECRTOORS Ben eS2Zo> HK Od & 2 mm D SESE tV SMR AVOYVHRZXNSHOAY OPmoMhSs (4S OneEnixzceZi0c ig ste sese4BE Sess Hoh |Ak MFS One Onse SS SES YEE <3 PSO hsS |i eKe eee BAZ eee eaeMoaes OS eReRS |DRFABAZEFOARODRAYOROGFS<K2ZHR KemeiouwPes (26x eSeoos eee eeeaussareag O2PhP2Z3 oe MSRRSS eo Uok leas ene oeaga7n OmaoasS 8s MEDPE ROSS EXCOSEREZASOAROS BE 29 MOS & & QSEZeeRnnoe SOAZAVET CUSED OS SmRAE |ARRDESeSOS6<Z SRK ES EME -ZaRese oo |\MaeoC RSIS one OM ens teseske Oe e2 3 ws Bee S SR SEOs EMME Zee EDDA RS Ogs2MmseHys SR RS REUTER ZARA RE ES ESOR 2zhysneas BARES to -,eadQe ogame THO ec naeese [PaeznearlS 6anG ee “aceaAea oS P2eaacs LZEESSSC2 RE ZSRaZ5aSssaa|23s Bp Y cm — — np Oe ea) 6 ~ teMm2HS om (PREF znOs Ge Seance ZR asarog Reesees so ISR ee ACser Oc se ae e ae oes an Oo ORS DRIFT RSME ORME MP ORFFARO“ZOSAUME He Psa nhe srt eo xcoRs Care atAe eee (mos Don WS SMITA OM IA OOS A eSZ GOs Sra <Pohos SES SSSSROSRTROZATSM BOSSES BRS OPES OO bp FROROOHZAUAS RoxzOD0KeS OSHS sS3SS2O|24ruboe20<>5é¥0E BOZASKALG O22 HP eS Hr Age ROEOF ORF ESE rPaEOOoOLNS KH PP HSPs BOlMOROSRSSEO LOIS SEE SA OR EKG Os 8263 Hog FSRHKSOOOLMEF > ROARR< Of S828 ool SESSOESP ES SVS SSB SES FORE © N lo << ANN ao, O. ove) oNoN Qo, aS GY 9 00 53 as NAN HES moms oo dé Oo PG = jo) 0 WO 2024 / 163957 PCT / US2024 / 014331 O° 28 26 Moy T oY Qn .t0,. 25 |EGkS 1 gg &es EE PEE Etc ne OfG a < non 8802045 3B mA © S Sm ab 8 BE . a Oat m i, |Eoe3 Z 6 9She BEsegse 8 2 ERs = oO Hina g SSR0HOs Q 8 O faa Fy sé a90U04 40 3a E535 SB 2268 2322565 Ze Zhan 7) n. mAs A Qe oeYO £ |BaSE S § E4ee SgL255% O Sots o a. was Sse O005F QON<te a Z OASas SHuOVVAY OoHA< Z a a = ay SEtO 2% OR MA aa mw QOmsa PPtOOGY 522 2 A 3865 8295525 Zane 2 § g852 2322585 R23 S 5 Efs< 225525 ¢ ORS = = a2 ay 2S500LE QA & gj = 6 SEGROny, BRSRRAHs OSh> 2 Aza 2 3Q9005% ORD & 2 OQ €895 2 SORES a i. S) i 2n%e 2 eth OO OSS ra e) AIO Shoo aSe Reo so) val tno Bo ROS EE pPaee< a ro) tare mH SRO H AeILD S) ae AEA Hs HPeRL >aAaa0~ oO a. ~ene SP Etoos Qa<us& a Z, >>> qo HGR & OHSUOE Z n <<a0# SEoRUVUG zones a = Kee > DP DIOELOS 3H288 mo 2 &§ <6 Sb SOREL Zaihos > QB Beas >» PSE GLO Arete a) e) AGATA a5 Se BO + Josae O < QOAa a = fr) <0 & zusa eX bs =< 4 eases ys SBZSGRSE = > en = v7, BOF o HM sSORUY0 ZSSCE a E S, 3 S582 § 28R2828 a NAN £ Hx oy I Do MO ROD O&<t>> 7 A FT a De Sf KS45 F 29 B¥O Aerecbo 6H Ba AS FH FSaN Y oSeaVogy a) & a eH op OR<t BOR5628 7 o 25 G2 SSE 2 24s5s¢ ZESsE R Fy I «<< O< ~Adth 8 S8295Fe e<eSeS5 9n SF §€ OF OG BAAR F OCFSTEOH Vico BS BS = 2B 282 FVAR 5 SPI Beeson 2 6 S| 2 UO UO 2502 2 <8S0E090 ome) WO 2 0 53 24 / 1639 57 2a aS oO < ig ES SS E ge 238 Zo no tC) & ohm s 2 s = 32 a L PCT / U 24 e $2024 / 0 $8 S e s 14331 , © tH 5a a Y S 9 bn i) pO ee og a of a2 8 2 6D § SS 25 k ee E p s 2 e 0 S66 a a : S eb SS o oce <0 i i a OF O <2Og ao = op oh BP 8 3s an VE O ae & Ss) mt & 33s 2a5 & g EO ae) oe. Oo = cEen e g e -2 s6 5 22 88 9 q e U U O E : one << ot Afa UO < 2s = oo 3 ane) Pra s 0 2 e a a H e e e oe SOE s N E a s g e S C ejae ons 8 & 2 sh be Ps as O ‘o) \o) O s U g e o s 5 C U a g Ss a os E T E rE , fame S u e e e x aa 2 s = A 1 uO < A H H << < SE SE one) S E E Of<4 5 OF = H A G RE < SOHE L SGE QY HO er es re a bp O O LO OS 95 aire) < POS « oO < SZS UR ZS beLS FE Shons SS OE GU < Re es PCT / US2024 / 014331 WO 2024 / 163957 one) 5 ad OB PKOV8 Ems BEY, ae SCeXOHOUNDUY OOVEE HS sh RSs- BUSSES SSeS eegcecel ee Cees aieTs aS QEYO500DV 9g79 M3289 no FeROODUOGV0UF Fouat 38393 9 2 & CES SISetee FOROOHYE S2eePSSHS i Z OtOLaAee a SGERPO5RES <SOUSUSSS2h8 8823 BROS SES SBSH US SUG SS5 OSS Bee hae gz SOO SSS RGSS SSS SUS SSE CSR es aaa ss 3 8 CY ZOSSEL DOVoAO DROVOS Sh whe g & 4 OU < HKORRE ot quCr SUVUOLZSS HLF & ag SOG SS 2240s SRS OZR CRUE Z Lee hE G pa SSSSSECUS SOS he SzgCR EU sE BE REE He oar OURS LAYVOD ome QeEe Ss 2998 & <8 OPSorcr ee ORO, Ritter 3 PP EO bo Oo = Leos YOtOVES ZPRYAEOo OLS Hoh Es 0 SSOSSESSES ESE <OR Se ey ees gees eee G LPOZHSQEEY GHORDRSVOR & Sh Bb Bb & Oe HUVYVURSZHY P00 ad 9202 HO 9 oH Act tae RE Eee ETEE PEER Bish ett Ste Otte PE EE re e ice CELT EE SCGUEZAD CO S908 SEO SH ZEEE 88 & bh Si bb b SS5GSISUROUSS SZESSLSOR REE S oe 2222999209 SE OEE SESLECES PH UEE BS eee EEL CLE iste tel toe EEE ELE PEESSCURSZOROOE LORD BQ Ss BS bo 8 9 <S SESS OSSLSSLULSLE LSE SR ATH Ee es tee a eet Eee eG SEO LO RCSB OSES US aE OR Bae Ge Bs PLUS ZOZYUOS SEAH<ZSUCEOH we Reg ss OS ZSGSK<SFESOR KOS CORES E ae ne sf 8 SOG SSGSSECOED RteOORROG 23 Sm hes KOzt< OOO S SUS ERD SHE SGURS BS eRe eS SESGSSEREQVSSZYOZED DL GVOCE PRBS SSB POZO SE eG ezGORS OSGS0LOR S38 PR8 oH iat ae) = SOUnr V0 = Keo = 2 805 fh & OD 0 BUS LOO LORDS Ooo % 32 5 POSS SS E<GESUOR AC Ze POSsSaes ea ZOSRSERSSUSESEOUOS SS SRS sees es 8 eS SESECSS Sh SSS HOSES SUSUR Ekle aes S SESS EULESS L SER US OP SESS Eee ESI ase 0 FOUd OSXOOLEAS S32 Sh bh MS COS PEALO OQOSOU0RE Pot SS RBBLS HS a DR QEQYESSERLSEYSER SES O23 nM0NS5 eZ aQq SQSEASARLESR SSE SLE CSULS BERET EE TS SOS ZSECOSELS SSE ES RSr sh fags Be BS O Be OS US SUR OBOE SY PHS aes EA 2 SOD PS SS SOB CCE SE CRUE CZ ya Be 8 he 'S) HKtOHO MBW2 Y Sa EEE EEE ETAT ET ELE: WO 2024 / 163957 PCT / US2024 / 014331 O° 28 8 3 pe Ewes VES) = AnyOnmrts e: |ESEG2 82252252525 55022225023 mE aaSe woe nO2852 a> W oN ~ ese Rts ROE < Su Onwmsa zits EX Zs BERS SPOCPLZtS9RRAaS02 Ai nes < Newnan Pr AREY Ae ISOS AES 2 4 MORE RZTECOURPOS Pe Ron te Are asso’ 22 |PRZRSE SRLS ERS SOS BORE ZRIEL TE a8 Ree ASO SaS UM eer seen oGaKceeas 8 Rte SRF AOC Ser Ok enAarKSArSseaY < § aPeee BRYA OSHRTIOOetHne ey c 2 BZTIASeSS0R0 Ae KO >On O ASSL F SFA g aes aes Ox9ASss By RE RESSSORLCAGE OMe EES OR See BEEN ZO oe ME MORE ZOC eee Coase An BSME OS SSS One SREP