Tat-FXN fusion protein for use in the treatment of friedreich's ataxia

The TAT-FXN fusion protein addresses the lack of effective treatments for Friedreich's Ataxia by increasing frataxin levels, stabilizing clinical scores, and slowing disease progression.

WO2026136463A1PCT designated stage Publication Date: 2026-06-25LARIMAR THERAPEUTICS INC
View PDF 0 Cites 0 Cited by

Patent Information

Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
LARIMAR THERAPEUTICS INC
Filing Date
2025-12-16
Publication Date
2026-06-25

AI Technical Summary

Technical Problem

There is no FDA-approved treatment for Friedreich's Ataxia, a progressive multisystem disease caused by a deficiency of the mitochondrial protein frataxin, and existing therapies like antioxidants and iron chelation are not effective in preventing progressive loss of motor control and cardiomyopathy.

Method used

Administration of a TAT-FXN fusion protein at specific doses for a duration, which increases frataxin levels in subjects, thereby stabilizing or improving clinical scores related to Friedreich's Ataxia.

Benefits of technology

The TAT-FXN fusion protein stabilizes or decreases clinical scores such as the Modified Friedreich's Ataxia Rating Scale, Activities of Daily Living, and Fatigue Impact Scale, while increasing frataxin levels in tissues, potentially slowing disease progression.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure IMGF000072_0001
    Figure IMGF000072_0001
  • Figure IMGF000072_0002
    Figure IMGF000072_0002
  • Figure IMGF000074_0001
    Figure IMGF000074_0001
Patent Text Reader

Abstract

The present disclosure provides methods of treating Friedreich's Ataxia (FRDA) in a subject that comprise administering to the subject a TAT-FXN fusion protein once daily at a dose of about 25 mg or a dose of about 50 mg. The present disclosure also provides methods of treating Friedreich's Ataxia (FRDA) in a pediatric subject that comprise administering to the subject a TAT-FXN fusion protein once daily at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg. The present disclosure also provides methods of increasing the level of frataxin (FXN) in an FXN-decifient subject, e.g., pediatric subject.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] Atty. Docket No. 130197-01920

[0002] METHODS OF TREATING FRIEDREICH’S ATAXIA

[0003] RELATED APPLICATIONS

[0004] This application claims priority to U.S. Provisional Patent Application No. 63 / 734718, filed on December 16, 2024; U.S. Provisional Patent Application No. 63 / 734723, filed on December 16, 2024; U.S. Provisional Patent Application No. 63 / 799217, filed on May 2, 2025; and U.S. Provisional Patent Application No. 63 / 890214, filed on September 29, 2025. The entire contents of each of the foregoing applications are hereby incorporated herein by reference.

[0005] INTRODUCTION

[0006] Mitochondrial diseases are a group of disorders caused by dysfunctional mitochondria, the cellular organelles that store potential energy in the form of adenosine triphosphate (ATP) molecules and are found in every cell of the human body except mature red blood cells.

[0007] Friedreich’s Ataxia (FRDA) is the most common inherited ataxia in humans and results from a deficiency of the mitochondrial protein frataxin (FXN), and specifically human frataxin (hFXN). FRDA is a rare disease with an estimated incidence of 1:29,000, a carrier frequency of -1:85, and about 4,000-5,000 reported cases in the United States. FRDA is a progressive multisystem disease, typically beginning in mid-childhood. Subjects suffer from multiple symptoms, including progressive neurologic and cardiac dysfunction. Other clinical findings can include scoliosis, fatigue, diabetes, visual impairment, and hearing loss.

[0008] Inheritance is autosomal recessive and is predominantly caused by an inherited GAA triplet expansion in the first intron of both alleles of the hFXN gene. This triplet expansion causes transcriptional repression of the FRDA gene, which results in the production of very small amounts of hFXN in subjects. Subjects who are heterozygous for hFXN mutation typically have hFXN levels at -50% of normal but are phenotypically normal. Levels of hFXN of -45-70 pg / pl and -5-25 pg / pl in whole blood of heterozygotes and subjects afflicted with FRDA respectively have been shown to be stable over time. Most subjects with FRDA produce -20-40% of normal hFXN levels, depending on the tissue, sampling technique and assay considered (Deutsch et al., Molecular Genetics and Metabolism (2010), 101:238-245). Lower levels of hFXN are associated with earlier onset of disease, faster rate of disease

[0009] 1

[0010] MEI 53012850v.l Atty. Docket No. 130197-01920 progression and shorter time to loss of ambulation (Plasterer et al., PLoS ONE (2013), 8(5):e63958; Rummey et al., EClinicalMedicine (2020), 18:100213). According to published data, the levels of hFXN in heterozygoes and subjects with FRDA is, respectively, 50.2% and 20.9% of hFXN levels of healthy controls in buccal cells; 75.3% and 32.2% in whole blood; 68.7% and 35.8% in peripheral blood mononuclear cells (PMBCs) and 64% and 29% in lymphoblastoid cells.

[0011] Currently, there is no FDA-approved treatment for FRDA. Antioxidants and iron chelation have not been overly effective, and, despite treatment, subjects typically experience progressive loss of motor control and die, cardiomyopathy being the primary cause of death.

[0012] Protein replacement therapy is a well-established approach to metabolic diseases, such as diabetes, lysosomal storage disorders and hemophilia. Work in subject-derived cellular and animal models has demonstrated that replacement of functional FXN can correct or improve the FRDA disease phenotype. However, there is a need in the art for FXN replacement therapies to treat FRDA that are safe and efficacious in adult and pediatric subjects.

[0013] SUMMARY OF THE DISCLOSURE

[0014] Accordingly, the present disclosure provides methods of treating Friedreich’s Ataxia in a subject in need thereof, the method comprising administering to the subject a TAT-FXN fusion protein at a dose of about 25 mg or about 50 mg; wherein the dose is administered once daily for at least 90 days, or the method comprising administering to a pediatric subject a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg; wherein said dose is administered once daily for at least 7 days.

[0015] In some aspects, the present disclosure provides a method of treating Friedreich’s Ataxia in a subject in need thereof, the method comprising administering to the subject a TAT-FXN fusion protein at a dose of about 25 mg; wherein the dose is administered once daily for at least 90 days; wherein the TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that the administration of the TAT-FXN fusion protein results in one or more of the following:

[0016] 2

[0017] MEI 53012850v.l Atty. Docket No. 130197-01920

[0018] (i) no change or a decrease in a modified Friedreich’s Ataxia Rating Scale (mFARS) score, as compared to the mFARS score prior to the administration of the TAT- FXN fusion protein;

[0019] (ii) no change or a decrease in Friedreich’s Ataxia Rating Scale - Activities of Daily Living (FARS-ADL) score, as compared to the FARS-ADL score prior to the administration of the TAT-FXN fusion protein;

[0020] (iii) no change or a decrease in a 9-Hole Peg Test (9-HPT) score, as compared to the 9-HPT score prior to the administration of the TAT-FXN fusion protein;

[0021] (iv) no change or a decrease in a Timed 25-Foot Walk (T25-FW) test score, as compared to the T25-FW score prior to the administration of the TAT-FXN fusion protein;

[0022] (v) no change or a decrease in Patient Global Impression of Severity (PGLS) score, as compared to the PGLS score prior to the administration of the TAT-FXN fusion protein;

[0023] (vi) no change or a decrease in Patient Global Impression of Change (PGLC) score, as compared to the PGLC score prior to the administration of the TAT-FXN fusion protein;

[0024] (vii) no change or a decrease in Clinical Global Impression of Severity (CGLS) score, as compared to the CGLS score prior to the administration of the TAT-FXN fusion protein;

[0025] (viii) no change or a decrease in Clinical Global Impression of Change (CGLC) score, as compared to the CGLC score prior to the administration of the TAT-FXN fusion protein;

[0026] (ix) no change or a decrease in the Functional Staging for Ataxia score, as compared to the Functional Staging for Ataxia score prior to the administration of the TAT- FXN fusion protein;

[0027] (x) no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score, as compared to the MFIS score prior to the administration of the TAT-FXN fusion protein;

[0028] 3

[0029] MEI 53012850v.l Atty. Docket No. 130197-01920

[0030] (xi) no change or an increase in left ventricular ejection fraction, as compared to the left ventricular ejection fraction prior to the administration of the TAT-FXN fusion protein;

[0031] (xii) no change or a decrease in left ventricular end-diastolic volume, as compared to the left ventricular end-diastolic volume prior to the administration of the TAT-FXN fusion protein; and

[0032] (xiii) no change or a decrease in hemoglobin Ale (HbAlc) levels, as compared to the HbAlc levels prior to the administration of the TAT-FXN fusion protein.

[0033] In some embodiments, the administration of the TAT-FXN fusion protein results in no change or a decrease in the mFARS score. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the mFARS score of at least about 0.5 points, at least about 0.1 points, at least about 0.2 points, at least about 0.3 points, at least about 0.4 points, at least about 0.5 points, at least about 0.6 points, at least about 0.7 points, at least about 0.8 points, at least about 0.9 points, at least about 1 point, at least about 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about

[0034] 5.5 points or at least about 6 or more points.

[0035] In some embodiments, the administration of the TAT-FXN fusion protein results in no change or a decrease in the FARS-ADL score. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the FARS-ADL score of at least about 0.1 points, at least about 0.2 points, at least about 0.3 points, at least about 0.4 points, at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about

[0036] 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points or at least about 10 or more points.

[0037] In some embodiments, the administration of the TAT-FXN fusion protein results in no change or a decrease in the 9-HPT score. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the 9-HPT score of at least 1 second, at least 2 seconds, at least 5 seconds, at least 7 seconds, at least 9 seconds, at least 10 seconds, at least

[0038] 4

[0039] MEI 53012850v.l Atty. Docket No. 130197-01920

[0040] 15 seconds, at least 20 seconds, at least 25 seconds, at least 30 seconds, at least 35 seconds, at least 40 seconds, at least 45 seconds, at least 50 seconds, at least 55 seconds, at least 60 seconds, at least 65 seconds, at least 70 seconds, or at least 75 seconds.

[0041] In some embodiments, the administration of the TAT-FXN fusion protein results in no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the Modified Fatigue Impact Scale (MFIS) score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points, at least about 10 points, at least about 12 points, at least about 14 points, at least about 16 points, at least about 18 points, at least about 20 points, at least about 22 points, at least about 24 points, at least about 26 points, at least about 28 points or at least about 30 points.

[0042] In some embodiments, the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0043] In some embodiments, the solid tissue sample is a skin biopsy. In some embodiments, the solid tissue sample is a buccal tissue.

[0044] In some embodiments, the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 70% of the level of FXN protein in a healthy subject.

[0045] In some embodiments, the level of FXN protein in a buccal sample following administration of the TAT-FXN fusion protein is about 1.4 to about 3.7 pg / ptg of total protein.

[0046] In some embodiments, the level of FXN protein in a buccal tissue sample following administration of the TAT-FXN fusion protein is increased by about 0.5 to about 2.6 pg / ptg of

[0047] 5

[0048] MEI 53012850v.l Atty. Docket No. 130197-01920 total protein, as compared to the level of FXN protein prior to administration of the TAT- FXN fusion protein.

[0049] In some embodiments, the level of FXN protein in a buccal tissue sample following administration of the TAT-FXN fusion protein is increased to at least about 30% of the level of FXN protein in a healthy subject following administration of the TAT-FXN fusion protein.

[0050] In some embodiments, the level of FXN protein in a skin biopsy sample following administration of the TAT-FXN fusion protein is about 7.0 to about 10.5 pg / ptg of total protein.

[0051] In some embodiments, the level of FXN protein in a skin biopsy sample following administration of the TAT-FXN fusion protein is increased by about 4.2 to about 9.0 pg / ptg of total protein, as compared to the level of FXN protein prior to administration of the TAT- FXN fusion protein.

[0052] In some embodiments, the level of FXN protein in a skin biopsy sample following administration of the TAT-FXN fusion protein is increased to at least about 70% of the level of FXN protein in a healthy subject following administration of the TAT-FXN fusion protein.

[0053] In some embodiments, the TAT-FXN fusion protein is administered for at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least 13 months, at least 14 months, at least 15 months, at least 16 months, at least 17 months, at least 18 months, at least 19 months or at least 20 or more months.

[0054] In some aspects, the present disclosure also provides a method of treating Friedreich’s Ataxia in a subject in need thereof, the method comprising administering to the subject a TAT-FXN fusion protein at a dose of about 50 mg; wherein the dose is administered once daily for at least 90 days; wherein the TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that the administration of the TAT-FXN fusion protein results in one or more of the following:

[0055] (i) no change or a decrease in a modified Friedreich’s Ataxia Rating Scale (mFARS) score, as compared to the mFARS score prior to the administration of the TAT- FXN fusion protein;

[0056] 6

[0057] MEI 53012850v.l Atty. Docket No. 130197-01920

[0058] (ii) no change or a decrease in Friedreich’s Ataxia Rating Scale - Activities of Daily Living (FARS-ADL) score, as compared to the FARS-ADL score prior to the administration of the TAT-FXN fusion protein;

[0059] (iii) no change or a decrease in a 9-Hole Peg Test (9-HPT) score, as compared to the 9-HPT score prior to the administration of the TAT-FXN fusion protein;

[0060] (iv) no change or a decrease in a Timed 25-Foot Walk (T25-FW) test score, as compared to the T25-FW score prior to the administration of the TAT-FXN fusion protein;

[0061] (v) no change or a decrease in Patient Global Impression of Severity (PGLS) score, as compared to the PGLS score prior to the administration of the TAT-FXN fusion protein;

[0062] (vi) no change or a decrease in Patient Global Impression of Change (PGLC) score, as compared to the PGLC score prior to the administration of the TAT-FXN fusion protein;

[0063] (vii) no change or a decrease in Clinical Global Impression of Severity (CGLS) score, as compared to the CGLS score prior to the administration of the TAT-FXN fusion protein;

[0064] (viii) no change or a decrease in Clinical Global Impression of Change (CGLC) score, as compared to the CGLC score prior to the administration of the TAT-FXN fusion protein;

[0065] (ix) no change or a decrease in the Functional Staging for Ataxia score, as compared to the Functional Staging for Ataxia score prior to the administration of the TAT- FXN fusion protein;

[0066] (x) no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score, as compared to the MFIS score prior to the administration of the TAT-FXN fusion protein;

[0067] (xi) no change or an increase in left ventricular ejection fraction, as compared to the left ventricular ejection fraction prior to the administration of the TAT-FXN fusion protein;

[0068] 7

[0069] MEI 53012850v.l Atty. Docket No. 130197-01920

[0070] (xii) no change or a decrease in left ventricular end-diastolic volume, as compared to the left ventricular end-diastolic volume prior to the administration of the TAT-FXN fusion protein; and

[0071] (xiii) no change or a decrease in hemoglobin Ale (HbAlc) levels, as compared to the HbAlc levels prior to the administration of the TAT-FXN fusion protein.

[0072] In some embodiments, the administration of the TAT-FXN fusion protein results in no change or a decrease in the mFARS score. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the mFARS score of at least about 0.1 points, at least about 0.2 points, at least about 0.3 points, at least about 0.4 points, at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points or at least about 6 or more points. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the mFARS score of about 0.3 points to about 4 points.

[0073] In some embodiments, the administration of the TAT-FXN fusion protein results in no change or a decrease in the FARS-ADL score. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the FARS-ADL score of at least about 0.1 points, at least about 0.2 points, at least about 0.3 points, at least about 0.4 points, at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points or at least about 10 or more points. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the FARS-ADL score of about 0.1 points to about 1 point.

[0074] In some embodiments, the administration of the TAT-FXN fusion protein results in no change or a decrease in the 9-HPT score. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the 9-HPT score of at least 1 second, at least 2 seconds, at least 5 seconds, at least 7 seconds, at least 9 seconds, at least 10 seconds, at least 15 seconds, at least 20 seconds, at least 25 seconds, at least 30 seconds, at least 35 seconds, at least 40 seconds, at least 45 seconds, at least 50 seconds, at least 55 seconds, at least 60

[0075] 8

[0076] MEI 53012850v.l Atty. Docket No. 130197-01920 seconds, at least 65 seconds, at least 70 seconds, or at least 75 seconds. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the 9-HPT score of about 2 seconds to about 40 seconds.

[0077] In some embodiments, the administration of the TAT-FXN fusion protein results in no change or a decrease in the T-25-FW score. In some embodiments, the administration of the TAT-FXN fusion protein results in no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score. In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the Modified Fatigue Impact Scale (MFIS) score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points, at least about 10 points, at least about 12 points, at least about 14 points, at least about 16 points, at least about 18 points, at least about 20 points, at least about 22 points, at least about 24 points, at least about 26 points, at least about 28 points or at least about 30 points.

[0078] In some embodiments, the administration of the TAT-FXN fusion protein results in a decrease in the Modified Fatigue Impact Scale (MFIS) score of about 0.5 points to about 20 points.

[0079] In some embodiments, the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0080] In some embodiments, the solid tissue sample is a skin biopsy. In some embodiments, the solid tissue sample is a buccal tissue.

[0081] In some embodiments, the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased by at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 250%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at

[0082] 9

[0083] MEI 53012850v.l Atty. Docket No. 130197-01920 least about 1000%, at least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%.

[0084] In some embodiments, the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 75% of the level of FXN protein in a healthy subject.

[0085] In some embodiments, the level of FXN protein in a skin sample obtained from said subject is about 5 pg / ptg of total protein to about 30 pg / ptg of total protein.

[0086] In some embodiments, the TAT-FXN fusion protein is administered for at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least 13 months, at least 14 months, at least 15 months, at least 16 months, at least 17 months, at least 18 months, at least 19 months or at least 20 or more months.

[0087] In some embodiments, the subject is a human.subject. In some embodiments, the subject is at least 18 years of age or older.

[0088] In some aspects, the present disclosure provides a method of increasing level of frataxin (FXN) protein in an FXN deficient pediatric subject, said method comprising administering to said subject a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg; wherein said dose is administered once daily for at least 7 days; and wherein said TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0089] In some embodiments, the solid tissue sample is a buccal tissue sample or a skin biopsy sample. In some embodiments, the solid tissue sample is a buccal tissue sample.

[0090] In some embodiments, the TAT-FXN fusion protein is administered to said pediatric subject for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, or at least 12 weeks. In some

[0091] 10

[0092] MEI 53012850v.l Atty. Docket No. 130197-01920 embodiments, the TAT-FXN fusion protein is administered to said subject for more than 10 weeks.

[0093] In some embodiments, the level of FXN protein in a solid tissue sample obtained from said pediatric subject following administration of the TAT-FXN fusion protein is increased by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 250%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at least about 1000%, at least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%.

[0094] In some embodiments, the level of FXN protein in a solid tissue sample obtained from said pediatric subject following administration of the TAT-FXN fusion protein is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 70% of the level of FXN protein in a healthy subject.

[0095] In some aspects, the present disclosure provides a method of treating Friedreich’s Ataxia in a pediatric subject in need thereof, said method comprising administering to said subject a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg; wherein said dose is administered once daily for at least 7 days; and wherein said TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5, such that the Friedreich’s Ataxia in the pediatric subject is treated.

[0096] In some embodiments, the level of FXN protein in a solid tissue sample obtained from said pediatric subject following administration of the TAT-FXN fusion protein is increased as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0097] In some embodiments, the solid tissue sample is a buccal tissue sample or a skin biopsy sample. In some embodiments, the solid tissue sample is a buccal tissue sample.

[0098] In some embodiments, the TAT-FXN fusion protein is administered to said pediatric subject for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, or at least 12 weeks. In some

[0099] 11

[0100] MEI 53012850v.l Atty. Docket No. 130197-01920 embodiments, the TAT-FXN fusion protein is administered to said subject for more than 10 weeks.

[0101] In some embodiments, the level of TAT-FXN protein in a solid tissue sample obtained from said pediatric subject following administration of the TAT-FXN fusion protein is increased by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 250%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at least about 1000%, at least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%.

[0102] In some embodiments, the level of FXN protein in a solid tissue sample obtained from said pediatric subject following administration of the TAT-FXN fusion protein is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 70% of the level of FXN protein in a healthy subject.

[0103] In some embodiments, the administration of the TAT-FXN fusion protein to said pedeiatric subject results in one or more of the following:

[0104] (i) no change or a decrease in a modified Friedreich’s Ataxia Rating Scale (mFARS) score, as compared to the mFARS score prior to the administration of the TAT- FXN fusion protein;

[0105] (ii) no change or a decrease in Friedreich’s Ataxia Rating Scale - Activities of Daily Living (FARS-ADL) score, as compared to the FARS-ADL score prior to the administration of the TAT-FXN fusion protein;

[0106] (iii) no change or a decrease in a 9-Hole Peg Test (9-HPT) score, as compared to the 9-HPT score prior to the administration of the TAT-FXN fusion protein;

[0107] (iv) no change or a decrease in a Timed 25-Foot Walk (T25-FW) test score, as compared to the T25-FW score prior to the administration of the TAT-FXN fusion protein;

[0108] (v) no change or a decrease in Patient Global Impression of Severity (PGLS) score, as compared to the PGLS score prior to the administration of the TAT-FXN fusion protein;

[0109] 12

[0110] MEI 53012850v.l Atty. Docket No. 130197-01920

[0111] (vi) no change or a decrease in Patient Global Impression of Change (PGI-C) score, as compared to the PGI-C score prior to the administration of the TAT-FXN fusion protein;

[0112] (vii) no change or a decrease in Clinical Global Impression of Severity (CGI-S) score, as compared to the CGI-S score prior to the administration of the TAT-FXN fusion protein;

[0113] (viii) no change or a decrease in Clinical Global Impression of Change (CGI-C) score, as compared to the CGI-C score prior to the administration of the TAT-FXN fusion protein;

[0114] (ix) no change or a decrease in the Functional Staging for Ataxia score, as compared to the Functional Staging for Ataxia score prior to the administration of the TAT- FXN fusion protein;

[0115] (x) no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score, as compared to the MFIS score prior to the administration of the TAT-FXN fusion protein;

[0116] (xi) no change or an increase in left ventricular ejection fraction, as compared to the left ventricular ejection fraction prior to the administration of the TAT-FXN fusion protein;

[0117] (xii) no change or a decrease in left ventricular end-diastolic volume, as compared to the left ventricular end-diastolic volume prior to the administration of the TAT-FXN fusion protein; and

[0118] (xiii) no change or a decrease in hemoglobin Ale (HbAlc) levels, as compared to the HbAlc levels prior to the administration of the TAT-FXN fusion protein.

[0119] BRIEF DESCRIPTION OF THE DRAWINGS

[0120] Figure 1 is a schematic showing administration schedule 25 mg and 50 mg doses of the TAT-FXN fusion protein or placebo to subjects with FRDA in the dose exploration study.

[0121] 13

[0122] MEI 53012850v.l Atty. Docket No. 130197-01920

[0123] Figure 2 is a graph showing dose-dependent increase from baseline in FXN levels in skin cells of subjects with FRDA that were administered 25 mg or 50 mg of the TAT-FXN fusion protein or placebo at day 14 and day 28. The dots represent median and the horizontal lines represent 25thand 75thpercentiles.

[0124] Figure 3 is a waterfall plot showing the individual changes in FXN levels from baseline in skin cells of subjects with FRDA who were administered 25 mg or 50 mg of the TAT-FXN fusion protein or placebo at day 14.

[0125] Figure 4 is a graph showing dose-dependent increase from baseline in FXN levels in buccal cells of subjects with FRDA who were administered 25 mg or 50 mg of the TAT-FXN fusion protein or placebo at day 14 and day 28. The dots represent median and the horizontal lines represent 25thand 75thpercentiles.

[0126] Figure 5 is a waterfall plot showing the individual changes in FXN levels from baseline in buccal cells of subjects with FRDA that were administered 25 mg or 50 mg of the TAT-FXN fusion protein or placebo at day 14.

[0127] Figure 6 is a schematic showing the number of subjects who had a shift in their FXN levels in skin cells as a percentage of healthy volunteers after 14 days of treatment with the TAT-FXN fusion protein.

[0128] Figure 7 is a schematic showing the number of subjects who had a shift in their FXN levels in buccal cells as a percentage of healthy volunteers after 14 days of treatment with the TAT-FXN fusion protein.

[0129] Figure 8 is a schematic showing administration schedules of 25 mg, 50 mg and 100 mg doses of TAT-FXN fusion protein or placebo to subjects with FRDA in the multiple ascending dose study.

[0130] Figure 9 is a diagram showing the PK / PD model developed in the study described in Example 2. Model parameters were Kin (zero order rate constant for FXN) 0.0241 1 / h; EBASE (estimated baseline) 3.28 pg / pgprot; F4 (proportionality constant for FXN input from central compartment) 0.0194 103 pg / pg / pgprot.

[0131] Figure 10 is a plot showing mean and (SD) PK parameters for doses of 25 mg, 50 mg and 100 mg for the last day of daily dose for the multiple ascending dose study.

[0132] 14

[0133] MEI 53012850v.l Atty. Docket No. 130197-01920

[0134] Figure 11 is a plot showing mean and SD PK parameters with doses of 25 mg and 50 mg for the last day of daily dose for the dose exploration study.

[0135] Figure 12 is a plot showing skin frataxin to protein ratio over time predicted from PK / PD simulations for a dose of 100 mg, 75 mg, 50 mg and 25 mg of the TAT-FXN fusion protein. Dashed red line represents 50% of the average skin frataxin / protein ratio (8.17 pg / pg) in a non-interventional study in healthy controls. Blue line represents the median of simulated values across trials, and the red lines are the 10th and 90th percentiles. Shaded regions represent the 95% confidence intervals of the corresponding percentiles (10th, 50th, and 90th).

[0136] Figure 13 is a plot showing model-predicted maximum skin FXN concentration at steady state stratified by baseline FXN level. The black dashed lines represent 50% (8.17 pg / mcg) and 100% (16.35 pg / mcg) of the mean skin FXN concentrations in healthy controls. The densities correspond to the 10th percentile (yellow), medians (green), and 90th percentile (red) of the simulated maximum skin FXN to protein ratio at steady state.

[0137] Figure 14 is a plot showing model-predicted maximum skin FXN concentration at steady state stratified by age of onset. The black dashed lines represent 50% (8.17 pg / mcg) and 100% (16.35 pg / mcg) of the mean skin FXN concentrations in healthy controls. The densities correspond to the 10th percentile (yellow), medians (green), and 90th percentile (red) of the simulated maximum skin FXN to protein ratio at steady state.

[0138] Figure 15 is a graph showing the relationship between age at onset and GAA repeat length in adults with FRDA participating in interventional clinical studies with the TAT-FXN fusion protein.

[0139] Figure 16 is a graph showing the relationship between buccal cell and skin cell frataxin concentrations in adults with FRDA participating in interventional clinical studies with the TAT-FXN fusion protein.

[0140] Figure 17 is a graph showing the relationship between buccal cell frataxin concentration and age at symptom onset in adults with FRDA participating in interventional clinical studies with TAT-FXN fusion protein.

[0141] 15

[0142] MEI 53012850v.l Atty. Docket No. 130197-01920

[0143] Figure 18 is a graph showing the relationship between buccal cell frataxin concentration and shorter triplet GAA (guanine adenine adenine) repeat lengths in adults with FRDA participating in interventional clinical studies with the TAT-FXN fusion protein.

[0144] Figure 19 is a graph showing the relationship between buccal cell frataxin concentration and total modified Freidriech’s ataxia rating scale (mFARS) score in adults with FRDA participating in interventional clinical studies with the TAT-FXN fusion protein.

[0145] Figure 20 is a graph showing frataxin levels (pg / .g of total protein) in skin cells measured at baseline, at Day 30 and Day 90 following daily administration of 25 mg of CTI- 1601. The dotted line indicates frataxin levels that are 50% of the frataxin levels in healthy volunteers.

[0146] Figure 21 is a graph showing change from baseline in frataxin levels (pg / .g of total protein) in skin cells measured at Day 30 and Day 90 following daily administration of 25 mg of CTI-1601.

[0147] Figure 22 is a graph showing frataxin levels (pg / .g of total protein) in buccal cells measured at baseline, at Day 30, Day 60 and Day 90 following daily administration of 25 mg of CTI-1601. The dotted line indicates frataxin levels that are 50% of the frataxin levels in healthy volunteers.

[0148] Figure 23 is a graph showing change from baseline in frataxin levels (pg / .g of total protein) in buccal cells measured at Day 30, Day 60 and Day 90 following daily administration of 25 mg of CTI-1601.

[0149] Figure 24 shows increase in frataxin levels in buccal cells as a percentage of average frataxin levels in healthy volunteers at baseline, Day 30, Day 60 and Day 90 following daily administration of 25 mg of CTI-1601.

[0150] Figure 25 shows increase in frataxin levels in skin cells as a percentage of average frataxin levels in healthy volunteers at baseline, Day 30 and Day 90 following daily administration of 25 mg of CTI-1601.

[0151] Figure 26 is a schematic showing the number of subjects who had a shift in their frataxin levels in buccal cells as a percentage of frataxin levels of healthy volunteers following 30 days, 60 days or 90 days of daily dosing with the TAT-FXN fusion protein.

[0152] 16

[0153] MEI 53012850v.l Atty. Docket No. 130197-01920

[0154] Figure 27 is a schematic showing the number of subjects who had a shift in their frataxin levels in skin cells as a percentage of frataxin levels of healthy volunteers following 30 days, or 90 days of daily dosing with the TAT-FXN fusion protein.