UOUeSZORAS SeSewORrNonAne re Se5<Snreegorarea PREZROR GAS Qe Usa TV OTe Zeoed SRO SHORE Se DRE OSS ASAE SSE Sr REASR IRA Ze <4 eS HOF ORe eo ae RHO Oe tO KP Oe oe ZT SSO LOSE eRe ECE Oto AchaeaRChCnel-avl en Ac E A SSC ORKR SOE ASCO E EES Maso Kn BSR > MEERA AZLS ASE COE AS eRe HA OMOF RAZ ISS eH ae Hemorsertste Mees sonzcogso os aa soe or eseis MEARS ZS eng e Ae AREER UH SP ECOEs ASA ZZADPRAS AMOR SOR GOH BOSE ROH EZ MESSR ARS OS ER Ree SKM Ee MOCM renee iv Beet ene eo eA eA ASD Zot ee Amz ee MS ORES AVS eR ERQOY ARH OK Minter remsoototes esas Ueae Soon BSB ee nNOS Sh Oozdeot geese ansz4h SKIS RA< EAP SOSY GE MEZOYSSOReE PSeSPRSURE FRYE SoOOYORFCZEYOFA< RSM4ZRES TOG OSM E SuSE re SES ae we BerHoeanKsanezZroseeecOyZyees 3 > RAR RS EASE OAS SS a Sr ENR eAeos = S SR RR SeOLeHR EG aK oe ea Aes e Ene = ee ee eae eee e ASE eOazGach f F AS e098 Casa cS ee Oe sash Zaraass . a SSR RPE OCR SA REZDA TASER ONOASS OO = ZSSE RASS ALES EOELOCE ACORN ES Ka 7 we SGAZAD tiIMAraZ ak> SASFDORRVG Az < n BHOERDS 5} =< LARS JREZEHAMHE RE TYO 8 Aas-eoetnac e = om rT FESS BOO oO eens OMe eA AS Se oS OB 3 oz as Hay 5a g Ta 3 Se Os Z4g oo a, x6 Cae Woo Q Oo & g jo) 1S) WO 2024 / 163957 g g PCT / US2024 / 014331 N J! WA Ww 4 8 I wm & 2wsag Oe ~OU2e DO BE : Ss 4he< Be > SOSEGOL SS BSS se 2 = © FA Poe ZsREOrooss sy ws ws 38 2 6 45Sé B22 yGOSS80e Beary part aad 5 QO 9 A 3 fo) Z. moda! BOS POE OSSOS Ss Hess a2 ree E RE gS Sf 9 BSE: 22 E2855 <235 3 4s 22 e 38 o g Skee 22 SC SL5 ECU s Poe ys Bn pa) QO S é % a ~ Kon I HS 85 POLS Se Hoe Soe = i n Qo@moR He = nT o 46a S22 mee SQOU BRS & Sw 5S £ gees PEL EGR SSO PERS & B 5S & @8$<2 SHS HSGECOU SHA Ee & as $ 6k5e BRE ECVSEO SP FESS - Tihs z= B ESO 22RSG5RG0R Ba gees Thole SHauc Oo oS Ps o) 'S) ow n SSS ES OHOYVS PmMMaE S Oo & eco y S28 SVOER LOS & oo Hs So fant = Li > Hee Ms 2c H R os 5 2 £238 s488SRESoo ane gss A @ FOG B SEQ PE KUED Sms PER ~) ~ Qazty PSS BS SRH <P Se8s RES me e Sa9e B25 REV ROP Es ges G § 2488 FERESOSEES Bese es ee a EEE EL £ Oo EEE SS, Poe s Sm 8 oo 8b 5 & esha SRSSSQH SLL She BBS Ay Z, >>> op Odes OF SoRzeeS2 Z @ S208 285 SHOUzO BSB BSB Q se SS S 5 E2EE bh25g2oe25 2459 a8 A & A842 Ses HPOSSUS gees es o 4 aSEa 28g PECRClL Gk ss RLS 4 gg #a26 8 PHEZTSE SCOPES ess] Ss a) aa) of = Ge A Sate g PPS HSVOOS AO BS HPg . Ye G SESE 8 2B PSS3555 Be Bee Soo Ys “wey 2B S509 3600 m oo g J BB pe ey SSER 2B 395 BU SR SSS owas SB S| ¢ Ho Zx BoeD »o Bhs See ZOOL S Beas o | © 2a GS S628 28 SoPESOGE PES ESS Sg gy L <5 O92 Rak & PELE ECE ECELE S$ 2 92 39 Bess g Say becogsys sage 5 Ee 66 66 SSOz 2 BP mah st Ot te BO & - 433 PHO fUfG< SP aesy 4331 PCT / US2024 / 01 tH cas << SGOVEY 4 o nnansvst 2262550253853 Ww sSEEESEEEESE 20085: Fear eet 2 3 nl re = PP ay ESSeCEeysy ROBSRERS a Ele gece SO< zSOU0S OF 20028 $8 a ee ceeees B ZeOSO8 EEE 2 aS 72> 3225985 PEBCROSSoase ACES) S5zUs FE 4 Sg EEE RECS ESES 2SSE=5 POSF OBOE go” PE CEE SO L Soh ss SEee USeSSEESee Zs ea Besee eee Seo P<H 005S¢s SI Sz Bea se BEo S5OESSY g Zz GRY 20% 3 < 3 x S20 a Be & one) SOS 35 Wi eee <E5OSS Ss) oy EO’ 2eUe Se beSees a2 28 HBo = = bo py Ss YOLUS SO S2ZOESE Sx = Pay ma 228 ee RS) eS OLSSESY GEO SOLS Oo BELT IgESseces <eB Y Bae 2 25828 < Ss oS A Ee e ec e S3ZEO= Ae eee SESE SCRE SES tie Tb eee PESeSseecs 382527225825 SE5509 2299s Seas aa) = oS BB SS xs OOS S 5SUous OEOE C Ve Uae de 200s <z x SSSSES SeESR SS a DEO Zak ZYAe CR = 442g) e258 SEF Fae QO =z CS225 = Boo e Se & OO oe) 'o) HO O OE P P ea RE gee SEBESE E04 O° SES PU bee ees VE<dez Vz RO ESY © BE BER TELE ROA s5 RoE S00 © Re 5S 2 3 eo 8 < Bota Ots SESOO tte V eee S25255 oe) Gae9y © $3233 842 ODER ORURE £0 SESEDR Ee) = 223s Hs oe) SOR®) OEOE LOD HH << Se2ysgey Beas s5ee 'S) ZO oS) iS) ed OU =< tO O DEB 2b2SES ES < Soes s5 < OU 2 oS 89 558 Se ULES se SUSSen z8CEe = 8H so to) Cte te J) UO 'o) ae 2g 2 225869 Se A235 CLO 0 OU ae) 33 oS, 2B tO HOYOS one) 250 c << Oo iS) B23, 25s ae ZOgs Oo 4 st O55 OES Pe ueeeded Oz EES5SSSS O OR tO GEZ222 F8 Oe S382 # SESS eeE SE SCE SESE SORSFSSE TE EERE E Sr eee Chol srsnc 523 3} Bs er eee BEBE O ORS) Seeeegegee Tn ee tt Os seas 3232935 =x as GOVSseL Ude BGO28S ons $922 2828525 SSgo0e zs SHYSSS SO Be Bs a BS 454559 o qx S58SSS 3 2 ao § ee S) OO4See OU Q Te ee ate P e qe2P2 Bogs c6 PEEEEEL mess 5D 5D WO 2024 / 163957 PCT / US2024 / 014331 ome) ae 33 OwYv ) 2 |SSoSESSScese eee saae OZ PRVURE SeSeeztongegseyne2 Su HR ROUUUGSY SUS H&S MME ZS Zz tUOROO SOLO HS HHE AS & - LUEFUS OZOUGVEAS LS HMHO F 2 z ORO OR SVOLOSS RAS HS & 23 SL SOSH SFE SVU SS H&B 8 8% PU ZSSOMEEV Ac hs HESS ee eo BOlOUSE OtOGOefRS HGS MES < § zctVU SPOR eVOb GY mene s g =| Ore CORSZHOS SS RSL O Ot fO0 SOS S & & Ys, OOSGSLELSOEDS BYEPS HS 9 COSREOR SOLE OZ RS H RHO SE ZESEOH OU SSzU Se eHs ae SOOSEVESOUK KER 33 HES OS OO TE HR HL IY AKG PERS Hw SOVAGSZOOVGEV GAL SEs 3 B38 SRVOSTOOLO AEE es mes 5 ZOQVOS0VORUSYHOHS583933 28 OF VZQUZOYUFEOOSS PaHS Hs DVOGOHGROVORZS285829%3%9 82 ROUOrPaeze<th et 59 BO =) 3 Sp SP = & OVOYVDGD S004 2 50 tg mSVX98 9 FO, HOORte esr hMeadsZgy CS SCO SS SROS US PRP BPS & BE ASS S SOUS Os Hee we SPOS SlS5UEes5 Fags ese moO OS Zo Ko S oS SR SHS OES SeUSOF a3 Meee ne RS OORUO RK SOUS S HH Dh BS OOR SOURS OSV STE SSS MS hE POOGOR ES SON OO Sem hes es DELS SG SROSSSS He as He POOLS OH OYUGOD HS mn ee ZOUOVOSORSIOFE SMES HS SGOLOZQZROURS OG PHZP2ES FEOODO SHOUD REOSsoSmones = OL OREVOSLESK< 249382 Heo 7 OR OLHEROL LOSS Heh HS0 tux a oo oH oS SELOSZERSSOSE F248 bE a8 SOSZVLZOLOF SOLS Hl HS SHE EFOSUSPZOLEOHOR SS BS HBSS OOP SZPOO Ze tZEOO mBseS PsZ CSR <DZOCUCE OR By ae Re ES PSEYL ZAC OBER S BS BEE BBO oSOS OO O VOHtBOLUVEBEUVUOOLLE Seg M85 SEUVKEVOLO0UOOU SHS HHS He WO 2024 / 163957 PCT / US2024 / 014331