[0155] Figure 28 is a series of graphs demonstrating skin FXN levels in subjects being administered CTI-1601 in the open label extension (OLE) study described in Example 5.

[0156] Figure 29 is a schematic showing the number of subject who had a shift in their frataxin levels in skin cells as a percentable of frataxin levels of healthy volunteers in the OLE study described in Example 5.

[0157] Figure 30 is a study schema for a Phase 1 Study to Assess the Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of Subcutaneous CTI-1601 in Adolescents and Children with Friedreich’s Ataxia described in Example 6.

[0158] DETAILED DESCRIPTION OF THE DISCLOSURE

[0159] The present disclosure provides a method of treating Friedreich’s Ataxia (FRDA) in a subject in need thereof, e.g., a pediatric subject or an adult subject.

[0160] In some aspects, the present disclosure provides a method of treating Friedreich’s Ataxia (FRDA) in a subject in need thereof, said method comprising administering to the subject a TAT-FXN fusion protein at a dose of about 25 mg; wherein the dose is administered once daily for at least 90 days; wherein the TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that the administration of the TAT-FXN fusion protein results in no change or an improvement in at least one clinical parameter useful for assessing FRDA in a subject. In some embodiment, the at least one clinical parameter is selected from the group consisting of a modified Friedreich’s Ataxia Rating Scale (mFARS) score; a Friedreich’s Ataxia Rating Scale - Activities of Daily Living (FARS-ADL) score; a 9-Hole Peg Test (9-HPT) score; a Timed 25-Foot Walk (T25-FW) test score; a Patient Global Impression of Severity (PGLS) score; a Patient Global Impression of Change (PGLC) score; a Clinical Global Impression of Severity (CGLS) score; a Clinical Global Impression of Change (CGLC) score; a Functional Staging for Ataxia score; a Modified Fatigue Impact

[0161] 17

[0162] MEI 53012850v.l Atty. Docket No. 130197-01920

[0163] Scale (MFIS) score; left ventricular ejection fraction; left ventricular end-diastolic volume; and hemoglobin Ale (HbAlc) levels.

[0164] In some aspects, the present disclosure provides a method of treating Friedreich’s Ataxia (FRDA) in a subject in need thereof, said method comprising administering to the subject a TAT-FXN fusion protein at a dose of about 50 mg; wherein the dose is administered once daily for at least 90 days; wherein the TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that the administration of the TAT-FXN fusion protein results in no change or an improvement in at least one clinical parameter useful for assessing FRDA in a subject. In some embodiment, the at least one clinical parameter is selected from the group consisting of a modified Friedreich’s Ataxia Rating Scale (mFARS) score; a Friedreich’s Ataxia Rating Scale - Activities of Daily Living (FARS-ADL) score; a 9-Hole Peg Test (9-HPT) score; a Timed 25-Foot Walk (T25-FW) test score; a Patient Global Impression of Severity (PGLS) score; a Patient Global Impression of Change (PGLC) score; a Clinical Global Impression of Severity (CGLS) score; a Clinical Global Impression of Change (CGLC) score; a Functional Staging for Ataxia score; a Modified Fatigue Impact Scale (MFIS) score; left ventricular ejection fraction; left ventricular end-diastolic volume; and hemoglobin Ale (HbAlc) levels.

[0165] In some aspects, the present disclosure provides a method of increasing level of frataxin (FXN) protein in an FXN deficient pediatric subject, the method comprising administering to the subject a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg; wherein the dose is administered once daily for at least 7 days; and wherein the TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that the level of FXN protein in a solid tissue sample obtained from the subject following administration of the TAT-FXN fusion protein is increased, as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0166] The present disclosure also provides a method of treating Friedreich’s Ataxia (FRDA) in a pediatric subject in need thereof, the method comprising administering to the subject a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg; wherein the dose is administered once daily for at least 7 days; and wherein the TAT- FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that the FRDA in the pediatric subject is treated. In some embodiments, the level of FXN protein

[0167] 18

[0168] MEI 53012850v.l Atty. Docket No. 130197-01920 in a solid tissue sample obtained from the pediatric subject following administration of the TAT-FXN fusion protein is increased, as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0169] In some embodiments, the solid tissue sample is obtained from the subject at least 1 day following the start of the administration of the TAT-FXN fusion protein. In some embodiments, the solid tissue sample is obtained from the subject at least 1 day, at least 2 days, at least 3 days, at least 4 days, at least 5 days, at least 6 days or at least 7 days following the start of administration of the FXN fusion protein. In some embodiments, the solid tissue sample is obtained at more than one time point following the start of administration of the TAT-FXN fusion protein. In some embodiments, the level of FXN in the tissue sample is determined at more than one time point following the start of administration of the TAT-FXN fusion protein in order to monitor the treatment of the subject with the TAT-FXN fusion protein.

[0170] In some embodiments, the methods further comprise the step of obtaining the solid tissue sample or samples from the subject. In some embodiments, the methods further comprise the step of measuring or determining the concentration of FXN in the solid tissue sample or samples obtained from the subject. In some embodiments, the methods further comprise the step of receiving information on the concentration of FXN in the solid tissue sample or samples obtained from the subject.

[0171] In some embodiments, the methods further comprise making a decision on whether to maintain or to modify a dose amount or dosing frequency based on the concentration of FXN in the solid tissue sample or samples. In some embodiments, the methods further comprise making a recommendation on whether to maintain or to modify a dose amount or dosing frequency based on the concentration of FXN in the solid tissue sample or samples.

[0172] In some embodiments, the subject, e.g., adult subject, is administered the TAT-FXN fusion protein once daily at a dose of about 25 mg for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 11 weeks, at least 12 weeks, at least 13 weeks, at least 14 weeks, at least 15 weeks, at least 16 weeks, at least 17 weeks, at least 18 weeks, at least 19 weeks, at least 20 weeks, at least 25 weeks, at least 30 weeks, at least 35 weeks, at least 40 weeks, at least 45 weeks, at least 50 weeks or at least 60 or more weeks.

[0173] 19

[0174] MEI 53012850v.l Atty. Docket No. 130197-01920

[0175] In some embodiments, the subject, e.g., adult subject, is administered the TAT-FXN fusion protein once daily at a dose of about 50 mg for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 11 weeks, at least 12 weeks, at least 13 weeks, at least 14 weeks, at least 15 weeks, at least 16 weeks, at least 17 weeks, at least 18 weeks, at least 19 weeks, at least 20 weeks, at least 25 weeks, at least 30 weeks, at least 35 weeks, at least 40 weeks, at least 45 weeks, at least 50 weeks or at least 60 or more weeks.

[0176] In some embodiments, the methods of the disclosure comprise administering the TAT-FXN fusion protein to a pediatric subject once daily at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 11 weeks, at least 12 weeks, at least 13 weeks, at least 14 weeks, at least 15 weeks, at least 16 weeks, at least 17 weeks, at least 18 weeks, at least 19 weeks, at least 20 weeks, at least 25 weeks, at least 30 weeks, at least 35 weeks, at least 40 weeks, at least 45 weeks, at least 50 weeks or at least 60 or more weeks.

[0177] In some embodiments, the pediatric subject is administered the TAT-FXN fusion protein once daily for at least 30 days, at least 60 days or at least 90 days.

[0178] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a pediatric subject who is administered the TAT-FXN fusion protein once daily at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg, is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the pediatric subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at least about 1000%, at least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0179] 20

[0180] MEI 53012850v.l Atty. Docket No. 130197-01920

[0181] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a pediatric subject who is administered the TAT-FXN fusion protein once daily at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg, is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the pediatric subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 1.1-fold, at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 60-fold, at least about 70-fold, at least about 80-fold, at least about 90-fold, at least about 100-fold, at least about 500-fold or at least about 1000-fold. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0182] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a pediatric subject who is administered the TAT-FXN fusion protein once daily at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg, is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the pediatric subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 1 pg / pg of total protein, at least about 2 pg / pg of total protein, at least about 3 pg / pg of total protein, at least about 4 pg / pg of total protein, at least about 5 pg / pg of total protein, at least about 6 pg / pg of total protein, at least about 7 pg / pg of total protein, at least about 8 pg / pg of total protein, or at least about 9 pg / pg of total protein. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0183] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a pediatric subject who is administered the TAT-FXN fusion protein once daily at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg, is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 70% of the level of FXN in the solid tissue sample of a healthy subject. The term “level of FXN protein in a healthy subject” or “level of FXN protein in the solid tissue sample of a healthy subject”, as used herein, refers to the level of FXN protein in a solid tissue sample (e.g., buccal or skin

[0184] 21

[0185] MEI 53012850v.l Atty. Docket No. 130197-01920 sample) from one or more healthy subjects, e.g., an average (e.g., a mean or median) of FXN levels in a solid tissue sample e.g., buccal or skin sample) from multiple (e.g., 2, 3, 4, 5, 10, 15, 20 or more) healthy subjects. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the level of FXN protein in a healthy subject is about 10 pg / ptg of total protein to about 20 pg / ptg of total protein, or about 14 pg / ptg of total protein to about 18 pg / ptg of total protein, or about 15 pg / ptg of total protein to about 17 pg / ptg of total protein, e.g., about 16.34 pg / ptg of total protein in a skin biopsy sample. In some embodiments, the solid tissue sample is a buccal sample. In some embodiments, the level of FXN protein in a healthy subject is about 5 pg / ptg of total protein to about 12 pg / ptg of total protein, about 6 pg / ptg of total protein to about 10 pg / ptg of total protein, or about 7 pg / ptg of total protein to about 9 pg / ptg of total protein, e.g., about 8.24 pg / ptg of total protein, in a buccal sample.

[0186] In some embodiments, the increase in the level of hFXN in the solid tissue sample obtained from the subject, e.g., a skin sample or a buccal sample, is sufficient to have a therapeutic effect, i.e., sufficient to treat FRDA in the pediatric subject.

[0187] In some embodiments, the pediatric subject is administered the TAT-FXN fusion protein once daily at a dose of about 50 mg for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 11 weeks, at least 12 weeks, at least 13 weeks, at least 14 weeks, at least 15 weeks, at least 16 weeks, at least 17 weeks, at least 18 weeks, at least 19 weeks, at least 20 weeks, at least 25 weeks, at least 30 weeks, at least 35 weeks, at least 40 weeks, at least 45 weeks, at least 50 weeks or at least 60 or more weeks.

[0188] In some embodiments, the level of FXN protein in a solid tissue sample obtained from the subject following administration of the TAT-FXN fusion protein is increased as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0189] In some embodiments, the increase in the level of hFXN in the solid tissue sample obtained from the subject, e.g., a skin sample or a buccal sample, is sufficient to have a therapeutic effect, i.e., sufficient to treat FRDA in the subject.

[0190] The term “FXN protein”, as used herein, encompasses both the full-length human frataxin protein (hFXN) and mature hFXN. The full-length hFXN contains 210 amino acids,

[0191] 22

[0192] MEI 53012850v.l Atty. Docket No. 130197-01920 and includes an 80 amino acid mitochondrial targeting sequence (MTS) at the N-terminus.

[0193] The full-length hFXN protein (amino acids 1-210) has the amino acid sequence of SEQ ID NO: 1.

[0194] The full-length hFXN (SEQ ID NO: 1) comprises mature hFXN (SEQ ID NO: 2) and a mitochondrial targeting sequence (MTS) having the amino acid sequence MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASS NQRGLNQIWNVKKQSVYLMNLRK (SEQ ID NO: 3).

[0195] The TAT-FXN fusion protein of the present disclosure includes hFXN and also the HIV-TAT peptide YGRKKRRQRRR (SEQ ID NO: 4) linked via a linker to the N-terminus of the full-length hFXN protein. The mechanism of action of the fusion protein relies on the cell-penetrating ability of the HIV-TAT peptide to deliver the fusion protein into cells and the subsequent processing into mature hFXN after translocation into the mitochondria. The TAT-FXN fusion protein of the present disclosure, which may also be referred to herein as “CTI-1601” or “nomlabofusp” has the following amino acid sequence (224 amino acids): MYGRKKRRQRRRGGMWTEGRRAVAGEEASPSPAQAQTETRVPRPAEEAPECGRRG ERTDIDATCTPRRASSNQRGENQIWNVKKQSVYEMNERKSGTEGHPGSEDETTYERE AEETEDSEAEFFEDEADKPYTFEDYDVSFGSGVETVKEGGDEGTYVINKQTPNKQIW ESSPSSGPKRYDWTGKNWVYSHDGVSEHEEEAAEETKAEKTKEDESSEAYSGKDA (SEQ ID NO: 5).

[0196] 23

[0197] MEI 53012850v.l Atty. Docket No. 130197-01920

[0198] In some embodiments, the TAT-FXN fusion protein of the present disclosure comprises an amino acid sequence having at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 5.

[0199] In some embodiments, the TAT-FXN fusion protein of the present disclosure consists of an amino acid sequence having at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 5.

[0200] The term “pediatric subject” refers to a human subject who is 18 years old or younger. In some embodiments, the subject is from 2 to 12 years of age. In some embodiments, the subject is from 12 to 18 years of age. In some embodiments, the pediatric subject is younger than 18 years old. In some embodiments, the pediatric subject is at least 2 years old and younger than 18 years old, i.e., between 2 and 17 years old. In some embodiments, the subject is an FXN-deficient subject.

[0201] In some embodiments, the subject is a human subject who is at least 18 years old. In some embodiments, the subject is an adult subject, e.g., who is 18 years old or older. .

[0202] In some embodiments, the TAT-FXN fusion protein is administered subcutaneously.

[0203] In some embodiments, the TAT-FXN fusion protein is administered as a part of a pharmaceutical composition comprising the TAT-FXN fusion protein, a pharmaceutically acceptable excipient and a pharmaceutically acceptable carrier. An exemplary pharmaceutical composition comprising the TAT-FXN fusion protein is described, e.g., in WO 2022 / 126029, the entire contents of which are hereby incorporated herein by reference.

[0204] In some embodiments, the levels of FXN protein are measured using mass spectrometry. In some embodiments the levels of FXN protein are measured using a combination of immunpurification and mass spectrometry. An exemplary method of measuring levels of FXN protein using mass spectrometry comprises detecting a peptide derived from mature hFXN, e.g., a peptide comprising or consisting of the amino acid sequence of SGTEGHPGSEDETTYER (SEQ ID NO: 6); and / or a peptide comprising, or consisting of, the amino acid sequence EGGDEGTYVINK (SEQ ID NO: 7). An exemplary method that may be used to measure levels of FXN protein in a solid sample obtained from a

[0205] 24

[0206] MEI 53012850v.l Atty. Docket No. 130197-01920 subject is described, e.g., in WO 2021 / 021964, the entire contents of which are hereby incorporated herein by reference. An exemplary method of measuring levels of FXN protein may comprise using liquid chromatography, followed by tandem mass spectrometry (LC / MS- MS) and monitoring the transition 607.3 -> 669.3 for the peptide comprising, or consisting of, SEQ ID NO: 6 and the transition 625.3 -> 794.4 for the peptide comprising, or consisting of, SEQ ID NO: 7. In some embodiments, an exemplary method of measuring levels of FXN protein in a solid tissue sample may comprise (a) purifying by immunocapture the FXN protein from a from the solid tissue sample, thereby obtaining immunocaptured complexes comprising FXN; (b) subjecting the immunocaptured complexes comprising FXN to digestion by trypsin, thereby producing the peptide comprising SEQ ID NO: 6 and / or the peptide comprising SEQ ID NO: 7; and (c) determining the amount of at least one peptide selected from the group consisting of the peptide comprising SEQ ID NO: 6 and the peptide comprising SEQ ID NO: 7 by LC / MS-MS.

[0207] Treatment of Friedreich’s Ataxia

[0208] In the context of the present disclosure, administration to a subject, e.g., an adult subject, of a TAT-FXN fusion protein at a dose of between 25 and 50 mg, e.g., a dose of about 25 mg for at least 90 days, or at a dose of about 50 mg for at least 90 days, can be clinically effective to treat Friedreich’s ataxia (FRDA). In some embodiments, a TAT-FXN fusion protein administered at a daily dose of about 0.8 mg / kg, up to a maximum daily dose of about 50 mg, can be clinically effective to treat Friedreich’s ataxia (FRDA) in a pediatric subject.

[0209] It is presently anticipated that protein replacement therapy with the TAT-FXN fusion protein will correct the metabolic defect in FRDA and restore adequate cellar function in subjects. It is also anticipated that treatment with the TAT-FXN fusion protein will change FRDA from a progressive and deadly disease to a chronic condition that is managed by injections of the fusion polypeptide, much as insulin has changed diabetes into a chronic disease with normal life activities. In older FRDA patients with established disease, it is anticipated that administration of the TAT-FXN fusion protein will halt disease progression. In children diagnosed before onset of FRDA symptoms, it is anticipated that administration of the TAT-FXN fusion protein will result in near complete preservation of tissue function and health.

[0210] 25

[0211] MEI 53012850v.l Atty. Docket No. 130197-01920

[0212] The gene defect for FRDA was identified in 1996 and there is consensus in the field that lack of FXN protein in mitochondria is the biochemical defect. Multiple investigators have shown that replacement of FXN in deficient patient fibroblasts, and even in yeast with loss of FXN, will rescue the phenotype. Thus, the consensus in the field is that therapies for FRDA must include increasing levels of FXN protein in mitochondria of affected tissues. Although the precise function of FXN has yet to be defined, it is clear that FXN participates in iron-sulfur cluster assembly. In its absence, mitochondrial proteins containing an ironsulfur cluster (Complexes I, II, and III of the electron transport chain, and aconitase of the Krebs cycle) are severely defective in activity. As a result, those tissues with high dependence on energy production by mitochondria, such as heart and brain, are severely affected and greater than about 60% of patients die from heart failure. As with other mitochondrial diseases, multiple organ systems are also impacted, such as eye, hearing, and pancreas. Thus, clinically relevant target tissues include the heart and brain and can be followed by common clinical testing, such as echocardiography, and neurologic assays such as the Friedreich Ataxia Rating Scale (FARS).

[0213] Administration of a TAT-FXN fusion protein, e.g., at a daily dose of about 0.8 mg / kg, up to a maximum daily dose of about 50 mg, can, therefore, be effective as a protein replacement therapy in FXN-deficient pediatric subjects diagnosed with FRDA, including, e.g., an FRDA-associated disease, disorder or condition, to treat the FRDA, including, e.g., the FRDA-associated disease, disorder or condition.In some embodiments, administration of a TAT-FXN fusion protein, e.g., at a dose of about 25 mg administered once daily for at least 90 days, or at a dose of 50 mg administered once daily for at least 90 days, can be effective as a protein replacement therapy in FXN-deficient subjects, e.g., adult subjects, diagnosed with FRDA, including, e.g., an FRDA-associated disease, disorder or condition, to treat the FRDA, including, e.g., the FRDA-associated disease, disorder or condition.

[0214] The term “FRDA”, as used herein, encompasses any disease, disorder or condition associated with a frataxin deficiency. In some embodiments, “FRDA” may be characterized by a loss of function in FXN, e.g., a loss of function mutation in an FXN gene. The term “FRDA-associated disease, disorder or condition”, as used herein, encompasses a disease, disorder or condition secondary to and / or caused by FRDA, i.e., when present in a subject, it accompanies FRDA and is not present in a subject in the absence of FRDA. Non-limiting examples of an FRDA-associated disease, disorder, or condition, include FRDA-associated

[0215] 26

[0216] MEI 53012850v.l Atty. Docket No. 130197-01920 pneumonia, FRDA-associated hypertrophic cardiomyopathy and FRD A- associated diabetes.

[0217] Other non-limiting examples of an FRDA-associated disease, disorder or condition include an FRDA-associated disease, disorder or condition characterized by, without limitation:

[0218] (1) a neurological deficiency including, without limitation, one or more of the following: loss of proprioception, loss of reflexes, loss of ability to walk, loss of ability to hold gaze with eyes;

[0219] (2) impaired swallowing and / or a progressive loss of the ability to swallow; progressive loss of hearing;

[0220] (3) progressive loss of vision due to retinal degeneration from lack of FXN;

[0221] (4) progressive loss of speech;

[0222] (5) metabolic syndrome including, without limitation, elevated triglycerides, low high-density lipoprotein (HDL) cholesterol, and elevated low-density lipoprotein (LDL) cholesterol;

[0223] (6) scoliosis that requires surgery to correct; and / or combinations thereof.

[0224] In some embodiments, administration of a TAT-FXN fusion protein, e.g., at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, to a pediatric subject treats FRDA, including, e.g., an FRDA-associated disease, disorder or condition. In some embodiments, administration of a TAT-FXN fusion protein, e.g., at a dose of about 25 mg administered once daily for at least 90 days, or at a dose of 50 mg administered once daily for at least 90 days, to a subject, e.g., an adult subject, treats FRDA, including, e.g., an FRDA-associated disease, disorder or condition.

[0225] “Treating FRDA”, as used herein, encompasses ameliorating, improving or achieving a reduction in the severity of FRDA, including, e.g., an FRDA-associated disease, disorder or condition. For example, “treating FRDA” encompasses ameliorating, improving or achieving a reduction in at least one symptom or indicator associated with FRDA. “Treating FRDA”, as used herein, also encompasses delaying progression of FRDA, including, e.g., an FRDA- associated disease disorder or condition, e.g., delaying appearance of at least one symptom or indicator associated with FRDA or preventing an increase in the severity of at least one symptom or indicator associated with FRDA, in a subject.

[0226] 27

[0227] MEI 53012850v.l Atty. Docket No. 130197-01920

[0228] In some embodiments, the TAT-FXN fusion protein is administered for at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least 13 months, at least 14 months, at least 15 months, at least 16 months, at least 17 months, at least 18 months, at least 19 months or at least 20 or more months.

[0229] In some embodiments, the term “treating FRDA” also encompasses achieving increased survival (e.g., survival time) of a subject, e.g., a human, with FRDA, including, e.g., an FRDA-associated disease, disorder or condition. For example, treatment of FRDA may result in an increased life expectancy of a subject, e.g., a human, with FRDA, including, e.g., an FRDA-associated disease disorder or condition. In some embodiments, treatment of FRDA in the context of the present disclosure may result in an increased life expectancy of a subject of greater than about 10%, greater than about 20%, greater than about 30%, greater than about 40%, greater than about 50%, greater than about 60%, greater than about 70%, greater than about 80%, greater than about 90%, greater than about 100%, greater than about 110%, greater than about 120%, greater than about 130%, greater than about 140%, greater than about 150%, greater than about 160%, greater than about 170%, greater than about 180%, greater than about 190%, or greater than about 200% or more, as compared to the average life expectancy of one or more control individuals with similar disease without treatment.

[0230] In some embodiments, treatment of FRDA, including, e.g., an FRDA-associated disease, disorder or condition, in the context of the present disclosure may result in an increased life expectancy of a subject by greater than about 6 months, greater than about 8 months, greater than about 10 months, greater than about 12 months, greater than about 2 years, greater than about 4 years, greater than about 6 years, greater than about 8 years, or greater than about 10 years or more, as compared to the average life expectancy of one or more control individuals with similar disease without treatment. In some embodiments, treatment of FRDA, including, e.g., an FRDA-associated disease, disorder or condition in the context of the present disclosure may result in a long-term survival of a subject, e.g., a human, with FRDA, including, e.g., an FRDA-associated disease, disorder or condition. The term “long-term survival”, as used herein, refers to a survival time or life expectancy longer than about 40 years, 45 years, 50 years, 55 years, 60 years, or longer.

[0231] 28

[0232] MEI 53012850v.l Atty. Docket No. 130197-01920

[0233] Clinical assessments known to one of ordinary skill in the art may be used to assess FRDA, including, e.g., an FRD A- associated disease, disorder or condition, to determine the severity of the FRDA and / or to determine the effect of administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days. In some embodiments, clinical assessments known to one of ordinary skill in the art may be used to assess FRDA, including, e.g., an FRDA- associated disease, disorder or condition, to determine the severity of the FRDA and / or to determine the effect of administration to a subject, e.g., adult subject, of a TAT- FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days. Examples of methods of clinical assessment of FRDA, including assessments of the severity of FRDA, are described, e.g., in Paap et al., “Standardized Assessment of Hereditary Ataxia Patients in Clinical Studies”, Mov Disord Clin Pract. 2016, 3(3):230-240 and Patel et al., “Progression of Friedreich ataxia: quantitative characterization over 5 years”, Ann Clin Transl Neurol 2016, 3(9):684-694, the entire contents of each of which are hereby incorporated herein by reference.

[0234] Timed 25-Foot Walk (T25-FW) is a quantitative mobility and leg function performance test that measures the time needed to complete a 25-foot walk. In some embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a decrease in the severity of FRDA as measured, e.g., by the time needed to complete a 25-foot walk. For example, administration to a subject of a TAT- FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a decrease in the time needed to complete a 25-foot walk, e.g., a decrease of at least about 5%, at least about 10%, at least about 25%, or at least about 50% in the time needed to complete a 25-foot walk, as compared to the time needed to complete a 25-foot walk measured in the subject prior to administration of the TAT-FXN fusion protein, or as compared to a baseline value. A baseline value may be the time needed to complete a 25-foot walk measured prior to administration of the TAT-FXN fusion protein.

[0235] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a decrease in the severity of FRDA as measured, e.g.,

[0236] 29

[0237] MEI 53012850v.l Atty. Docket No. 130197-01920 by the time needed to complete a 25-foot walk. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may result in a decrease in the time needed to complete a 25-foot walk, e.g., a decrease of at least about 5%, at least about 10%, at least about 25%, or at least about 50% in the time needed to complete a 25-foot walk, as compared to the time needed to complete a 25-foot walk measured in the pediatric subject prior to administration of the TAT-FXN fusion protein, or as compared to a baseline value. A baseline value may be the time needed to complete a 25-foot walk measured prior to administration of the TAT-FXN fusion protein.

[0238] In other embodiments, administration to a subject e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may delay progression of FRDA in the subject as measured, e.g., by the time needed to complete a 25-foot walk. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a substantially similar time needed to complete a 25-foot walk, or a lack of a substantial increase in the time needed to complete a 25-foot walk (e.g., less than a 20%, less than a 10%, or less than a 5% increase in the time needed to complete a 25-foot walk), as compared to the baseline value, i.e., time needed to complete a 25-foot walk measured in the subject prior to administration of the TAT-FXN fusion protein.

[0239] In other embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may delay progression of FRDA in the pediatric subject as measured, e.g., by the time needed to complete a 25-foot walk. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a substantially similar time needed to complete a 25-foot walk, or a lack of a substantial increase in the time needed to complete a 25-foot walk (e.g., less than a 20%, less than a 10%, or less than a 5% increase in the time needed to complete a 25-foot walk), as compared to the baseline value, i.e., time needed to complete a 25-foot walk measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0240] 30

[0241] MEI 53012850v.l Atty. Docket No. 130197-01920

[0242] The Modified Friedreich’s Ataxia Rating Scale (mFARS) is an examination-based rating scale for assessing the severity of FRDA as described, e.g., in Burk et al., “Monitoring progression in Friedreich ataxia (FRDA): the use of clinical scales”, J of Neurochemistry 2013, 126(suppl. 1): 118-124 and Rummey et al., “Psychometric properties of the Friedreich’s Ataxia Rating Scale”, Neurol Genet 2019, 5:e371, the entire contents of each of which are hereby incorporated herein by reference.

[0243] In some embodiments, the mFARS score may comprise at least one of the following subscores: a) a score based on the Functional Disability Rating Scale (FARS-FDS; 0-6 scale; assessment usually made by a neurologist; b) a score based on the Activities of Daily Living Scale (FARS-ADL, 0-36 scale; assessment made by a patient or caregiver); and c) a score based on the Neurological Rating Scale (FARS-neuro) 0-125 scale; assessment made by a neurologist). In some examples, the FARS-ADL score is a FARS rating scale assessing subject ability to complete ADLs (e.g., speech, cutting food, dressing, and personal hygiene), with scores ranging from 0 to 36 points. The respondent may be the subject; a combination of the subject and family; or a family member, spouse or caregiver for those subjects unable to complete the test.

[0244] In some embodiments, the score based on the Neurological Rating Scale may include modified scoring of the neurological rating scale involving direct subject participation and targeting specific areas impacted by FRDA, such as bulbar, upper limb, lower limb, and upright stability (mFARS-neuro, 0-99 scale). The mFARS-neuro excludes subscale D (peripheral nervous system) and the first 2 questions of subscale A (bulbar) from the neurological rating scale of the FARS questionnaire.

[0245] In some embodiments, the score based on the Neurological Rating scale may include modified scoring of the neurological rating scale (mFARS-neuro, 0-93 scale).

[0246] In some embodiments, the mFARS score may be based on two subscores derived from the full FARS questionnaire: mFARS-neuro as described above and the FARS-ADL as described above.

[0247] In some embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a decrease in the severity of FRDA as measured, e.g., by an mFARS score, or at least one mFARS subscore as described herein.

[0248] 31

[0249] MEI 53012850v.l Atty. Docket No. 130197-01920

[0250] For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a decrease in an mFARS score or at least one mFARS subscore, as compared to a baseline value, i.e., the mFARS score or the at least one mFARS subscore measured in the subject prior to administration of the TAT-FXN fusion protein.