[00236] The modified ERT2 peptide-suicide protein fusion polypeptide encoding constructs (Constructs 9-12) are delivered to human iPSCs via Nucleofection with a GAPDH targeting ribonucleoprotein (RNP) complex comprising of Cpfl endonuclease and a single guide RNA (sgRNA) targeting the coding sequence of the GAPDH gene, as per Example 2. Individual clones are derived from the transfected pools by puromycin selection and apoptotic efficacy is determined in individual clones edited with Constructs 9-12 by screening clones in the presence of a range of 4-OHT and Endoxifen in PSCs and PSC-derived Myeloid Progenitor cells, as per Example 11. 8.14. Example 14: Assessment improved modified ERT2 peptide-Suicide Protein Constructs, and Evaluation of Apoptotic Efficacy in PSCs and in PSC- derived Myeloid Progenitor Cells

[00237] Induced pluripotent stem cells GPSCs) were edited using Construct 9, 10, 11, or 12 (Table 5). Edited pools of iPSCs were treated with puromycin selection at a concentration of 0.25ug¢ / mL for 3 days starting at 6 days following Nucleofection and continuing until 9 days following Nucleofection. Then combinations of 4-OHT (from 0 to 4nM) and endoxifen (from 0 to 25nM) were added to the edited pools for 3 days. Untreated and treated wells of the edited pools were imaged every 4 hours over the course of the 3 day treatment duration using an Incucyte SX5 (Sartorius) and the confluency in each well was quantified using the onboard Incucyte analysis pipeline. Addition of all tested ranges of combination 4-OHT and endoxifen treatment resulted in cell death, with nearly complete cell death seen for iPSCs edited with Construct 9 (FIG. 17A), 10 (FIG. 17B), and 11 (FIG. 17C). The relative lack of cell death seen for the iPSCs edited with Construct 12 (FIG. 17D) may have been due to incomplete puromycin selection of the edited pool.

[00238] While the present disclosure has been particularly shown and described with reference to a preferred embodiment and various alternate embodiments, it will be understood by persons skilled in the relevant art that various changes in form and details can be made therein without departing from the spirit and scope of the present disclosure and appended claims.