[0251] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a decrease in the severity of FRDA as measured, e.g., by an mFARS score, or at least one mFARS subscore as described herein. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a decrease in an mFARS score or at least one mFARS subscore, as compared to a baseline value, i.e., the mFARS score or the at least one mFARS subscore measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0252] In other embodiments, administration to a subject e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may delay progression of FRDA in the subject as measured, e.g., by an mFARS score or at least one mFARS subscore as disclosed herein. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a substantially similar mFARS score or at least one mFARS subscore, or a substantial lack of an increase in an mFARS score or at least one mFARS subscore, as compared to a baseline value, i.e., the mFARS score or the at least one mFARS subscore measured in the subject prior to administration of the TAT-FXN fusion protein, or as compared to a baseline value.

[0253] In other embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may delay progression of FRDA in the subject as measured, e.g., by an mFARS score or at least one mFARS subscore as disclosed herein. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a substantially similar mFARS score or at least one mFARS subscore, or a

[0254] 32

[0255] MEI 53012850v.l Atty. Docket No. 130197-01920 substantial lack of an increase in an mFARS score or at least one mFARS subscore, as compared to a baseline value, i.e., the mFARS score or the at least one mFARS subscore measured in the pediatric subject prior to administration of the TAT-FXN fusion protein, or as compared to a baseline value.

[0256] In some embodiments, administration to a subject (e.g., adult subject) of the TAT- FXN fusion protein at a dose of about 25 mg once daily for at least 90 days may result in a decrease in the mFARS score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points or at least about 6 or more points.

[0257] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a decrease in the mFARS score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points or at least about 6 or more points.

[0258] In some embodiments, administration to a subject (e.g., adult subject) of the TAT- FXN fusion protein at a dose of about 25 mg once daily for at least 90 days may result in a decrease in the FARS-ADL score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points or at least about 10 or more points.

[0259] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may result in a decrease in the FARS-ADL score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5

[0260] 33

[0261] MEI 53012850v.l Atty. Docket No. 130197-01920 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about

[0262] 8.5 points, at least about 9 points, at least about 9.5 points or at least about 10 or more points.

[0263] The Nine-Hole Peg Test (9HPT) may be used to measure finger dexterity in subjects with FRDA. In this test, a subject is asked to take pegs from a container, one by one, and place them into the nine holes on the board as quickly as possible. The subject must then remove the pegs from the holes, one by one, and replace them back into the container. Scores are based on the time taken to complete the test activity, recorded in seconds.

[0264] In some embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a decrease in the severity of FRDA as measured, e.g., by a 9HPT score. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in an decrease in a 9HPT score expressed as time to complete the test activity e.g., at least an about 5%, 10%, 25%, or 50% decrease in a 9HPT score expressed as time to complete the test activity), as compared to a baseline value, i.e., the 9HPT score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0265] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a decrease in the severity of FRDA as measured, e.g., by a 9HPT score. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in an decrease in a 9HPT score expressed as time to complete the test activity (e.g., at least an about 5%, 10%, 25%, or 50% decrease in a 9HPT score expressed as time to complete the test activity), as compared to a baseline value, i.e., the 9HPT score measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0266] In other embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may delay progression of FRDA in the subject as measured, e.g., by a 9HPT score. For example, administration to a subject of a TAT-FXN

[0267] 34

[0268] MEI 53012850v.l Atty. Docket No. 130197-01920 fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a substantially similar 9HPT score, or a lack of a substantial increase in a 9HPT score expressed as time to complete the test activity, as compared to a baseline value, i.e., the 9HPT score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0269] In other embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may delay progression of FRDA in the subject as measured, e.g., by a 9HPT score. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a substantially similar 9HPT score, or a lack of a substantial increase in a 9HPT score expressed as time to complete the test activity, as compared to a baseline value, i.e., the 9HPT score measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0270] In some embodiments, administration of the TAT-FXN fusion protein to a subject e.g., adult subject) at a dose of about 25 mg daily for at least 90 days results in a decrease in the 9-HPT score of at least 1 second, at least 2 seconds, at least 5 seconds, at least 7 seconds, at least 9 seconds, at least 10 seconds, at least 15 seconds, at least 20 seconds, at least 25 seconds, at least 30 seconds, at least 35 seconds, at least 40 seconds, at least 45 seconds, at least 50 seconds, at least 55 seconds, at least 60 seconds, at least 65 seconds, at least 70 seconds, or at least 75 seconds.

[0271] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, results in a decrease in the 9-HPT score of at least 1 second, at least 2 seconds, at least 5 seconds, at least 7 seconds, at least 9 seconds, at least 10 seconds, at least 15 seconds, at least 20 seconds, at least 25 seconds, at least 30 seconds, at least 35 seconds, at least 40 seconds, at least 45 seconds, at least 50 seconds, at least 55 seconds, at least 60 seconds, at least 65 seconds, at least 70 seconds, or at least 75 seconds.

[0272] The Modified Fatigue Impact Scale (MFIS) is a modified form of the Fatigue Impact Scale based on items derived from interviews with MS patients concerning how fatigue impacts their lives. This instrument provides an assessment of the effects of fatigue in terms

[0273] 35

[0274] MEI 53012850v.l Atty. Docket No. 130197-01920 of physical, cognitive, and psychosocial functioning. The full-length MFIS consists of 21 items. The total score for the MFIS is the sum of the scores for the 21 items. Individual subscale scores for physical, cognitive, and psychosocial functioning can also be generated by calculating the sum of specific sets of items.

[0275] In some embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a decrease in the severity of FRDA as measured, e.g., by a MFIS score. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in an decrease in a MFIS score e.g., at least an about 5%, 10%, 25%, or 50% decrease in a MFIS, as compared to a baseline value, i.e., the MFIS score measured in the subject prior to administration of the TAT-FXN fusion protein.In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a decrease in the severity of FRDA as measured, e.g., by a MFIS score. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may result in an decrease in a MFIS score (e.g., at least an about 5%, 10%, 25%, or 50% decrease in a MFIS, as compared to a baseline value, i.e., the MFIS score measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0276] In other embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may delay progression of FRDA in the subject as measured, e.g., by a MFIS score. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a substantially similar MFIS score, or a lack of a substantial increase in a MFIS score, as compared to a baseline value, i.e., the MFIS score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0277] In other embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may delay progression of FRDA in the pediatric subject as measured, e.g., by a MFIS score. For example, administration to a pediatric subject of a TAT-FXN

[0278] 36

[0279] MEI 53012850v.l Atty. Docket No. 130197-01920 fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may result in a substantially similar MFIS score, or a lack of a substantial increase in a MFIS score, as compared to a baseline value, i.e., the MFIS score measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0280] In some embodiments, administration of the TAT-FXN fusion protein to a subject (e.g., adult subject) at a dose of about 25 mg daily for at least 90 days results in a decrease in the MFIS score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about

[0281] 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points, at least about 10 points, at least about 12 points, at least about 14 points, at least about 16 points, at least about 18 points, at least about 20 points, at least about 22 points, at least about 24 points, at least about 26 points, at least about 28 points or at least about 30 points.

[0282] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, results in a decrease in the MFIS score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about

[0283] 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points, at least about 10 points, at least about 12 points, at least about 14 points, at least about 16 points, at least about 18 points, at least about 20 points, at least about 22 points, at least about 24 points, at least about 26 points, at least about 28 points or at least about 30 points.

[0284] Functional Staging for Ataxia is completed by a healthcare professional and the scores may range from normal (Stage 0) to confined to a wheelchair or bed with total dependency for all activities of daily living (Stage 6.0), with increments of 0.5 permitted.

[0285] In some embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a decrease in the severity of FRDA as

[0286] 37

[0287] MEI 53012850v.l Atty. Docket No. 130197-01920 measured, e.g., by a Functional Staging for Ataxia score. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in an decrease in a Functional Staging for Ataxia score e.g., at least an about 5%, 10%, 25%, or 50% decrease in a Functional Staging for Ataxia, as compared to a baseline value, i.e., the PGI-S score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0288] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may result in a decrease in the severity of FRDA as measured, e.g., by a Functional Staging for Ataxia score. For example, administration to a subject of a TAT- FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may result in an decrease in a Functional Staging for Ataxia score (e.g., at least an about 5%, 10%, 25%, or 50% decrease in a Functional Staging for Ataxia, as compared to a baseline value, i.e., the PGI-S score measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0289] In other embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may delay progression of FRDA in the subject as measured, e.g., by a Functional Staging for Ataxia score. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a substantially similar PGI-S score, or a lack of a substantial increase in a Functional Staging for Ataxia score, as compared to a baseline value, i.e., the Functional Staging for Ataxia score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0290] In other embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may delay progression of FRDA in the pediatric subject as measured, e.g., by a Functional Staging for Ataxia score. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a substantially similar PGI-S score, or a lack of a substantial increase in a Functional Staging for Ataxia score, as

[0291] 38

[0292] MEI 53012850v.l Atty. Docket No. 130197-01920 compared to a baseline value, i.e., the Functional Staging for Ataxia score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0293] The Patient Global Impression of Severity (PGI-S) is a question that requires the subject to rate the severity of their condition. The Patient Global Impression of Change (PGI- C) is a question depicting a subject’s rating of their overall improvement from baseline with study drug.

[0294] In some embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a decrease in the severity of FRDA as measured, e.g., by a PGI-S score. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in an decrease in a PGI-S score e.g., at least an about 5%, 10%, 25%, or 50% decrease in a PGI-S, as compared to a baseline value, i.e., the PGI-S score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0295] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may result in a decrease in the severity of FRDA as measured, e.g., by a PGI-S score. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in an decrease in a PGI-S score (e.g., at least an about 5%, 10%, 25%, or 50% decrease in a PGI-S, as compared to a baseline value, i.e., the PGI-S score measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0296] In other embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may delay progression of FRDA in the subject as measured, e.g., by a PGI-S score. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a substantially similar PGI-S score, or a lack of a substantial increase in a PGI-S score, as compared to a baseline value, i.e., the PGI-S score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0297] 39

[0298] MEI 53012850v.l Atty. Docket No. 130197-01920

[0299] In other embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may delay progression of FRDA in the pediatric subject as measured, e.g., by a PGI-S score. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in a substantially similar PGI-S score, or a lack of a substantial increase in a PGI-S score, as compared to a baseline value, i.e., the PGI-S score measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0300] In some embodiments, administration to a subject e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a decrease in the severity of FRDA as measured, e.g., by a PGI-C score. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in an decrease in a PGI-C score (e.g., at least an about 5%, 10%, 25%, or 50% decrease in a PGI-C, as compared to a baseline value, i.e., the PGI-C score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0301] In some embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may result in a decrease in the severity of FRDA as measured, e.g., by a PGI-C score. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may result in an decrease in a PGI-C score (e.g., at least an about 5%, 10%, 25%, or 50% decrease in a PGI-C, as compared to a baseline value, i.e., the PGI-C score measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0302] In other embodiments, administration to a subject (e.g., adult subject) of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may delay progression of FRDA in the subject as measured, e.g., by a PGI-C score. For example, administration to a subject of a TAT-FXN fusion protein at a dose of about 25 mg once daily for at least 90 days or a dose of about 50 mg once daily for at least 90 days may result in a substantially similar PGI-C score, or a lack

[0303] 40

[0304] MEI 53012850v.l Atty. Docket No. 130197-01920 of a substantial increase in a PGI-C score, as compared to a baseline value, i.e., the PGI-C score measured in the subject prior to administration of the TAT-FXN fusion protein.

[0305] In other embodiments, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may delay progression of FRDA in the subject as measured, e.g., by a PGI-C score. For example, administration to a pediatric subject of a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days may result in a substantially similar PGI-C score, or a lack of a substantial increase in a PGI-C score, as compared to a baseline value, i.e., the PGI-C score measured in the pediatric subject prior to administration of the TAT-FXN fusion protein.

[0306] FRDA-Associated Pneumonia

[0307] Subjects diagnosed with FRDA suffer neurodegeneration of the dorsal root ganglia causing progressive ataxia. This typically leads to the progressive loss of an ability to walk, feed oneself, talk, swallow, and pulmonary aspiration. The event of pulmonary aspiration can lead to pneumonia, frequent hospitalizations, and, eventually, death over a period of 10- 15 years from the date of diagnosis.

[0308] For many of the reasons set forth above, administration of a disclosed pharmaceutical composition comprising a disclosed TAT-FXN fusion protein, can be effective as a protein replacement therapy in FXN-deficient subjects diagnosed with FRDA to prevent pulmonary aspiration, thereby preventing the pneumonia that follows pulmonary aspiration. Accordingly, the present disclosure provides methods of treating an FRDA-associated pneumonia in a subject, comprising administering to a subject in need thereof a pharmaceutical composition comprising a TAT-FXN fusion protein of the disclosure, thereby treating the FRDA-associated pneumonia in the subject.

[0309] FRDA-Associated Hypertrophic Cardiomyopathy

[0310] Hypertrophic cardiomyopathy is a condition in which the muscles of the heart thicken, making it difficult for the heart to pump blood through the circulatory system. It can be caused by a deficiency in FXN in the mitochondria of the heart cells. In subjects diagnosed with FRDA, progressive hypertrophic cardiomyopathy about 50% of the time progresses to heart failure and death. Protein replacement therapy with a disclosed TAT-FXN

[0311] 41

[0312] MEI 53012850v.l Atty. Docket No. 130197-01920 fusion protein can replace the FXN deficiency underlying hypertrophic cardiomyopathy. Administration of a TAT-FXN fusion protein to a subject can, therefore, be effective as a protein replacement therapy in FXN-deficient subjects diagnosed with both FRDA and hypertrophic cardiomyopathy. In some embodiments, a TAT-FXN fusion protein administered to a subject (e.g., adult subject) at a dose of about 25 mg once daily for at least 14 days or a dose of about 50 mg once daily for at least 14 days can be effective as a protein replacement therapy in FXN-deficient subjects diagnosed with both FRDA and hypertrophic cardiomyopathy. In some embodiments, a TAT-FXN fusion protein administered to a pediatric subject at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days can be effective as a protein replacement therapy in FXN- deficient subjects diagnosed with both FRDA and hypertrophic cardiomyopathy.

[0313] Diabetes

[0314] The hallmark of diabetes is an inability to properly regulate blood levels of glucose, resulting in elevated blood glucose levels. In subjects diagnosed with FRDA, diabetes often shows up as a consequence of FXN-deficient mitochondria in the pancreas. Protein replacement therapy with a TAT-FXN fusion protein can replace the FXN deficiency underlying diabetes. Administration of a TAT-FXN fusion protein to a subject can therefore be effective as a protein replacement therapy in FXN-deficient subjects diagnosed with diabetes. In some embodiments, a TAT-FXN fusion protein administered to a subject (e.g., adult subject) at a dose of about 25 mg once daily for at least 14 days or a dose of about 50 mg once daily for at least 14 days can be effective as a protein replacement therapy in FXN- deficient subjects diagnosed with diabetes. In some embodiments, a TAT-FXN fusion protein is administered to a pediatric subject at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days can be effective as a protein replacement therapy in FXN-deficient subjects diagnosed with diabetes.

[0315] Other FRDA-Associated Diseases / Disorders

[0316] Subjects diagnosed with FRDA often experience other disorders associated with FXN deficiency. Such FRDA-associated disorders can include, without limitation: neurological disorders including, without limitation, loss of proprioception, loss of reflexes, loss of ability to walk, loss of ability to hold gaze with eyes; impaired swallowing and / or a progressive loss of the ability to swallow; progressive loss of hearing; progressive loss of vision due to retinal

[0317] 42

[0318] MEI 53012850v.l Atty. Docket No. 130197-01920 degeneration from lack of FXN; progressive loss of speech; metabolic syndrome including, without limitation, elevated triglycerides, low high-density lipoprotein (HDL) cholesterol, and elevated low-density lipoprotein (LDL) cholesterol; scoliosis that requires surgery to correct; and / or combinations thereof. Protein replacement therapy with a disclosed TAT- FXN fusion protein can replace the FXN deficiency underlying these diseases / disorders. Administration of a TAT-FXN fusion protein to a subject can therefore be effective as a protein replacement therapy in FXN-deficient subjects diagnosed with FRDA and experiencing neurological disorders including, without limitation, loss of proprioception, loss of reflexes, loss of ability to walk, loss of ability to hold gaze with eyes; impaired swallowing and / or a progressive loss of the ability to swallow; progressive loss of hearing; progressive loss of vision due to retinal degeneration from lack of FXN; progressive loss of speech; metabolic syndrome including, without limitation, elevated triglycerides, low HDL cholesterol, and elevated LDL cholesterol; scoliosis that requires surgery to correct; and / or combinations thereof. In some embodiments, a TAT-FXN fusion protein is administered to a subject (e.g., adult subject) at a dose of about 25 mg once daily for at least 14 days or a dose of about 50 mg once daily for at least 14 days. In some embodiments, a TAT-FXN fusion protein is administered to a pediatric subject at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days.

[0319] Increase in the Levels of FXN Protein

[0320] Methods of the present disclosure, which comprise administering to a subject (e.g., adult subject), e.g., an FXN-deficient subject, a TAT-FXN fusion protein once daily at a dose of about 25 mg for at least 90 days, or a dose of about 50 mg for at least 90 days, may also result in an increase in the level of FXN protein in the subject, e.g., an increase in the level of FXN protein in a solid tissue sample obtained from the subject following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0321] In some embodiments, when the method comprises administering to the subject a TAT-FXN fusion protein at a dose of about 50 mg once daily for at least 14 days, the level of FXN protein in a solid tissue sample obtained from the subject following administration of the TAT-FXN fusion protein is increased by at least about 20%, or at least about 1.2-fold, as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0322] 43

[0323] MEI 53012850v.l Atty. Docket No. 130197-01920

[0324] In some embodiments, when the method comprises administering to the subject a TAT-FXN fusion protein at a dose of about 50 mg once daily for at least 14 days, the level of FXN protein in a solid tissue sample obtained from the subject following administration of the TAT-FXN fusion protein is increased by at least about 3 pg / ptg of total protein, as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0325] In some embodiments, the solid tissue sampe is a skin biopsy. In some embodiments, the solid tissue sample is a buccal tissue.

[0326] In some embodiments, the level of FXN protein in a solid tissue sample obtained from the subject following administration of the TAT-FXN fusion protein at a daily dose of about 25 mg for at least 90 days is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 70% of the level of FXN protein in a healthy subject.

[0327] In some embodiments, the level of FXN protein in a buccal sample following administration of the TAT-FXN fusion protein at a daily dose of about 25 mg for at least 90 days is about 1.4 to about 3.7 pg / ptg of total protein.

[0328] In some embodiments, the level of FXN protein in a buccal sample following administration of the TAT-FXN fusion protein at a daily dose of about 25 mg for at least 90 days is increased by about 0.5 to about 2.6 pg / ptg of total protein, as compared to the level of FXN protein prior to administration of the TAT-FXN fusion protein.

[0329] In some embodiments, the level of FXN protein in a buccal sample following administration of the TAT-FXN fusion protein at a daily dose of about 25 mg for at least 90 days is increased to at least about 30% of the level of FXN protein in a healthy subject following administration of the TAT-FXN fusion protein.

[0330] In some embodiments, the level of FXN protein in a skin biopsy sample following administration of the TAT-FXN fusion protein at a daily dose of about 25 mg for at least 90 days is about 7.0 to about 10.5 pg / ptg of total protein.

[0331] In some embodiments, the level of FXN protein in a skin biopsy sample following administration of the TAT-FXN fusion protein at a daily dose of about 25 mg for at least 90

[0332] 44

[0333] MEI 53012850v.l Atty. Docket No. 130197-01920 days is increased by about 4.2 to about 9.0 pg / ptg of total protein, as compared to the level of FXN protein prior to administration of the TAT-FXN fusion protein.

[0334] In some embodiments, the level of FXN protein in a skin biopsy sample following administration of the TAT-FXN fusion protein at a daily dose of about 25 mg for at least 90 days is increased to at least about 70% of the level of FXN protein in a healthy subject following administration of the TAT-FXN fusion protein.

[0335] In some embodiments, when the subject is administered the TAT-FXN fusion protein once daily at a dose of about 25 mg, the solid tissue sample is obtained from the subject at least 14 days following the start of the administration of the TAT-FXN fusion protein. In some embodiments, the solid tissue sample is obtained from the subject at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 11 weeks, at least 12 weeks, at least 13 weeks, at least 14 weeks, at least 15 weeks, at least 16 weeks, at least 17 weeks, at least 18 weeks, at least 19 weeks, at least 20 weeks, at least 25 weeks, at least 30 weeks, at least 35 weeks, at least 40 weeks, at least 45 weeks, at least 50 weeks or at least 60 or more weeks following the start of administration of the FXN fusion protein.

[0336] In some embodiments, when the subject is administered the TAT-FXN fusion protein once daily at a dose of about 50 mg, the solid tissue sample is obtained from the subject at least 14 days following the start of the administration of the TAT-FXN fusion protein. In some embodiments, the solid tissue sample is obtained from the subject at least at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 11 weeks, at least 12 weeks, at least 13 weeks, at least 14 weeks, at least 15 weeks, at least 16 weeks, at least 17 weeks, at least 18 weeks, at least 19 weeks, at least 20 weeks, at least 25 weeks, at least 30 weeks, at least 35 weeks, at least 40 weeks, at least 45 weeks, at least 50 weeks or at least 60 or more weeks following the start of administration of the FXN fusion protein.

[0337] In some embodiments, the solid tissue sample is obtained at more than one time point, e.g., at 14 days and at 28 days, following the start of administration of the TAT-FXN fusion protein. In some embodiments, the level of FXN in the tissue sample is determined at more than one time point following the start of administration of the TAT-FXN fusion protein

[0338] 45

[0339] MEI 53012850v.l Atty. Docket No. 130197-01920

[0340] (e.g., once every week, once every 2 weeks, once every 3 weeks, or once a month) in order to monitor the treatment of the subject with the TAT-FXN fusion protein.

[0341] In some embodiments, the methods further comprise the step of obtaining the solid tissue sample or samples from the subject. In some embodiments, the methods further comprise the step of measuring or determining the concentration of FXN in the solid tissue sample or samples obtained from the subject. In some embodiments, the methods further comprise the step of receiving information on the concentration of FXN in the solid tissue sample or samples obtained from the subject.

[0342] In some embodiments, the methods further comprise making a decision on whether to maintain or to modify a dose amount or dosing frequency based on the concentration of FXN in the solid tissue sample or samples. In some embodiments, the methods further comprise making a recommendation on whether to maintain or to modify a dose amount or dosing frequency based on the concentration of FXN in the solid tissue sample or samples.

[0343] In some embodiments, the subject is administered the TAT-FXN fusion protein once daily at a dose of about 25 mg for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 11 weeks, at least 12 weeks, at least 13 weeks, at least 14 weeks, at least 15 weeks, at least 16 weeks, at least 17 weeks, at least 18 weeks, at least 19 weeks, at least 20 weeks, at least 25 weeks, at least 30 weeks, at least 35 weeks, at least 40 weeks, at least 45 weeks, at least 50 weeks or at least 60 or more weeks.

[0344] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a subject who is administered the TAT-FXN fusion protein once daily at a dose of about 25 mg is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at least about 1000%, at

[0345] 46

[0346] MEI 53012850v.l Atty. Docket No. 130197-01920 least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0347] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a subject who is administered the TAT-FXN fusion protein once daily at a dose of about 25 mg is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9- fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40- fold, at least about 50-fold, at least about 60-fold, at least about 70-fold, at least about 80- fold, at least about 90-fold, at least about 100-fold, at least about 500-fold or at least about 1000-fold. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0348] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a subject who is administered the TAT-FXN fusion protein once daily at a dose of about 25 mg is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 1 pg / ptg of total protein, at least about 2 pg / pg of total protein, at least about 3 pg / pg of total protein, at least about 4 pg / pg of total protein, at least about 5 pg / pg of total protein, at least about 6 pg / pg of total protein, at least about 7 pg / ptg of total protein, at least about 8 pg / pg of total protein, or at least about 9 pg / ptg of total protein. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0349] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a subject who is administered the TAT-FXN fusion protein once daily at a dose of about 25 mg is increased to at least about 12.5%, at least about 25%, at least about 37.5% , at least about 50%, or at least about 70% of the level of FXN in the solid tissue sample of a healthy subject. The term “level of FXN protein in a healthy subject” or “level of FXN protein in the solid tissue sample of a healthy subject”, as used herein, refers to the level of FXN protein in

[0350] 47

[0351] MEI 53012850v.l Atty. Docket No. 130197-01920 a solid tissue sample (e.g., buccal or skin sample) from one or more healthy subjects, e.g., an average e.g., a mean or median) of FXN levels in a solid tissue sample (e.g., buccal or skin sample) from multiple (e.g., 2, 3, 4, 5, 10, 15, 20 or more) healthy subjects. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the level of FXN protein in a healthy subject is about 10 pg / ptg of total protein to about 20 pg / ptg of total protein, or about 14 pg / ptg of total protein to about 18 pg / ptg of total protein, or about 15 pg / ptg of total protein to about 17 pg / ptg of total protein, e.g., about 16.34 pg / ptg of total protein in a skin biopsy sample. In some embodiments, the solid tissue sample is a buccal sample. In some embodiments, the level of FXN protein in a healthy subject is about 5 pg / ptg of total protein to about 12 pg / ptg of total protein, about 6 pg / ptg of total protein to about 10 pg / ptg of total protein, or about 7 pg / |ig of total protein to about 9 pg / ptg of total protein, e.g., about 8.24 pg / |ig of total protein, in a buccal sample.

[0352] In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0353] In some embodiments, the increase in the level of hFXN in the solid tissue sample obtained from the subject, e.g., a skin sample or a buccal sample, is sufficient to have a therapeutic effect, i.e., sufficient to treat FRDA in the subject.

[0354] In some embodiments, the subject is administered the TAT-FXN fusion protein once daily at a dose of about 50 mg for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 11 weeks, at least 12 weeks, at least 13 weeks, at least 14 weeks, at least 15 weeks, at least 16 weeks, at least 17 weeks, at least 18 weeks, at least 19 weeks, at least 20 weeks, at least 25 weeks, at least 30 weeks, at least 35 weeks, at least 40 weeks, at least 45 weeks, at least 50 weeks or at least 60 or more weeks.

[0355] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a subject who is administered the TAT-FXN fusion protein once daily at a dose of about 50 mg is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 70%, at least

[0356] 48

[0357] MEI 53012850v.l Atty. Docket No. 130197-01920 about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at least about 1000%, at least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0358] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a subject who is administered the TAT-FXN fusion protein once daily at a dose of about 50 mg is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9- fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40- fold, at least about 50-fold, at least about 60-fold, at least about 70-fold, at least about 80- fold, at least about 90-fold, at least about 100-fold, at least about 500-fold or at least about 1000-fold. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0359] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a subject who is administered the TAT-FXN fusion protein once daily at a dose of about 50 mg is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 1 pg / pg of total protein, at least about 2 pg / pg of total protein, at least about 3 pg / pg of total protein, at least about 4 pg / pg of total protein, at least about 5 pg / pg of total protein, at least about 6 pg / pg of total protein, at least about 7 pg / pg of total protein, at least about 8 pg / pg of total protein, or at least about 9 pg / pg of total protein. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0360] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a subject who is administered the TAT-FXN fusion protein once daily at a dose of about 50

[0361] 49

[0362] MEI 53012850v.l Atty. Docket No. 130197-01920 mg is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50%, or at least 70% of the level of FXN in the solid tissue sample of a healthy subject. In some embodiments, the level of FXN in a solid tissue sample may be an average or a median of FXN levels measured in a solid tissue sample of multiple, e.g., two or more, subjects. In some embodiments, the solid tissue sample is a buccal sample.

[0363] In some embodiments, the increase in the level of hFXN in the solid tissue sample e.g., a skin sample or a buccal sample, obtained from the subject is sufficient to have a therapeutic effect, i.e., sufficient to treat FRDA in the subject.

[0364] Methods of the present disclosure, which comprise administering to a pediatric subject, e.g., an FXN-deficient subject, a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of 50 mg, administered once daily for at least 7 days, may also result in an increase in the level of FXN protein in the subject, e.g., an increase in the level of FXN protein in a solid tissue sample obtained from the subject following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

[0365] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a pediatric subject who is administered the TAT-FXN fusion protein once daily at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg, is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the pediatric subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at least about 1000%, at least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0366] 50

[0367] MEI 53012850v.l Atty. Docket No. 130197-01920

[0368] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a pediatric subject who is administered the TAT-FXN fusion protein once daily at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg, is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the pediatric subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 1.1-fold, at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 60-fold, at least about 70-fold, at least about 80-fold, at least about 90-fold, at least about 100-fold, at least about 500-fold or at least about 1000-fold. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0369] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a pediatric subject who is administered the TAT-FXN fusion protein once daily at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg, is increased following administration of the TAT-FXN fusion protein, as compared to the level of FXN protein in a solid sample obtained from the pediatric subject prior to the administration of the TAT-FXN fusion protein. In some embodiments the level of FXN protein is increased by at least about 1 pg / pg of total protein, at least about 2 pg / pg of total protein, at least about 3 pg / pg of total protein, at least about 4 pg / pg of total protein, at least about 5 pg / pg of total protein, at least about 6 pg / pg of total protein, at least about 7 pg / pg of total protein, at least about 8 pg / pg of total protein, or at least about 9 pg / pg of total protein. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the solid tissue sample is a buccal sample.

[0370] In some embodiments, the level of FXN protein in a solid tissue sample obtained from a pediatric subject who is administered the TAT-FXN fusion protein once daily at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg, is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 70% of the level of FXN in the solid tissue sample of a healthy subject.