[00239] All references, issued patents and patent applications cited within the body of the instant specification are hereby incorporated by reference in their entirety, for all purposes. 111 WO 2024 / 163957 PCT / US2024 / 014331 WHAT IS CLAIMED IS 1. A targeting construct comprising: (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (i) a modified estrogen receptor ligand binding domain (ER-LBD); and (i1) a caspase 9 domain or derivative or functional fragment thereof; (c) a second homology arm corresponding to a 3' target sequence comprising second region of homology to the target genomic locus, wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the modified ER-LBD comprises a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: (i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, Gi) an L391V substitution, a N413D substitution, a Q414E substitution, a $463P substitution, and a H524F substitution, (ii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, aM421L substitution, aM517A substitution, and a H524F substitution, 112 WO 2024 / 163957 PCT / US2024 / 014331 (iv) an L354] substitution, a L391¥V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, (v) an L391¥V substitution, a Q414E substitution, an N413D substitution, an $463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an MS517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354] substitution, an L384M substitution, and an H524L substitution, or (viii) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element. 2. A targeting construct comprising: (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (i) a first modified estrogen receptor ligand binding domain (ER- LBD); (i1) a first caspase 9 domain or derivative or functional fragment thereof; (iii) a second modified estrogen receptor ligand binding domain (ER-LBD); and 113 WO 2024 / 163957 PCT / US2024 / 014331 (iv) a second caspase 9 domain or derivative or functional fragment thereof; (c) a second homology arm corresponding to a 3' target sequence comprising second region of homology to the target genomic locus, wherein the first modified ER-LBD and the second modified ER-LBD each comprise an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the first modified ER-LBD and the second modified ER-LBD each independently comprise: a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: (i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a $463P substitution, and a H524L substitution, Gi) an L391V substitution, a N413D substitution, a Q414E substitution, a $463P substitution, and a H524F substitution, (ii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, aM421L substitution, aM517A substitution, and a H524F substitution, (iv) an L354] substitution, a L391¥V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, (v) an L391¥V substitution, a Q414E substitution, an N413D substitution, an $463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an MS517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354] substitution, an L384M substitution, and an H524L substitution, or 114 WO 2024 / 163957 PCT / US2024 / 014331 (viii) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element. 3. The targeting construct of claim 1 or 2, wherein the additional amino acid substitutions comprise: (a) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a $463P substitution, and a H524L substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of (SEQ ID NO:2), optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:2, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:?2, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:2; (b) an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:3, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:3; optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:3, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:3; (c) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, aM421L substitution, a M517A substitution, and a H524F substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:4, optionally wherein the modified ER-LBD comprises an amino acid sequence having at 115 WO 2024 / 163957 PCT / US2024 / 014331 least 98% sequence identity to the amino acid sequence of SEQ ID NO:4, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:4, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:4; (d) an L354] substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:5, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:5, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:5, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:5; (e) an L391V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L354] substitution, an L384M substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:40, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:40, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:40, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:40; (f) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:41, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:41, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:41, optionally wherein the modified ER-LBD 116 WO 2024 / 163957 PCT / US2024 / 014331 comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:41; (g) an N413D substitution, an $463P substitution, an L354] substitution, an L384M substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:42, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:42, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:42, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:42; or (h) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354] substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:43, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:43, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:43, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:43, optionally wherein the modified ERT2 peptide further comprises an N-terminal serine (S) residue, optionally wherein the modified ER-LBD comprises the V595A amino acid substitution, optionally wherein the targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to an amino acid sequence set forth in SEQ ID NO: 13, 15, 17, 19, 21, 23, 25, 27, 44, 46, 48, or 50, optionally wherein the targeting construct comprises an amino acid sequence set forth in SEQ ID NO: 13, 15, 17, 19, 21, 23, 25, 27, 44, 46, 48, or 50. 4. The targeting construct of any one of claims 1-3, wherein: 117 WO 2024 / 163957 PCT / US2024 / 014331 (a) the caspase 9 domain or derivative or functional fragment thereof does not comprise a Caspase Activation and Recruitment Domain (CARD) domain sequence, optionally wherein the caspase 9 domain or derivative or functional fragment thereof comprises (SEQ ID NO:6); (b) the modified estrogen receptor ligand binding domain (ER-LBD) is N- terminal or C-terminal to the caspase 9 domain or derivative or functional fragment thereof, optionally wherein the fusion polypeptide comprises a linker between the modified estrogen receptor ligand binding domain (ER-LBD) and the caspase 9 domain or derivative or functional fragment thereof. (c) neither the first nor second caspase 9 domain or derivative or functional fragment thereof comprise a Caspase Activation and Recruitment Domain (CARD) domain sequence, optionally wherein the first caspase 9 domain or derivative or functional fragment thereof and / or the second caspase 9 domain or derivative or functional fragment thereof comprises (SEQ ID NO:6); and / or (d) the first ER-LBD is N-terminal or C-terminal to the first caspase 9 domain or derivative or functional fragment thereof and / or the second ER-LBD is N-terminal or C-terminal to the second caspase 9 domain or derivative or functional fragment thereof, optionally wherein the fusion polypeptide comprises a linker between the modified estrogen receptor ligand binding domain (ER-LBD) and the caspase 9 domain or derivative or functional fragment thereof. 5. The targeting construct of any one of claims 1 to 4, which is configured such that upon its recombination with the target genomic locus, the STEL gene is modified such to incorporate the fusion polypeptide coding sequence 3’ to the STEL protein coding sequence or 5' to the STEL protein coding sequence. 6. The targeting construct of any one of claims | to 5, wherein the nucleotide insert further comprises a nucleotide sequence encoding a separator sequence, optionally wherein thee targeting construct is configured such that upon recombination of the targeting construct with the target genomic locus, the separator sequence coding sequence is positioned between the coding sequence of the STEL protein and the fusion polypeptide coding sequence, optionally wherein the separator sequence is (a) an internal ribosome entry site (‘IRES”) or (b) a self- cleaving peptide, optionally wherein the self-cleaving peptide is a 2A peptide, optionally wherein the self-cleaving peptide is T2A, P2A, E2A, F2A, PQR, Opt2A, or Opt2A_2.0. 118 WO 2024 / 163957 PCT / US2024 / 014331 7. The targeting construct of any one of claims 1 to 6, wherein the STEL gene encodes a polypeptide involved in one or more of: glycolysis, ribonucleopolypeptide complex formation, focal adhesion, cell-substrate adherens junction, cell-substrate junction, cell anchoring, extracellular exosome, extracellular vesicle, intracellular organelle, anchoring junction, RNA binding, nucleic acid binding (e.g., rRNA or mRNA binding), and polypeptide binding, optionally wherein the STEL gene encodes a ribosomal polypeptide, optionally wherein the STEL gene is RPL13A, RPLPO, RPL10, RPL13, RPSJ8, RPL3, RPLP1, RPL15, RPL41, RPL11, RPL32, RPL18 A, RPL19, RPL28, RPL29, RPL9, RPL8, RPL6, RPL18, RPL7, RPL7A, RPL21, RPL37A, RPL 12, RPL5, RPL34, RPL35A, RPL30, RPL24, RPL39, RPL37, RPL14, RPL27A, RPLP2, RPL23A, RPL26, RPL36, RPL35, RPL23, RPL4, or RPL22, optionally wherein the STEL gene encodes a ribosomal polypeptide small subunit (RPS), optionally wherein the STEL gene is RPS2, RPS19, RPS14, RPS3A, RPS12, RPS3, RPS6, RPS23, RPS27A, RPS8, RPS4X, RPS7, RPS24, RPS27, RPSIS5A, RPS9, RPS28, RPS13, RPSA, RPS5, RPS 16, RPS25, RPS15, RPS20, or RPS11, optionally wherein the STEL gene encodes a mitochondrial polypeptide, optionally wherein the STEL gene is MT-CO1, MT-CO2, MT-ND4, MT-ND1, or MT-ND2, optionally wherein the STEL gene encodes an actin polypeptide, optionally wherein the STEL gene is ACTG1 or ACTB, optionally wherein the STEL gene encodes a eukaryotic translation factor, optionally wherein the STEL gene is EEFIA1, EEF2, or EIF1m optionally wherein the STEL gene encodes a histone, optionally wherein the STEL gene is H3F3A or H3F3B, optionally wherein the STEL gene is FTL, FTH1, TPT1, IMSB10, GAPDH, PTMA, GNB2L1, NACA, YBX1, NPM1, FAU, UBA52, HSP90AB1, MYL6, SERF2, or SRP14, optionally wherein the STEL gene is GAPDH, optionally wherein the STEL gene is RPL13A, optionally wherein the STEL gene is RPL7, optionally wherein the STEL gene is RPLPO. 8. The targeting construct of any one of claims | to 7, wherein the nucleotide insert further comprises a transgene, optionally wherein the transgene is linked to the fusion polypeptide coding sequence, optionally wherein the transgene encodes a therapeutic polypeptide, optionally wherein the fusion polypeptide coding sequence and transgene are connected via a nucleotide sequence encoding a separator sequence, optionally wherein the separator sequence is an internal ribosome entry site (“IRES”’), optionally wherein the separator sequence is a nucleotide sequence encoding a self-cleaving peptide (the “self-cleaving peptide coding sequence’), optionally wherin the self-cleaving peptide is a 2A peptide, optionally wherein the self-cleaving peptide is T2A, P2A, E2A, F2A, PQR, Opt2A, or Opt2A_2.0. 119 WO 2024 / 163957 PCT / US2024 / 014331 9. A system comprising: (a) the targeting construct of any one of claims | to 8; (b) a CRISPR-associated endonuclease (“Cas polypeptide”) or a nucleic acid encoding a Cas polypeptide; and (c) a guide RNA (“gRNA”) comprising a scaffold for binding the Cas polypeptide and a spacer sequence corresponding to the STEL gene, or a nucleic acid encoding the gRNA, optionally wherein the guide RNA is a single guide RNA (“sgRNA”), optionally wherein the system comprises the Cas polypeptide and gRNA, optionally wherein the system is in the form of a ribonucleoprotein particle (“RNP”). 10. A method of producing a gene-edited target cell, comprising: (a) introducing the system of claim 9 into a target cell; and (b) culturing the target cell under conditions in which gene editing occurs, thereby producing gene-edited target cell, optionally wherein the gene-targeted cell is of ectoderm lineage, optionally wherein the gene-edited target cell is a neuron, optionally wherein the gene-targeted cell if of mesoderm lineage, optionally wherein the gene-edited target cell is a cardiomyocyte. 