[0371] The term “level of FXN protein in a healthy subject” or “level of FXN protein in the solid tissue sample of a healthy subject”, as used herein, refers to the level of FXN protein in

[0372] 51

[0373] MEI 53012850v.l Atty. Docket No. 130197-01920 a solid tissue sample (e.g., buccal or skin sample) from one or more healthy subjects, e.g., an average e.g., a mean or median) of FXN levels in a solid tissue sample (e.g., buccal or skin sample) from multiple (e.g., 2, 3, 4, 5, 10, 15, 20 or more) healthy subjects. In some embodiments, the solid tissue sample is a skin sample. In some embodiments, the level of FXN protein in a healthy subject is about 10 pg / ptg of total protein to about 20 pg / ptg of total protein, or about 14 pg / ptg of total protein to about 18 pg / ptg of total protein, or about 15 pg / ptg of total protein to about 17 pg / ptg of total protein, e.g., about 16.34 pg / ptg of total protein in a skin biopsy sample. In some embodiments, the solid tissue sample is a buccal sample. In some embodiments, the level of FXN protein in a healthy subject is about 5 pg / ptg of total protein to about 12 pg / ptg of total protein, about 6 pg / ptg of total protein to about 10 pg / ptg of total protein, or about 7 pg / ptg of total protein to about 9 pg / ptg of total protein, e.g., about 8.24 pg / ptg of total protein, in a buccal sample.

[0374] EXAMPLES

[0375] Example 1. Administration of TAT-FXN fusion protein to subjects with FRDA increases levels of hFXN in solid tissues

[0376] Ambulatory and non- ambulatory subjects with FRDA > 18 years of age were administered the TAT-FXN fusion protein of SEQ ID NO: 5. Cohort 1 included a total of 13 participants, with 4 participants receiving placebo and 9 participants receiving 25 mg of the TAT-FXN fusion protein. Cohort 2 included a total of 15 participants, with 5 participants receiving placebo and 10 participants receiving 50 mg of the TAT-FXN fusion protein. The TAT-FXN fusion protein was administered once daily for the first 14 days, and once every other day for additional 14 days, as illustrated in Figure 1.

[0377] Skin and buccal samples were collected on day 14 and day 28. FXN levels in the samples were measured using mass spectrometry via detection of peptide derived from mature FXN. FXN concentrations in the samples were determined and normalized to total cellular protein content in each sample. Compared with baseline, median FXN concentration increased by 0.56 pg / ptg and 0.72 pg / ptg in buccal cells and 2.81 pg / ptg and 5.57 pg / ptg in skin cells in Cohorts 1 and 2, respectively, after 14 days of daily administration of the TAT-FXN fusion protein, with no change from baseline observed in subjects receiving placebo.

[0378] 52

[0379] MEI 53012850v.l Atty. Docket No. 130197-01920

[0380] Figure 2 is a graph showing dose-dependent increase from baseline in FXN levels in skin cells of subjects with FRDA that were administered 25 mg or 50 mg of the TAT-FXN fusion protein or placebo at day 14 and day 28. The dots represent median and the horizontal lines represent 25thand 75thpercentiles. The dose-dependent increase from baseline in FXN levels in skin is also summarized in Table 1 below.

[0381] Table 1: Median change from baseline skin FXN levels

[0382] Median baseline for subjects was 3.7 pg / ptg for cohort 1 and 2.1 pg / pg for cohort 2.

[0383] After 14 days of daily dosing, a dose-dependent increase in FXN levels from baseline is observed in skin cells. At 28 days, which is after subjects were switched to every-other- day dosing for 14 days, a dose dependent increase in frataxin levels is still observed, but the magnitude of the increase is lower.

[0384] Figure 3 is a waterfall plot showing the individual changes in FXN levels from baseline in skin cells of subjects with FRDA who were administered 25 mg or 50 mg of the TAT-FXN fusion protein or placebo at day 14. Each bar represents an individual subject. Figure 3 indicates that the majority of subjects treated with the TAT-FXN fusion protein had significant increases in FXN levels while subjects who were administered placebo had FXN levels that were basically unchanged. There is also a dose response observed, as FXN levels are increased in most of the cohort 2 (receiving 50 mg of TAT-FXN fusion protein), as compared to cohort 1 (receiving 25 mg dose of TAT-FXN fusion protein).

[0385] Figure 4 is a graph showing dose-dependent increase from baseline in FXN levels in buccal cells of subjects with FRDA who were administered 25 mg or 50 mg of the TAT-FXN fusion protein or placebo at day 14 and day 28. The dots represent median and the horizontal

[0386] 53

[0387] MEI 53012850v.l Atty. Docket No. 130197-01920 lines represent 25thand 75thpercentiles. Median baseline for subjects was 1.78 pg / ptg for cohort 1 and 1.61 pg / ptg for cohort 2.

[0388] After 14 days of dosing, a dose-dependent increase in FXN levels from baseline is observed in skin cells, although magnitude of the increase is lower than that observed in skin cells because buccal cells have lower levels of FXN than skin cells. The buccal cells also do not maintain the increased FXN levels following the switch to every other day dosing between day 14 and day 28 for cohort 1. This effect may be due to the quick turnover of buccal cells.

[0389] Figure 5 is a waterfall plot showing the individual changes in FXN levels from baseline in buccal cells of subjects with FRDA that were administered 25 mg or 50 mg of the TAT-FXN fusion protein or placebo at day 14. Figure 5 indicates that most treated subjects had increases in their FXN levels, while the FXN levels of subjects receiving placebo remained unchanged.

[0390] Figure 6 is a schematic showing the number of subjects who had a shift in their FXN levels in skin cells as a percentage of healthy volunteers after 14 days of treatment. Percentage of healthy volunteers was calculated by dividing each participant’ s FXN level by the average FXN level from the non-interventional healthy volunteer study (N=60). Figure 6 includes only those subjects who had quantifiable levels of FXN at baseline and day 14.

[0391] The data presented in Figure 6 indicates that of the 7 subjects who received a daily 25 mg dose of the TAT-FXN fusion protein for 14 days, one subject had a baseline level of FXN in skin cells, and 6 subjects had an increased from their baseline level of FXN in skin cells at day 14. Of the 6 subjects who had an increased from baseline level of FXN at day 14, one subject had an FXN level that is >50% of the FXN level in healthy volunteers.

[0392] The data presented in Figure 6 also indicates that of the 9 subjects who received a daily 50 mg dose of the TAT-FXN fusion protein for 14 days, all 9 subjects had an increased from baseline level of FXN in skin cells at day 14, with 3 subjects having an FXN level that was >50% of the FXN level in healthy volunteers.

[0393] Figure 7 is a schematic showing the number of subjects who had a shift in their FXN levels in buccal cells as a percentage of healthy volunteers after 14 days of treatment.

[0394] 54

[0395] MEI 53012850v.l Atty. Docket No. 130197-01920

[0396] The data presented in Figure 7 indicates that of the 7 subjects who received a daily 25 mg dose of the TAT-FXN fusion protein for 14 days, 5 subjects had a baseline level of FXN in buccal cells, and 2 subjects had an increased from baseline level of FXN in buccal cells at day 14. Of the 2 subjects who had an increased from baseline level of FXN at day 14, one subject had an FXN level that was >37.5% of the FXN level in healthy volunteers.

[0397] The data presented in Figure 7 also indicates that of the 7 subjects who received a daily 50 mg dose of the TAT-FXN fusion protein for 14 days, 2 subjects had a baseline level of FXN in buccal cells and 5 subjects had an increased from baseline level of FXN in buccal cells at day 14. Of the 5 subjects who had an increased from baseline level of FXN at day 14, one subject had an FXN level that was >37.5% of the FXN level in healthy volunteers.

[0398] The results presented in Example 1 indicate that once daily administration of the TAT-FXN fusion protein at the dose of 25 mg and 50 mg leads to increased levels of FXN in both skin and buccal samples in subjects with FRDA.

[0399] Example 2. Prediction of tissue FXN levels with long term administration of TAT-FXN fusion protein in adults with FRDA using modeling and simulations

[0400] Abstract

[0401] Methods

[0402] Plasma concentrations of the TAT-FXN fusion protein and skin FXN concentrations from adults with FRDA before and after short term (< 30 days) subcutaneous administration of 25 mg, 50 mg, 75 mg, and 100 mg of an exemplary FXN fusion protein in Phase 1 and 2 clinical studies were used to construct an exposure-response model. Simulations of a population of virtual FRDA patients receiving daily doses of 25, 50, 75 or 100 mg of FXN fusion protein were performed (n=100, 100 trials) and skin FXN profiles over time at each dose were predicted.

[0403] Results

[0404] The simulations predicted that skin FXN concentrations should reach steady state at approximately 28 days after daily administrations across all doses. Daily administration of 25

[0405] 55

[0406] MEI 53012850v.l Atty. Docket No. 130197-01920 mg, 50 mg, 75 mg, and 100 mg of the TAT-FXN fusion protein was predicted to attain a median maximum skin FXN concentration of 6.22 pg / |ig, 9.06 pg / p.g, 11.9 pg / p.g, and 14.7 pg / .g, respectively.

[0407] Discussion

[0408] In a separate study, the mean skin FXN concentration in healthy controls with 2 normal frataxin alleles was 16.35 pg / p.g. Prior published studies indicate that the mean FXN concentration in asymptomatic heterozygous carriers is 50% of healthy controls. In relation to these findings, 59% of patients with FRDA receiving daily 50 mg of FXN fusion protein are predicted to achieve skin frataxin concentrations that are equal or above 50% of the concentrations found in healthy controls.

[0409] Conclusion

[0410] Modeling and simulation using data from short term studies of FXN fusion protein administration can be used to predict a potential long term therapeutic dose, aily administration of 50 mg of FXN fusion protein is predicted to result in skin FXN concentrations that are > 50% of FXN concentrations found in healthy controls.

[0411] Introduction

[0412] FXN deficiency is the root cause of Friedreich’s ataxia (FRDA). Mean tissue FXN concentrations in patients with FRDA range from 21% to 35% relative to healthy controls with 2 normal FXN gene alleles. In asymptomatic heterozygous carriers, mean tissue FXN concentrations are approximately 50% of controls. Increases in tissue FXN concentrations were observed in adults with FRDA who received the TAT-FXN fusion protein in short term Phase 1 and phase 2 studies. Over a dose range from 25 mg to 100 mg of the TAT-FXN fusion protein, observed increases in tissue FXN concentrations appeared to be proportional to both dose and plasma concentrations of the FXN fusion protein. The objective of this study was to predict the potential increase in tissue FXN concentrations after long term administration of 25 mg to 100 mg TAT-FXN fusion protein.

[0413] Methods: Clinical Studies

[0414] Plasma TAT-FXN fusion protein pharmacokinetic (PK) and skin FXN concentration (pharmacodynamic [PD] ) data were collected from 3 completed clinical studies in adults with

[0415] 56

[0416] MEI 53012850v.l Atty. Docket No. 130197-01920

[0417] FRDA. The first study was a single ascending dose study which included dosing with 25 mg, 50, mg, 75 mg, and 100 mg of the TAT-FXN fusion protein and evaluation of the TAT-FXN fusion protein concentrations. The second study was a multiple ascending dose study which included dosing with 25 mg, 50, mg, 75 mg, and 100 mg of the TAT-FXN fusion protein in accordance with the dosing schedule shown in Figure 8. In the multiple ascending dose study, plasma samples to evaluate concentrations of the TAT-FXN fusion protein were obtained on days 1, 7 and 13, and skin samples to evaluate FXN concentrations were obtained at baseline and on day 13. The third study, which is described in Example 1, was a dose exploration study evaluating 25 mg and 50 mg doses of the TAT-FXN fusion protein administered according to the dosing schedule illustrated in Figure 1. In this study, full plasma samples were obtained on days 1, 7, 14 and 28 to evaluate TAT-FXN fusion protein PK profiles, and skin samples to evaluate FXN concentration were obtained at baseline and on days 14 and 28.

[0418] Methods: PK / PD

[0419] For pharmacokinetic / pharmacodynamics (PK / PD) modeling studies, a populational PK model (popPK) was developed from 1502 PK samples using NONMEM®. Beal's M3 method was applied to allow inclusion of BLQ data. A PK / PD model was developed using 95 non-BLQ post-dose observations collected from 61 unique subjects with FRDA, as shown in Figure 9. Here, the model parameters applied were Kin (zero order rate constant for FXN) 0.0241 1 / h; EBASE (estimated baseline) 3.28 pg / qgprot; F4 (proportionality constant for FXN input from central compartment) 0.0194 103 pg / pg / pgpi<>i. A population of virtual FRDA patients receiving subcutaneous daily doses of 25, 50, 75 or 100 mg of the TAT-FXN fusion protein for 40 days was simulated (n=100, 100 trials). Body weight and age of diagnosis were simulated based on the observed covariate distributions. Distribution of increases in FXN concentration from 50 sets of 2500 virtual FRDA patients was stratified by baseline FXN concentrations and the age of onset. Model verification was conducted by visual predictive checks (VPCs).

[0420] Results

[0421] Figure 10 is a plot showing mean and SD PK parameters with doses of 25 mg, 50 mg and 100 mg for the last day of daily dose for the multiple ascending dose study, while Figure 11 is a plot showing mean and SD PK parameters with doses of 25 mg and 50 mg for the last

[0422] 57

[0423] MEI 53012850v.l Atty. Docket No. 130197-01920 day of daily dose for the dose exploration study. The data shown in Figures 10 and 11 demonstrates that after subcutaneous administration of the TAT-FXN fusion protein, rapid absorption with a multi-exponential decline in concentrations was observed with doseproportional increases in exposure.

[0424] As illustrated in Figure 2 and Table 1 of Example 1 for the dose exploration study, and in Table 2 below for the multiple ascending dose study, dose-dependent increases in FXN concentrations were observed in the studies.

[0425] Table 2. Median change from baseline skin FXN levels in multiple ascending dose study

[0426] Figure 12 is a plot showing skin frataxin to protein ratio over time predicted from PK / PD simulations for a dose of 100 mg, 75 mg, 50 mg and 25 mg of TAT-FXN fusion protein. Dashed red line represents 50% of the average skin frataxin / protein ratio (8.17 pg / pg) in a non-interventional study in healthy controls. Blue line represents the median of simulated values across trials, and the red lines are the 10th and 90th percentiles. Shaded regions represent the 95% confidence intervals of the corresponding percentiles (10th, 50th, and 90th).

[0427] Median simulated values show in Figure 12 indicate that 50 mg of the TAT-FXN fusion protein administered daily is predicted to lead to a median increase in FXN concentrations of 5.64 pg / pg from baseline and increase skin FXN concentrations in 59% of simulated patients with FRDA to levels approximating or exceeding values representing 50% of the average skin FXN concentration in healthy controls (red dashed horizontal line).