11. The method of claim 10, wherein the target cell is: (a) a stem cell or a cell differentiated from a stem cell, optionally wherein the target cell is a stem cell, optionally wherein the stem cell is a human embryonic stem cell, (b) an induced pluripotent stem cell (“iPSC’’) or a cell differentiated therefrom, optionally wherein the target cell is (a) a regulatory T cell, a myeloid cell, a dendritic cell, a macrophage (e.g., an immunosuppressive macrophage), a myeloid progenitor cell, or a precursor or progenitor cell thereof; (c) a cell in the human nervous system, optionally selected from dopaminergic neuron, a microglial cell, an oligodendrocyte, an astrocyte, a cortical neuron, a 120 WO 2024 / 163957 PCT / US2024 / 014331 spinal or oculomotor neuron, an enteric neuron, a Placode-derived cell, a Schwann cell, and a trigeminal or sensory neuron, or a precursor or progenitor cell thereof; (d) a cell in the human cardiovascular system, optionally selected from a cardiomyocyte, an endothelial cell, and a nodal cell, or a precursor or progenitor cell thereof; (e) a cell in the human metabolic system, optionally selected from a hepatocyte, a cholangiocyte, and a pancreatic beta cell, or a precursor or progenitor cell thereof, or (f) a cell in the human ocular system, optionally selected from a retinal pigment epithelial cell, a photoreceptor cone cell, a photoreceptor rod cell, a bipolar cell, a ganglion cell, or a precursor or progenitor cell thereof. 12. A gene-edited target cell obtained or obtainable by the method of claim 10 or 11. 13. A gene-edited target cell comprising a STEL gene that comprises a nucleic acid encoding a fusion polypeptide under the transcriptional control of a STEL gene regulatory element, the fusion polypeptide comprising: (a) a modified estrogen receptor ligand binding domain (ER-LBD); and (b) a caspase 9 domain or derivative or functional fragment thereof, wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the modified ER-LBD comprises a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: (1) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, 121 WO 2024 / 163957 PCT / US2024 / 014331 (ii) an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution, (ii) an L354] substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, a M517A substitution, and a H524F substitution, (iv) an L354] substitution, a L391¥V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, (v) an L391¥V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L354I substitution, an L384M substitution, and an H524L substitution, (vi) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L354I substitution, an L384M substitution, and an H524L substitution, or (viii) an L391V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution, optionally wherein the modified ER-LBD is as defined in any one of claims 1-3, optionally wherein the caspase 9 domain or derivative or functional fragment thereof is as defined in claim 4, optionally wherein the fusion polypeptide is as defined in claim 4, optionally wherein the STEL gene is configured as defined in claim 7, optionally wherein the gene-edited target cell of claim 12 further comprises a transgene in the STEL gene, optionally wherein the transgene is as defined in claim 8, optionally wherein the target cell is as defined in claim 10 or 11. 122 WO 2024 / 163957 PCT / US2024 / 014331 14. A pharmaceutical composition comprising the gene-edited target cell of claim 12 or 13 and a pharmaceutically acceptable carrier. 15. A method of treating a patient in need thereof, comprising administering to the patient the gene-edited target cell of claim 12 or 13 or a pharmaceutical composition comprising the gene-edited target cell of claim 12 or 13 and a pharmaceutically acceptable carrier, optionally wherein the method further comprises controlling the gene-edited target cell population in the patient by: (a) monitoring, optionally, the gene-edited target cell population in the patient; and / or (b) administering an inducer of the modified ER-LBD if the patient experiences adverse events related to the gene-edited target cell population. 16. A method of mitigating adverse events or a safety risk associated with cell therapy in the form of the gene-edited target cells of claim 12 or 13 or the pharmaceutical composition of claim 14, the method comprising administering to a patient who received the gene-edited target cells or pharmaceutical composition an inducer of a modified ER-LBD if the patient experiences adverse events or a safety risk related to the gene-edited target cells or pharmaceutical composition, optionally wherein the inducer of the modified ER-LBD is tamoxifen or a tamoxifen metabolite, optionally wherein the inducer of the modified ER-LBD is tamoxifen, optionally wherein the inducer of the modified ER-LBD is a tamoxifen metabolite, optionally wherein the inducer of the modified ER-LBD is 4-hydroxytamoxifen, N- desmethyltamoxifen, tamoxifen-N-oxide, or endoxifen, optionally wherein a combination of two or more inducers of the modified ER-LBD is administered, optionally wherein the combination comprises 4-OHT and endoxifen, optionally wherein the combination has a synergistic effect and / or utilizes reduced dosing (e.g., reduced dosing amount and / or frequency) than would be required a single inducer of the modified ER-LBD. 123 WO 2024 / 163957 PCT / US2024 / 014331 1 / 25 =o= O> OQ BS © Rt © © <— faa) el el OO | eg! =O mio} too} i Oia EOIN i >!iF 5 ‘Eat WO 2024 / 163957 PCT / US2024 / 014331 2 / 25 — aire eee ——— an ae ee O> Z B © © ©O ©O <— faa) N N St ceics) LL gD! AD! QO} 5 DIN; EOIN YG Bao iho} | eer Oana ieee atte WO 2024 / 163957 , . PCT / US2024 / 014331 a y i 3 / 25 3 i we § By s ’ . $ es $ : N Om ~<20 Bu Su ee S S 8 Aa OS | Be ee so 8 = o.oo ” © Lu & _ g xo} c ~N Fk co Lu & ee oe ‘ ut ae = WO 2024 / 163957 PCT / US2024 / 014331 4 / 25 : BALQ : Ry A Om ~~ t 0 fo —t oO. : 1 "Ry, . ao) ; 1 hy Wy 2 ; “o / Po Cc : % = : + 4% : % on ~ — - — en > Y o on» + © A = = Pe}Ipy Sesiiv JO % + : CQ : ' nig, <C : 74 f : +, 40 v = Oo w : 1 “ey . oe & : + LL Oo . 40 Ss \ Ww N, S : Y 3) oo — el > Se = ee = 2 = 2 = Y ono tT OHO AN = xr Q peypy ssjaiiv Jo % am WO 2024 / 163957 PCT / US2024 / 014331 5 / 25 Rly WY —. AB O%, eR ho, Ye — @) OR NR oO. —or—“‘C‘“C*™!;*C*s*s*s*s*C*S*C*C*C*C mo 0. NN h e | 3 / 0 Se ee eee ee ee ee ees hy My, ~~ ss K foo a ~~ OM Ce —— % < ol r—~s—SCSC 0. 0. Cl EE (@) SN ee CULL OM ys, = | Veo fto | ###==— fey ty “ut rr—i“‘“:éOCOCO y rrr—“‘“CCOCN eT —sSC WO 2024 / 163957 PCT / US2024 / 014331 6 / 25 7 / 0 Yy% ioe Y% % 4 “a, , & a & Ay v o oD < Bo,% 3 & 45% Le “9, &% co z= & > >, 8G WwW © Oy", © & 93% "D o 4%, 0 a 934% £2, %O “9% KS eo 2,% O% 29%, co) N = fo) é 2% (Z x (eu / jebueL)) YO awousby jul }obie | Q5 WO 2024 / 163957 PCT / US2024 / 014331 7 / 25 ces . Ee oe - == 8 = SN So SS x SER RSE SSS SERS SEE rb) rrr — _ — _ F— pees) LHO-V INYL eS Ee re Ran cc e pejeol}uf) LHO-? WUL Ee nee Go ke Sea ee Ayu pejeasjun aa bis Ba = ——a1 poyecyur) LHO-¢ WUL 12 / 25 £m, Le 2024 / 163957 e re toa : 3 iS Sy By " 3 ES vey t 3 . . ros cs $ 3 wo hee OES rae z g Be a : 3 wh wei ae SNES EA ogy ¢ NN 8 Pr ey : N BATE eaten es ERS BY Mi & g 8 wo Le a, = : 3 R a SRE ya = 8 OT Sta es Smaht SI, te ok £ : “ nese SEES & BN = 8 woattn Sar Sage “ 2 OS ws nash eR ara LAS aay 2 OS os 7 we SECIS ee & . g . * en EAP? Note Say i : pe = BY “SS ss oN = ~ a ~~ Ns < “ rs S83 OIE 8 : x i r s : f S » i: s " s. ad : ‘ b i de SS : i tos a s : 3 y : : po i x. 3 fw i ‘ % z LoS 5 .. 2 z foo SE § $ Bits = fy : $ N BAY 3 Los t ey. 8 S & t 2 ©. i : i SS ny z y & § ee 3 i YS BS ay = m Ra : R a) g g es g Ny = g t aes : Ne a La x ry oe : g s Ls : : : eal gh : . x i Se ae x Cae x ss Sosy i 3 i . RE = ¥S = : x : = me £8 s : Me SoBe . d. g & S. S r f Ss : : Pox S i Ny 2S a Ny BY aches. S 3 § ce t 4 Pee A Py . z 3 ENE. & : 2p peg ght a ae aw = x. S Ba g eee eine SAM q z g Re en Sy g is 2 ens . = est Se She £ econ a By weg 7 Us EES Sey red =r : MBEAN SESS Sorceengenneny Red : . a ae: os a z ANA RAND = = 2 recente - teh wos s eee Roa ays eS Freeper iL) BS] “Shot CDRS Sl Dod aS gS Ry : Ge ae y - i scoromnnennnnnnnnn N ¢ f . s : Ss t Pag poe " Ls BC i a soe i : ‘ . _ Ro. . . he : , . N = s S + N i . Ni < aa an . mS po . : : i Ny : . & < gee y . foe Fa * a fore Roe aN a fees or esc hes I on Ss Ne eS : . We LARS TERRES i fo et. . caaguacigcupuageninng! PNY <p Be ; ws Sh Met ~NSS ER TE. PSA SESAA RASA SAAS SY ws * go . gesie ER * Se Roe i Ae eegeneny x fof, aes Ste an ES ha SS perenne y % a * cae teas. has: aN as Renseaieen m7 os a Re Poa : Sager planers & s ” tS iS ae 3 ce Ba ~ sc oeecquaqanpanguanpeny " re = s ¥ x = SOE S 3 8 as £ t me, re g H aa i i PE ay g H , . a a ot foe Xawewnwennnnnennnnnnnnnnanannnnnnntanasitindilat BEER cient B aS + i oe i Ss RRR Pas aN at Ror eg Ta oe : Se - SEER ES we Sk ey SERS ESE = 8 £ : : 7 ARR ij no sae Regee ua t g S oop pe pesnmegpeespeggssngpesnpengpongsoniosngannpemaopsongemagionpon = 2 ae ae oo = > = x Pa] & xS SS Bcd a in a =I oe o a RS ol - = 3 Tego TE Ban a. ‘ Ce a lated WIENS COWS WIS 6 PISS g i ae = : Yoogsy od i i i : g Lo = i : i i 4 ¢ £ t ogee a : Res uh e Loos . foe a ~ a fo t & Pz r $ ~ t eh t (o>) Ry ros = m x ™ ian] = nh t CS" i ne etc “ b / os Sts. MRSS TRES 0 URS UIC IS Ula 4 eee i h : foe : j . i . Los tle i os . _ : oO 8 ESS ‘ PE Se | SSDI LLIN DEER NE SHURE took naan: a RY SSL ci ta we oe a ™” 7 — is payeaujun LHO-r UL WO 2024 / 163957 PCT / US2024 / 014331 14 / 25 _ & ee cs) >= & c = Lo oO kK => = = c r = oc => Cc rant = => FSD O ww Wo co jw ww Ww = =-= 32> T Lo LO ro) & — ke i LE LE — fo) £€£ooxkooozkdzi ®2 — i i © i i cr Oo OO = 22e2282 223 Se = 6 + © S Sa KK Ss o -. UV YT Te Te YS oo oOo oOo oOo oOo oOo oOo oOo oOo oOo fal —_ —_ N N oO oO + +r ~~ ~~ ~~ ~~ ~~ ~~ ~~ ~~ ~~ o>) oO oO oO oO oO oO oO oO oO wo — — — — — — — — — _ —] —] —] —] —] —] —] Ss + zo} wn wn wn wn wn wn wn wn wn o [ [ [ [ [ [ [ [ [ = © 6 668606056 6 065 6 DD O OO ODO OO VO OO OO OO O Com] — So . eo © LL ’ me = \\ ee ® + ° So So So So So So Ww So Te) N = = (0.1 30 %) ISAWSOSd 8AIT WO 2024 / 163957 PCT / US2024 / 014331 15 / 25 _ & ee =>) = = c st ~ ra) F- = = =>s8 c © —_— —_ i —_— —_ — Cc c = H — — — st LE el a5 c TeE Toe pekKE FE fg 2 Oot OO se 2) Jr VY Gr ry JF Ft ce = (fe) —- ©& oOo — cO ~ 6 >. UV NTT Te Te YS Be PC FPF 8 8&0 GB GB 8B 8 © oO a ™N N (oe) oO = = — ~~ ~ ~ ~ ~ _ ~ —_ _ om © G6 GO BO BO BO BO BG GB ab) = — — => > > 5 > co = 56 5 5B B&B 5B B&B EE Go Nn 2) n on an wn ” an on o i < < < i c c Cc < i= oO oO oO oO oO oO oO oO {eo} Da O OO OO OO UO O VO OO OO o faa] oO So = : LL Ph ié is aoe ig if. — vk \\ aS © / - Oo ro) ° ro) oO oO oS Ww) °o Ww N = = (OL JO %) IIAAWSOSd 8AIT WO 2024 / 163957 PCT / US2024 / 014331 16 / 25 _ = = [ — cs) S & = => > S - 22384228222 e:°¢ & oO CO Oo c = & x - 2SForwrrt fF ooqoisg —_ c c c —_ —_ oO S G§& § ¢« © ©® © s¢& &s BS c - £ G6 © © £ @G D E wes: FF £ *® ® RX ££ £ 6 . fo) o x< oO oO (o} x< x< = oso 5 ST Ge SH SSD SE E25 55 2 2 F > Uw GB ete Y Gg ot Sr nm =. SS G&G G&G . . w& er 6 Tr OG FE OK o wv UN Te TH Te YS oo oOo oOo oOo oOo oOo oOo oOo oOo oOo oO ~~ —- NN oo OD OUST a ~~ ~~ ~~ ~~ ~~ ~~ ~~ ~~ ~~ o>) oO oO oO oO oO oO oO oO oO wo — — — — — — — — — a — Ss +S + SS + —] SS + zo} wn wn wn wn wn wn wn wn wn o [ [ [ [ [ [ [ [ [ = © 6 66 66 6 6 65 DD O OO OO OO OO VO OO OVO O — oO © e LL 3 BRS N ER? — | ae o ; y Bas SS So So So So So i) ww) fo] ww) N - = (0.1L $0 %) II8aMW / SOSd 9AIT WO 2024 / 163957 PCT / US2024 / 014331 17 / 25 — 2 E [ — = S = => S i 622s 222226 S - = a c Soc bol c c c bol bol oO So § &§ « © © @©@ fc & c £ L£ oF £ £ ££ © @ E . ‘o) o x< {eo} {eo} (eo) x< x< = op S$ Ss tT GFT GBH SECS Ss fae 2a 6 6 2 22 oHDuwuw pt fs Yoo Ee +r CO Tr DBT TFT OAK OC o oOo oOo oOo oOo oOo oOo oOo oOo oOo oa wr —_ NON oOo 69 + a ~~ ~~ ~~ ~~ ~~ ~~ ~~ ~~ ~~ o>) oO oO oO oO oO oO oO oO oO rab) — — — — — — — — — YF fs — SS + SS + —] SS + Zoe) wo wo wn wn wn wn wn wn wn o [ [ [ [ [ [ [ Cc Cc =-=€§ 0 06060060 60060 0656 85 6 Da O O OO O OO O OO YO OO — fl] rr op] : LL * s fof 2 ee Se x a, SS a *~. i] f=] i] i=] l=] So Te) C—] Ve) N - = (01 JO %) IIAM / SOSd 2@AIT WO 2024 / 163957 PCT / US2024 / 014331 18 / 25 Fac Oc “sages cV cut ss ° Soe g = | oS : ow} Ww “ (OL 10%) SAAS OS, BAY oc [al - xX 26 © < ees = FOS TED * © FF Jay tyortre * he @ES t O * © FaAEE . Soacooer ——1—T—_ o (OLIO 4%) HEARS 58 SAM WO 2024 / 163957 PCT / US2024 / 014331 19 / 25 Ce ) aN 4s a.oH te ndoiten aS we SSE oe Se Quantify % killin TamCasp? TamCaspe nPSCs myeioid progenitors FIG. 13A CD45 | as : rr ceomerey * _ CD45 FIG. 13B a \ o o o S iouiee — 100 nM FIG. 13C WO 2024 / 163957 PCT / US2024 / 014331 21 / 25 Endoxifen treatment of unedited myeloid progenitors 100 75 zo] 5] [0] QO 50 38 wh SS s ok 0 48 96 Hours Endoxifen treatment of TamCasp9-edited myeloid progenitors 400 a -~x-~ OnM Endoxifen a ~s nM Endoxifen 75 f 8 10nM Endoxifen as} ae ~*~ 100nM Endoxifen $ a we aed C50 Foe ® ° ae - eng ene gent se e ok 0 48 96 Hours WO 2024 / 163957 PCT / US2024 / 014331 22 / 25 = E- kK Tok po i Tope Oz OZTZTtLSO + O i as w i i wr => wv Sv vyvOsdq cs f2e2res oO Cc mo ©£ fF SZ OO =~ CO 6 Sr fT Gg, SEB O Oo O = O xc Ss ce 2 TO ro) T ro) T Oo ¢ Lu Oo W Cc co} Cc co} Cc Oo uw Cc oD) suWUsUSWU2S5C SELES SCS C CEBnN CB oO Oo ZH THESON DSS N ON DO WN OD - Z 1 I I! I! I 1 1 I 1 I I I 8 a 8 8 ND DD DDD DD B&B SYS YS OO0O0000005 55S SERBEE EEL 222 Fe Fe RF RF F&F RF Fe DDD LD r ei 2 ©) £ v7 7 ® AY \ - © S\ 2 — © E sg 3 : 6 = yyeoqd % WO 2024 / 163957 PCT / US2024 / 014331 25 / 25 Ss Ss fo] fo] gude guue c lw fom Lu Gz2! GZ2! Slow So WO <VNw wo < Nw wo Oo oO - A Oo oO ~~ NAN — — — — — — — — FEFEEE FFEE ee ILIrL 0009 090990 SS rrr 2esetst =2e2asaest c c Cc c c c Cc c oO - N TT oO rf NAN tT So So ie} ie} ou Bas LS Oo “a SO 3 2 * 4 _ a 2 aN ~ Qa 0 ee S oc 0 OYA of! =i 3 ca} FQ 8 ws | F © ) “A 9° “ v2) So re) So oS So So So o = = wv o N =- (%) Aouenyuoy (%) Aouanyuog Ss Ss gadg 2 gag? c Lu c Lu u 22s u 22s Sow Se Wo < VNwaw o <_< Nw 6 eer ee zr NQ FEEE FEFEEE ee ILILtL 0009 090909 SS SS eS i 2esetst ]2estas c c Cc c c c Cc c oO - N TT oO rN YT So So ie} ie} E ~ | ga £ ~ if, O a 8 ek v2) So ve) o v2) So ve) o - - - - (%) Aouenyuoy (%) Aousnyueg INTERNATIONAL SEARCH REPORT International application No. PCT / US2024 / 014331 A. CLASSIFICATION OF SUBJECT MATTER IPC: A61K 31 / 138 (2024.01); A6LK 35 / 12 (2024.01); CO7K 14 / 47 (2024.01); CO7K 16 / 28 (2024.01); CO7K 19 / 00 (2024.01); C12N 15 / 113 (2024.01); CIZN 15 / 62 (2024.01); C12N 15 / 90 (2024.01); C12N 5 / 10 (2024.01); CI2N 9 / 22 (2024.01); CI2N 964 (2024.01) CPC: CI2N 15 / 62; CO7K 19 / 00; C12N 15 / 902; AGLK 35 / 12; A6LK 39 / 4637; CO7K 16 / 28; CI2N 96478; CO7K 2319 / 715; C12N 9 / 22; C12N 15 / 113; C12N 2310 / 20; CO7K 14 / 4747; A61K 31 / 138; C12N 5 / 10 According to International Patent Classification (IPC) or to both national classification and IPC B. FIELDS SEARCHED Minimum documentation searched (classification system followed by classification symbols) See Search History Document Documentation searched other than minimum documentation to the extent that such documents are included in the fields searched See Search History Document Electronic data base consulted during the international search (name of data base and, where practicable, search terms used) See Search History Document Cc. DOCUMENTS CONSIDERED TO BE RELEVANT Citation of document, with indication, where appropriate, of the relevant passages Relevant to claim No. WO 2022 / 109421 Al (SENTI BIOSCIENCES INC.) 27 May 2022 (27.05.2022) Y entire document 1-3 WO 2022 / 216825 Al (SENTI BIOSCIENCES INC.) 13 October 2022 (13.10.2022) Y entire document 1-3 WO 2021 / 072329 Al (BLUEROCK THERAPEUTICS LP) 15 April 2021 (15.04.2021) Y entire document 1-3 US 2011 / 0023137 Al (CHU et al.) 27 January 2011 (27.01.2011) A entire document 1-3 [Further documents are listed in the continuation of Box C. [| See patent family annex. * — Special categories of cited documents: «T” later document published after the international filing date or priority “a” document defining the general state of the art which is not considered date and not in conflict with the application but cited to understand the to be of particular relevance principle or theory underlying the invention “ED” document cited by the applicant in the international application “x” document of particular relevance; the claimed invention cannot be “f” earlier application or patent but published on or after the international considered novel or cannot be considered to involve an inventive step filing date when the document is taken alone «document which may throw doubts on priority claim(s) or which is “Y” document of particular relevance; the claimed invention cannot be cited to establish the publication date of another citation or other considered to involve an inventive step when the document is special reason (as specified) combined with one or more other such documents, such combination «Q” document referring to an oral disclosure, use, exhibition or other being obvious to a person skilled in the art means “&” document member of the same patent family «“p” document published prior to the international filing date but later than the priority date claimed Date of the actual completion of the international search Date of mailing of the international search report 18 April 2024 (18.04.2024) 12 June 2024 (12.06.2024) Name and mailing address of the ISA / US Authorized officer Mail Stop PCT, Attn: ISA / US MATOS Commissioner for Patents TAINA P.O. Box 1450, Alexandria, VA 22313-1450 Facsimile No. 571-273-8300 Telephone No. 571-272-4300 Form PCT / ISA / 210 (second sheet) (July 2022) INTERNATIONAL SEARCH REPORT International application No. PCT / US2024 / 014331 Box No. I Nucleotide and / or amino acid sequence(s) (Continuation of item 1.c of the first sheet) 1. With regard to any nucleotide and / or amino acid sequence disclosed in the international application, the international search was carried out on the basis of a sequence listing: a. [| forming part of the international application as filed. b. furnished subsequent to the international filing date for the purposes of international search (Rule 13ter.1(a)), accompanied by a statement to the effect that the sequence listing does not go beyond the disclosure in the international application as filed. 2. [| With regard to any nucleotide and / or amino acid sequence disclosed in the international application, this report has been established to the extent that a meaningful search could be carried out without a WIPO Standard ST.26 compliant sequence listing. 3. Additional comments: Form PCT / ISA / 210 (continuation of first sheet) (July 2022) INTERNATIONAL SEARCH REPORT International application No. PCT / US2024 / 014331 Box No. IT Observations where certain claims were found unsearchable (Continuation of item 2 of first sheet) This international search report has not been established in respect of certain claims under Article 17(2)(a) for the following reasons: 1. | Claims Nos.: because they relate to subject matter not required to be searched by this Authority, namely: 2. [| Claims Nos.: because they relate to parts of the international application that do not comply with the prescribed requirements to such an extent that no meaningful international search can be carried out, specifically: 3. Claims Nos.: 4-16 because they are dependent claims and are not drafted in accordance with the second and third sentences of Rule 6.4(a). Box No. HI Observations where unity of invention is lacking (Continuation of item 3 of first sheet) This International Searching Authority found multiple inventions in this international application, as follows: This application contains the following inventions or groups of inventions which are not so linked as to form a single general inventive concept under PCT Rule 13.1. In order for all inventions to be examined, the appropriate additional examination fees need to be paid. Group I+: claims 1-3 are drawn to targeting constructs. The first invention of Group I+ is restricted to an ER-LBD variant comprising SEQ ID NO: | further comprising G400V, M543A, and L544A substitutions, and targeting constructs comprising the same. The first named invention has been selected based on the guidance set forth in section 10.54 of the PCT International Search and Preliminary Examination Guidelines. Specifically, the first named invention was selected based on the first listed compound species presented in the claims (see claim 1). It is believed that claims 1 and 2 read on this first named invention and thus these claims will be searched without fee to the extent that they read on an ER-LBD variant comprising SEQ ID NO: | further comprising G400V, M543A, and L544A substitutions, and targeting constructs comprising the same. Applicant is invited to elect additional ER-LBD variants to be searched in a specific combination by paying an additional fee for each election. An exemplary election would be an ER-LBD variant comprising SEQ ID NO: 1 further comprising G400V, M543A, L544A, and L384M substitutions, and targeting constructs comprising the same. Additional ER-LBD variants will be searched upon the payment of additional fees. Applicants must specify the claims that read on any additional elected inventions. Applicants must further indicate, if applicable, the claims which read on the first named invention if different than what was indicated above for this group. Failure to clearly identify how any paid additional invention fees are to be applied to the “+” group(s) will result in only the first claimed invention to be searched / examined. The inventions listed in Groups I+ do not relate to a single general inventive concept under PCT Rule 13.1, because under PCT Rule 13.2 they lack the same or corresponding special technical features for the following reasons: The Groups I+ formulas do not share a significant structural element responsible for ER-LBD variants requiring the selection of alternative amino acid substitutions where “wherein the modified ER-LBD comprises a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1: (i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, Form PCT / ISA / 210 (continuation of first sheet) (July 2022) INTERNATIONAL SEARCH REPORT International application No. PCT / US2024 / 014331 and a H524L substitution, (ii) an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution, (111) an L3541 substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, a M517A substitution, and a H524F substitution, 112 Atty. Docket No.: STB-052WO Client Docket No: SNTI-0052-W0O (iv) an L3541 substitution, a L391¥V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, (v) an L391V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L3541 substitution, an L384M substitution, and an H524L substitution, (vi) an L391 V substitution, an N413D substitution, an $463P substitution, an M517A substitution, an M421L substitution, an L3541 substitution, and an H524L substitution, (vii) an N413D substitution, an $463P substitution, an L3541 substitution, an L384M substitution, and an H524L substitution, or (viii) an L391¥V substitution, an N413D substitution, an S$463P substitution, an M517A substitution, an M421L substitution, an L3541 substitution, and an H524L substitution.” Additionally, even if Groups I+ were considered to share the technical features of a targeting construct comprising: (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (1) a modified estrogen receptor ligand binding domain (ER-LBD); and (ii) a caspase 9 domain or derivative or functional fragment thereof; (c) a second homology arm corresponding to a 3' target sequence comprising second region of homology to the target genomic locus, wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence, wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element; A targeting construct comprising: (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (i) a first modified estrogen receptor ligand binding domain (ER-LBD); (ii) a first caspase 9 domain or derivative or functional fragment thereof; (iii) a second modified estrogen receptor ligand binding domain (ER-LBD); and (iv) a second caspase 9 domain or derivative or functional fragment thereof; (c) a second homology arm corresponding to a 3’ target sequence comprising second region of homology to the target genomic locus, wherein the first modified ER-LBD and the second modified ER-LBD each comprise an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence, wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element, these shared technical features do not represent a contribution over the prior art. Specifically, WO 2022 / 109421 to Senti Biosciences Inc. teaches a targeting construct comprising: (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (i) a modified estrogen receptor ligand binding domain (ER-LBD); and (ii) a caspase 9 domain or derivative or functional fragment thereof; (c) a second homology arm corresponding to a 3’ target sequence comprising second region of homology to the target genomic locus, wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence, wherein the targeting construct is configured such that upon its recombination with the target genomic locus (the present disclosure provides an inducible cell death system comprising two or more polypeptide monomers, wherein each polypeptide monomer comprises one or more ligand binding domains and a cell death-inducing domain,... the one or more ligand binding domains of each of the two or more polypeptide monomers comprise a domain or functional fragment thereof selected from the group consisting of... a hormone-binding domain of estrogen receptor (ER) domain ... the cell death-inducing domain is derived from a protein selected from the group consisting of:... caspase 9, Para.

[0005] ; the at least one of the two or more polypeptide monomers further comprises a linker localized between each ligand binding domain and cell death-inducing domain, Para.

[0009] ; exogenous polynucleotides are introduced into the cell to be used as a homologous recombination template (HRT or HR template), Para.

[00361] ; The identical, or substantially identical, sequences found at the 5’ and 3’ ends of the HR template, with respect to the exogenous sequence to be introduced, are generally referred to as arms (HR arms), Para.

[00363] ); A targeting construct comprising: (a) a first homology arm corresponding to a 5’ target sequence comprising a first region of homology to a target genomic locus; (b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising: (i) a first modified estrogen receptor ligand binding domain (ER-LBD),; (ii) a first caspase 9 domain or derivative or Form PCT / ISA / 210 (continuation of first sheet) (July 2022) INTERNATIONAL SEARCH REPORT International application No. PCT / US2024 / 014331 Box No. TI Observations where unity of invention is lacking (Continuation of item 3 of first sheet) functional fragment thereof; (iii) a second modified estrogen receptor ligand binding domain (ER-LBD); and (iv) a second caspase 9 domain or derivative or functional fragment thereof; (c) a second homology arm corresponding to a 3’ target sequence comprising second region of homology to the target genomic locus, wherein the first modified ER-LBD and the second modified ER-LBD each comprise an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence, wherein the targeting construct is configured such that upon its recombination with the target genomic locus (the present disclosure provides an inducible cell death system comprising two or more polypeptide monomers, wherein each polypeptide monomer comprises one or more ligand binding domains and a cell death-inducing domain,... the one or more ligand binding domains of each of the two or more polypeptide monomers comprise a domain or functional fragment thereof selected from the group consisting of... a hormone-binding domain of estrogen receptor (ER) domain,... the cell death-inducing domain is derived from a protein selected from the group consisting of:.....

Claims

WHAT IS CLAIMED IS1. A targeting construct comprising:(a) a first homology arm corresponding to a 5' target sequence comprising a first region of homology to a target genomic locus;(b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising:(i) a modified estrogen receptor ligand binding domain (ER-LBD); and(ii) a caspase 9 domain or derivative or functional fragment thereof;(c) a second homology arm corresponding to a 3' target sequence comprising second region of homology to the target genomic locus, wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the modified ER-LBD comprises a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1:(i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution,(ii) an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution,(iii) an L354I substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, a M517A substitution, and a H524F substitution,(iv) an L354I substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution,(v) an L391V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L354I substitution, an L384M substitution, and an H524L substitution,(vi) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution,(vii) an N413D substitution, an S463P substitution, an L354I substitution, an L384M substitution, and an H524L substitution, or(viii) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution, wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element.

2. A targeting construct comprising:(a) a first homology arm corresponding to a 5' target sequence comprising a first region of homology to a target genomic locus;(b) a nucleotide insert comprising a nucleotide sequence encoding a fusion polypeptide comprising:(i) a first modified estrogen receptor ligand binding domain (ER- LBD);(ii) a first caspase 9 domain or derivative or functional fragment thereof;(iii) a second modified estrogen receptor ligand binding domain(ER-LBD); and(iv) a second caspase 9 domain or derivative or functional fragment thereof;(c) a second homology arm corresponding to a 3' target sequence comprising second region of homology to the target genomic locus, wherein the first modified ER-LBD and the second modified ER-LBD each comprise an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO: 1), and wherein the first modified ER-LBD and the second modified ER-LBD each independently comprise: a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1:(i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution,(ii) an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution,(iii) an L354I substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, a M517A substitution, and a H524F substitution,(iv) an L354I substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution,(v) an L391V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L354I substitution, an L384M substitution, and an H524L substitution,(vi) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution,(vii) an N413D substitution, an S463P substitution, an L354I substitution, anL384M substitution, and an H524L substitution, or(viii) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution, wherein the targeting construct is configured such that upon its recombination with the target genomic locus, the fusion polypeptide coding sequence is integrated into a STEL gene and becomes operably linked to the STEL gene regulatory element.

3. The targeting construct of claim 1 or 2, wherein the additional amino acid substitutions comprise:(a) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of (SEQ ID NO:2), optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:2, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:2, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:2;(b) an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:3, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:3; optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:3, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:3;(c) an L354I substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, a M517A substitution, and a H524F substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:4, optionally wherein the modified ER-LBD comprises an amino acid sequence having atleast 98% sequence identity to the amino acid sequence of SEQ ID NO:4, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:4, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:4;(d) an L354I substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution, and wherein the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:5, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:5, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:5, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:5;(e) an L391V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L354I substitution, an L384M substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:40, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:40, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:40, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:40;(f) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:41, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:41, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:41, optionally wherein the modified ER-LBDcomprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:41;(g) an N413D substitution, an S463P substitution, an L354I substitution, an L384M substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:42, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:42, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:42, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:42; or(h) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution, and the modified ER-LBD comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:43, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 98% sequence identity to the amino acid sequence of SEQ ID NO:43, optionally wherein the modified ER-LBD comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence of SEQ ID NO:43, optionally wherein the modified ER-LBD comprises or consists of an amino acid sequence having 100% sequence identity to the amino acid sequence of SEQ ID NO:43, optionally wherein the modified ERT2 peptide further comprises an N-terminal serine (S) residue, optionally wherein the modified ER-LBD comprises the V595A amino acid substitution, optionally wherein the targeting construct comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% identical to an amino acid sequence set forth in SEQ ID NO: 13, 15, 17, 19, 21, 23, 25, 27, 44, 46, 48, or 50, optionally wherein the targeting construct comprises an amino acid sequence set forth in SEQ ID NO: 13, 15, 17, 19, 21, 23, 25, 27, 44, 46, 48, or 50.

4. The targeting construct of any one of claims 1-3, wherein:(a) the caspase 9 domain or derivative or functional fragment thereof does not comprise a Caspase Activation and Recruitment Domain (CARD) domain sequence, optionally wherein the caspase 9 domain or derivative or functional fragment thereof comprises (SEQ ID NO:6);(b) the modified estrogen receptor ligand binding domain (ER-LBD) is N- terminal or C-terminal to the caspase 9 domain or derivative or functional fragment thereof, optionally wherein the fusion polypeptide comprises a linker between the modified estrogen receptor ligand binding domain (ER-LBD) and the caspase 9 domain or derivative or functional fragment thereof.(c) neither the first nor second caspase 9 domain or derivative or functional fragment thereof comprise a Caspase Activation and Recruitment Domain (CARD) domain sequence, optionally wherein the first caspase 9 domain or derivative or functional fragment thereof and / or the second caspase 9 domain or derivative or functional fragment thereof comprises (SEQ ID NO: 6); and / or(d) the first ER-LBD is N-terminal or C-terminal to the first caspase 9 domain or derivative or functional fragment thereof and / or the second ER-LBD is N-terminal or C-terminal to the second caspase 9 domain or derivative or functional fragment thereof, optionally wherein the fusion polypeptide comprises a linker between the modified estrogen receptor ligand binding domain (ER-LBD) and the caspase 9 domain or derivative or functional fragment thereof.

5. The targeting construct of any one of claims 1 to 4, which is configured such that upon its recombination with the target genomic locus, the STEL gene is modified such to incorporate the fusion polypeptide coding sequence 3' to the STEL protein coding sequence or 5' to the STEL protein coding sequence.

6. The targeting construct of any one of claims 1 to 5, wherein the nucleotide insert further comprises a nucleotide sequence encoding a separator sequence, optionally wherein thee targeting construct is configured such that upon recombination of the targeting construct with the target genomic locus, the separator sequence coding sequence is positioned between the coding sequence of the STEL protein and the fusion polypeptide coding sequence, optionally wherein the separator sequence is (a) an internal ribosome entry site (“IRES”) or (b) a selfcleaving peptide, optionally wherein the self-cleaving peptide is a 2A peptide, optionally wherein the self-cleaving peptide is T2A, P2A, E2A, F2A, PQR, Opt2A, or Opt2A_2.0.

7. The targeting construct of any one of claims 1 to 6, wherein the STEL gene encodes a polypeptide involved in one or more of: glycolysis, ribonucleopolypeptide complex formation, focal adhesion, cell-substrate adherens junction, cell-substrate junction, cell anchoring, extracellular exosome, extracellular vesicle, intracellular organelle, anchoring junction, RNA binding, nucleic acid binding (e.g., rRNA or mRNA binding), and polypeptide binding, optionally wherein the STEL gene encodes a ribosomal polypeptide, optionally wherein the STEL gene is RPL13A, RPLPO, RPL10, RPL13, RPSJ8, RPL3, RPLP1, RPL15, RPL41, RPL11, RPL32, RPL18 A, RPL19, RPL28, RPL29, RPL9, RPL8, RPL6, RPL18, RPL7, RPL7A, RPL21, RPL37A, RPL 12, RPL5, RPL34, RPL35A, RPL30, RPL24, RPL39, RPL37, RPL14, RPL27A, RPLP2, RPL23A, RPL26, RPL36, RPL35, RPL23, RPL4, or RPL22, optionally wherein the STEL gene encodes a ribosomal polypeptide small subunit (RPS), optionally wherein the STEL gene is RPS2, RPS 19, RPS 14, RPS3A, RPS 12, RPS3, RPS6, RPS23, RPS27A, RPS8, RPS4X, RPS7, RPS24, RPS27, RPS15A, RPS9, RPS28, RPS 13, RPSA, RPS5, RPS 16, RPS25, RPS15, RPS20, or RPS11, optionally wherein the STEL gene encodes a mitochondrial polypeptide, optionally wherein the STEL gene is MT-C01, MT-C02, MT-ND4, MT-ND1, or MT-ND2, optionally wherein the STEL gene encodes an actin polypeptide, optionally wherein the STEL gene is ACTG1 or ACTB, optionally wherein the STEL gene encodes a eukaryotic translation factor, optionally wherein the STEL gene is EEF1A1, EEF2, or EIFlm optionally wherein the STEL gene encodes a histone, optionally wherein the STEL gene is H3F3A or H3F3B, optionally wherein the STEL gene is FTL, FTH1, TPT1, IMSB10, GAPDH, PTMA, GNB2L1, NACA, YBX1, NPM1, FAU, UBA52, HSP90AB1, MYL6, SERF2, or SRP14, optionally wherein the STEL gene is GAPDH, optionally wherein the STEL gene is RPL 13 A, optionally wherein the STEL gene is RPL7, optionally wherein the STEL gene is RPLPO.

8. The targeting construct of any one of claims 1 to 7, wherein the nucleotide insert further comprises a transgene, optionally wherein the transgene is linked to the fusion polypeptide coding sequence, optionally wherein the transgene encodes a therapeutic polypeptide, optionally wherein the fusion polypeptide coding sequence and transgene are connected via a nucleotide sequence encoding a separator sequence, optionally wherein the separator sequence is an internal ribosome entry site (“IRES”), optionally wherein the separator sequence is a nucleotide sequence encoding a self-cleaving peptide (the “self-cleaving peptide coding sequence”), optionally wherin the self-cleaving peptide is a 2A peptide, optionally wherein the self-cleaving peptide is T2A, P2A, E2A, F2A, PQR, Opt2A, or Opt2A_2.0.

9. A system comprising:(a) the targeting construct of any one of claims 1 to 8;(b) a CRIS PR-associated endonuclease (“Cas polypeptide”) or a nucleic acid encoding a Cas polypeptide; and(c) a guide RNA (“gRNA”) comprising a scaffold for binding the Cas polypeptide and a spacer sequence corresponding to the STEL gene, or a nucleic acid encoding the gRNA, optionally wherein the guide RNA is a single guide RNA (“sgRNA”), optionally wherein the system comprises the Cas polypeptide and gRNA, optionally wherein the system is in the form of a ribonucleoprotein particle (“RNP”).

10. A method of producing a gene-edited target cell, comprising:(a) introducing the system of claim 9 into a target cell; and(b) culturing the target cell under conditions in which gene editing occurs, thereby producing gene-edited target cell, optionally wherein the gene-targeted cell is of ectoderm lineage, optionally wherein the gene-edited target cell is a neuron, optionally wherein the gene-targeted cell if of mesoderm lineage, optionally wherein the gene-edited target cell is a cardiomyocyte.

11. The method of claim 10, wherein the target cell is:(a) a stem cell or a cell differentiated from a stem cell, optionally wherein the target cell is a stem cell, optionally wherein the stem cell is a human embryonic stem cell,(b) an induced pluripotent stem cell (“iPSC”) or a cell differentiated therefrom, optionally wherein the target cell is (a) a regulatory T cell, a myeloid cell, a dendritic cell, a macrophage (e.g., an immunosuppressive macrophage), a myeloid progenitor cell, or a precursor or progenitor cell thereof;(c) a cell in the human nervous system, optionally selected from dopaminergic neuron, a microglial cell, an oligodendrocyte, an astrocyte, a cortical neuron, aspinal or oculomotor neuron, an enteric neuron, a Placode-derived cell, a Schwann cell, and a trigeminal or sensory neuron, or a precursor or progenitor cell thereof;(d) a cell in the human cardiovascular system, optionally selected from a cardiomyocyte, an endothelial cell, and a nodal cell, or a precursor or progenitor cell thereof;(e) a cell in the human metabolic system, optionally selected from a hepatocyte, a cholangiocyte, and a pancreatic beta cell, or a precursor or progenitor cell thereof, or(f) a cell in the human ocular system, optionally selected from a retinal pigment epithelial cell, a photoreceptor cone cell, a photoreceptor rod cell, a bipolar cell, a ganglion cell, or a precursor or progenitor cell thereof.

12. A gene-edited target cell obtained or obtainable by the method of claim 10 or 11.

13. A gene-edited target cell comprising a STEL gene that comprises a nucleic acid encoding a fusion polypeptide under the transcriptional control of a STEL gene regulatory element, the fusion polypeptide comprising:(a) a modified estrogen receptor ligand binding domain (ER-LBD); and(b) a caspase 9 domain or derivative or functional fragment thereof, wherein the modified ER-LBD comprises an amino acid sequence corresponding to a hormone binding domain of a reference human estrogen receptor sequence (SEQ ID NO:1), and wherein the modified ER-LBD comprises a G400V amino acid substitution, an M543A amino acid substitution, an L544A amino acid substitution, and optionally a V595A amino acid substitution, with reference to SEQ ID NO: 1; and additional amino acid substitutions, wherein the additional amino acid substitutions comprise, with reference to SEQ ID NO: 1:(i) an L384M substitution, an L391V substitution, a N413D substitution, an M421L substitution, a S463P substitution, and a H524L substitution,(ii) an L391V substitution, a N413D substitution, a Q414E substitution, a S463P substitution, and a H524F substitution,(iii) an L354I substitution, a L391V substitution, a N413D substitution, a Q414E substitution, a M421L substitution, a M517A substitution, and a H524F substitution,(iv) an L354I substitution, a L391V substitution, a L409V substitution, a N413D substitution, a Q414E substitution, and a H524L substitution,(v) an L391V substitution, a Q414E substitution, an N413D substitution, an S463P substitution, an M421L substitution, an L354I substitution, an L384M substitution, and an H524L substitution,(vi) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution,(vii) an N413D substitution, an S463P substitution, an L354I substitution, an L384M substitution, and an H524L substitution, or(viii) an L391V substitution, an N413D substitution, an S463P substitution, an M517A substitution, an M421L substitution, an L354I substitution, and an H524L substitution, optionally wherein the modified ER-LBD is as defined in any one of claims 1-3, optionally wherein the caspase 9 domain or derivative or functional fragment thereof is as defined in claim 4, optionally wherein the fusion polypeptide is as defined in claim 4, optionally wherein the STEL gene is configured as defined in claim 7, optionally wherein the gene-edited target cell of claim 12 further comprises a transgene in the STEL gene, optionally wherein the transgene is as defined in claim 8, optionally wherein the target cell is as defined in claim 10 or 11.

14. A pharmaceutical composition comprising the gene-edited target cell of claim 12 or 13 and a pharmaceutically acceptable carrier.

15. A method of treating a patient in need thereof, comprising administering to the patient the gene-edited target cell of claim 12 or 13 or a pharmaceutical composition comprising the gene-edited target cell of claim 12 or 13 and a pharmaceutically acceptable carrier, optionally wherein the method further comprises controlling the gene-edited target cell population in the patient by:(a) monitoring, optionally, the gene-edited target cell population in the patient; and / or(b) administering an inducer of the modified ER-LBD if the patient experiences adverse events related to the gene-edited target cell population.

16. A method of mitigating adverse events or a safety risk associated with cell therapy in the form of the gene-edited target cells of claim 12 or 13 or the pharmaceutical composition of claim 14, the method comprising administering to a patient who received the gene-edited target cells or pharmaceutical composition an inducer of a modified ER-LBD if the patient experiences adverse events or a safety risk related to the gene-edited target cells or pharmaceutical composition, optionally wherein the inducer of the modified ER-LBD is tamoxifen or a tamoxifen metabolite, optionally wherein the inducer of the modified ER-LBD is tamoxifen, optionally wherein the inducer of the modified ER-LBD is a tamoxifen metabolite, optionally wherein the inducer of the modified ER-LBD is 4-hydroxytamoxifen, N- desmethyltamoxifen, tamoxifen-N-oxide, or endoxifen, optionally wherein a combination of two or more inducers of the modified ER-LBD is administered, optionally wherein the combination comprises 4-OHT and endoxifen, optionally wherein the combination has a synergistic effect and / or utilizes reduced dosing (e.g., reduced dosing amount and / or frequency) than would be required a single inducer of the modified ER-LBD.