[0428] Figure 13 is a plot showing model-predicted maximum skin FXN concentration at steady state stratified by baseline FXN level. The black dashed lines represent 50% (8.17 pg / mcg) and 100% (16.35 pg / mcg) of the mean skin FXN concentrations in healthy controls.

[0429] 58

[0430] MEI 53012850v.l Atty. Docket No. 130197-01920

[0431] The densities correspond to the 10th percentile (yellow), medians (green), and 90th percentile (red) of the simulated maximum skin FXN to protein ratio at steady state.

[0432] Figure 14 is a plot showing model-predicted maximum skin FXN concentration at steady state stratified by age of onset. The black dashed lines represent 50% (8.17 pg / mcg) and 100% (16.35 pg / mcg) of the mean skin FXN concentrations in healthy controls. The densities correspond to the 10th percentile (yellow), medians (green), and 90th percentile (red) of the simulated maximum skin FXN to protein ratio at steady state.

[0433] Median simulated values shown in Figures 13 and 14 indicate that 50 mg of the TAT- FXN fusion protein administered daily is predicted to increase tissue FXN concentrations to a range that approaches or surpasses the 50% level relative to the mean healthy control FXN concentrations in the majority of patients with FRDA regardless of baseline FXN concentration and age of onset.

[0434] Conclusions

[0435] In this study, dose-dependent increases in TAT-FXN fusion protein exposure and skin FXN concentrations were observed in adults with FRDA after short term administration of 25 mg to 100 mg of the TAT-FXN fusion protein. Modeling and simulation predicted that daily administration of 50 mg of the TAT-FXN fusion protein would result in skin FXN concentrations that are > 50% of concentrations found in healthy controls. Further extension of the model applications to the pediatric population is planned to predict the impact of administration of the TAT-FXN fusion protein on FXN concentrations across different age groups. Data from an ongoing open label extension study will be used to confirm TAT-FXN fusion protein exposure and changes in tissue FXN concentrations after long term administration of TAT-FXN fusion protein to patients with FRDA.

[0436] Example 3. Disease characteristics and tissue FXN concentrations in adults with FRDA participating in interventional studies of an exemplary FXN fusion protein

[0437] Abstract

[0438] Methods

[0439] Disease characteristics, e.g., age at onset and guanine adenine adenine (GAA) repeat length, of adults with FRDA participating in Phase 1 and 2 interventional studies of TAT-

[0440] 59

[0441] MEI 53012850v.l Atty. Docket No. 130197-01920

[0442] FXN fusion protein were summarized and evaluated relative to baseline buccal and skin cell FXN concentrations.

[0443] Results

[0444] Sixty-one subjects participated in at least one study; 18 subjects participated in more than one study. Mean age was 31.9 years, and the age range was 19- 69 years. Mean age of onset was 15.9 years, and the range was 5- 60 years. Mean (range) shorter and longer GAA repeat lengths were 555.8 (99- 1000) and 890.2 (265- 1300). Mean baseline modified Friedreich’s Ataxia Rating scale neurologic score was 49.5 (13.2- 74.5). Mean (range) baseline buccal and skin cell frataxin concentrations were 1.90 (0.70- 4.95) and 3.25 (1.40- 8.10) pcg / pg, respectively. There is a relationship between FXN concentrations and age of onset and GAA repeat length. There is also a relationship between skin and buccal cell FXN concentrations.

[0445] Discussion

[0446] Age of onset is associated with more rapid disease progression. Data from the interventional studies of FXN fusion protein are consistent with previously published data suggesting that lower tissue FXN concentrations are associated with more rapid disease progression. Increasing FXN concentrations in patients with FRDA may decrease rate of disease progression.

[0447] Conclusion

[0448] The study population in the interventional studies of TAT-FXN fusion protein is representative of the FRDA population, and tissue FXN concentration data from these studies are consistent with prior studies demonstrating that lower FXN concentrations are associated with earlier onset of disease. Buccal and skin cell FXN levels correlate with each other.

[0449] Introduction

[0450] Friedreich ataxia (FRDA) is an autosomal recessive neurodegenerative disorder caused by a guanine adenine adenine (GAA) repeat expansion in the FXN gene that results in frataxin (FXN) deficiency. Affected individuals develop a progressive ataxia that leads to a loss of ambulation. Tissue FXN concentrations are correlated with age of disease onset and inversely correlated with the number of GAA repeats and rate of disease progression. The

[0451] 60

[0452] MEI 53012850v.l Atty. Docket No. 130197-01920 range of the number of GAA repeats observed in the population of patients with FRDA results in a diverse spectrum of disease characteristics.

[0453] The goal of this study was to describe the characteristics, including tissue FXN concentrations, in adults with FRDA who participated in Phase 1 and Phase 2 clinical studies evaluating a TAT-FXN fusion protein as a potential treatment for patients with FRDA.

[0454] Methods

[0455] Demographics and disease characteristics, as well as skin FXN concentration data, were collected from 3 completed clinical studies in adults with FRDA that are described in Example 2: The first study was a single ascending dose study which included dosing with 25 mg, 50, mg, 75 mg, and 100 mg of the TAT-FXN fusion protein and evaluation of the TAT- FXN fusion protein concentrations. The second study was a multiple ascending dose study which included dosing with 25 mg, 50, mg, 75 mg, and 100 mg of the TAT-FXN fusion protein in accordance with the dosing schedule shown in Figure 8. In the multiple ascending dose study, plasma samples to evaluate concentrations of the TAT-FXN fusion protein were obtained on days 1, 7 and 13, and skin samples to evaluate FXN concentrations were obtained at baseline and on day 13. The third study, which is described in Example 1, was a dose exploration study evaluating 25 mg and 50 mg doses of the TAT-FXN fusion protein administered according to the dosing schedule illustrated in Figure 1.

[0456] For statistical analyses, a linear regression model was used to investigate the relation of FXN levels in buccal cells to disease severity and progression; the relation of age of onset of disease manifestations to GAA repeat length on the shorter allele; and the relation of frataxin levels in buccal cells to frataxin levels in skin cells.

[0457] The demographics and baseline disease characteristics data for adults with FRDA participating in clinical studies of the TAT-FXN fusion protein are summarized in Table 3.

[0458] Table 3: Summary of demographic and baseline disease characteristics of adults with FRDA participating in clinical studies

[0459] 61

[0460] MEI 53012850v.l Atty. Docket No. 130197-01920

[0461] *18 subjects participated in more than 1 study.

[0462] ** Quantifiable buccal cells FXN levels relative to the median of healthy controls

[0463] **Ambulatory status is based on the gait score (E7=5 vs. <5) of the upright stability subscore of the mFARS GAA: guanine adenine adenine; mFARS: modified Freidriech’s ataxia rating scale; T25FW: timed 25 -foot walk; EVEF: left ventricular ejection fraction

[0464] Data on the quantifiable buccal cell FXN concentrations in adults with FRDA who participated in the clinical studies were organized into quartiles as shown in Table 4.

[0465] Table 4: Summary of disease characteristics of participants in clinical studies

[0466] 62

[0467] MEI 53012850v.l Atty. Docket No. 130197-01920

[0468] **Median values

[0469] Median buccal cell FXN concentration in healthy controls = 8.1 ng / mcg

[0470] Figure 15 is a graph showing the relationship between age at onset and shorter triplet GAA repeat length in adults with FRDA participating in the clinical studies with the TAT- FXN fusion protein. The data shown in Figure 15 indicate that age at onset is inversely correlated with GAAi repeat length.

[0471] Figure 16 is a graph showing the relationship between buccal cell and skin cell frataxin concentrations in adults with FRDA participating in clinical studies with the TAT- FXN fusion protein. The data shown in Figure 16 indicate that buccal cell FXN concentrations correlate with skin cell frataxin concentrations.

[0472] Figure 17 is a graph showing the relationship between buccal cell frataxin concentrations and age at symptom onset in adults with FRDA participating in clinical studies with the TAT-FXN fusion protein. Figure 18 is a graph showing the relationship between buccal cell frataxin concentration and shorter triplet GAA (guanine adenine adenine) repeat lengths in adults with FRDA participating in clinical studies with the TAT-FXN fusion protein.

[0473] 63

[0474] MEI 53012850v.l Atty. Docket No. 130197-01920

[0475] Figure 19 is a graph showing the relationship between buccal cell frataxin concentration and total modified Friedreich’s ataxia rating scale (mFARS) score in adults with FRDA participating in clinical studies with the TAT-FXN fusion protein.

[0476] The data shown in Figures 17-19 indicate that buccal cell FXN concentrations correlate with age at onset, and inversely correlate with GAAi repeat length and mFARS score in adults with FRDA participating in clinical studies of the TAT-FXN fusion protein.

[0477] Conclusions

[0478] Population of 61 participants in the clinical studies of the TAT-FXN fusion protein represent a wide range of adults with FRDA. Relationships observed between disease characteristics and buccal cell frataxin concentrations in population of participants in the clinical studies are consistent with reports from previous studies. As reported previously, lower tissue frataxin concentrations are associated with more severe disease. Buccal cell FXN concentrations are correlated with skin cell FXN concentrations.

[0479] Example 4. An Open-Label Extension Study to Assess the Long-term Safety, Efficacy, Pharmacodynamics, Pharmacokinetics, and Tolerability of Subcutaneous TAT-FXN Fusion Protein in Subjects with Friedreich’s Ataxia

[0480] Study Protocol

[0481] Background Information

[0482] Friedreich’s ataxia (FRDA) is the most common inherited ataxia in humans and results from a deficiency of the mitochondrial protein, frataxin (FXN). FRDA is a rare disease with an incidence that is estimated to be 1:29,000, and a carrier frequency of -1:85. In the United States (US), there are an estimated 4,000 to 5,000 cases, primarily in Caucasians of European descent, with an equal frequency in males and females. It is a progressive multisystem disease, typically beginning in mid-childhood. Patients suffer from multiple symptoms, including progressive neurologic and cardiac dysfunction. A key feature of FRDA is the primary neurodegeneration of the dorsal root ganglia and the dentate nucleus of the cerebellum leading to the hallmark clinical findings of progressive limb ataxia and dysarthria. A hypertrophic cardiomyopathy is common and associated with early mortality in

[0483] 64

[0484] MEI 53012850v.l Atty. Docket No. 130197-01920 the third to fifth decade of life. Other clinical findings can include scoliosis, fatigue, diabetes, visual impairment, and hearing loss.

[0485] Inheritance is autosomal recessive and is predominantly caused by an inherited guanine adenine adenine (GAA) triplet expansion in the first intron of both alleles of the FXN gene. This triplet expansion causes transcriptional repression of the FXN gene, so patients produce only small quantities of FXN. There is some correlation between GAA repeat number and the onset and severity of clinical symptoms, with higher repeat numbers associated with more severe disease. Heterozygotes (carriers) typically have FXN levels at -50% of normal but are phenotypically normal. The FXN levels in whole blood in both heterozygotes and in FRDA patients have been shown to be stable over time.

[0486] The TAT-FXN fusion protein of the disclosure (CTI-1601) is being developed as a novel, specific treatment to supplement FXN levels in adults and children with FRDA. Currently, there is no approved FXN replacement therapy available for the treatment of FRDA. The only treatment for FRDA approved by the US Food and Drug Administration (FDA) is omaveloxolone. The precise mechanism by which omaveloxolone exerts its therapeutic effect in patients with FRDA is unknown but has been shown to activate the Nuclear factor (erythroid-derived 2)-like 2 (Nrf2) pathway which is involved in the cellular response to oxidative stress. Omaveloxolone does not appear to affect tissue FXN concentrations, and therefore does not address the core pathophysiology of FRDAA

[0487] TAT-FXN Fusion Protein - Clinical Information

[0488] CTI-1601, intended to be a mitochondrial FXN replacement therapy, is a recombinant fusion protein and is intended to deliver FXN, the protein deficient in FRDA, to the mitochondria where it is intended to increase mitochondrial levels of FXN and restore normal mitochondrial function in patients with FRDA.

[0489] CTI-1601 administered SC in a single dose was well tolerated at doses of 25, 50, 75, and 100 mg in the single ascending dose (SAD) study. Twenty-eight subjects participated in the SAD study: 6 in Cohort 1, 7 in Cohort 2, 8 in Cohort 3, and 7 in Cohort 4. Most treatment-emergent adverse events (TEAEs) were Common Terminology Criteria for Adverse Events (CTCAE) Grades 1 and 2 in severity. There were no fatal events or serious adverse events (SAEs) reported in this study.

[0490] 65

[0491] MEI 53012850v.l Atty. Docket No. 130197-01920

[0492] Injection site reactions (ISRs), all Grade 1 in severity, were the most common types of TEAEs, reported in all (100%) subjects treated with CTI-1601; these events were much less frequent (10%) in subjects who received placebo. The majority of TEAEs of ISRs occurred on the day of study drug administration and were considered related to study drug; most of these events resolved on the same day of onset.

[0493] The incidence of injection site findings, including discoloration, tenderness, ecchymosis, and scratch marks, was higher (56%) in CTI-1601 -treated subjects compared to none (0%) in placebo subjects. The most common finding was tenderness, reported in 39% of all treated subjects, more frequently reported in subjects treated at a dose of 75 mg. Discoloration was only reported in 17% of all treated subject and only reported in subjects treated at 100 mg. Injection site findings were transient and mostly observed at 6 to 12 hours postdose, with discolored areas diminishing in size as of 12 hours postdose and thereafter. Perceived pain at the injection site was minimal and temporary; no subjects perceived pain on Day 2 postdose and thereafter.

[0494] The multiple ascending dose (MAD) study consisted of 3 dosing regimen cohorts. Cohort 1 received either placebo or 25 mg administered daily for 4 days followed by a dose administered every 72 hours on Days 7, 10, and 13. Cohort 2 received either placebo or 50 mg administered daily for 7 days followed by a dose administered every 48 hours on Days 9, 11, and 13. Cohort 3 received either placebo or 100 mg administered daily for 13 days. Twenty-seven subjects (11 de novo and 16 who also participated in the SAD study) participated in the MAD study: 8 in Cohort 1, 9 in Cohort 2, and 10 in Cohort 3. One subject in Cohort 2 withdrew from the study on Day 2 due to episodes of nausea and vomiting.

[0495] Consistent with the observations from the SAD study, CTI-1601 was safe and well tolerated. Adverse events (AEs) were generally mild, brief, and self-limited, and no SAEs were observed. The most commonly observed AEs were ISRs, which were similar in nature to the ISRs observed in the SAD study and generally resolved. Other AEs that occurred in more than 1 subject included gastrointestinal complaints (nausea, vomiting, diarrhoea) and headache. These AEs occurred sporadically across the 3 cohorts, and the frequency or severity of these AEs did not change with increasing dose. One subject in Cohort 2 (50 mg) discontinued the study after the first dose because of Grade 2 nausea and Grade 1 vomiting which was considered drug related. An increase in buccal and skin cell FXN concentrations

[0496] 66

[0497] MEI 53012850v.l Atty. Docket No. 130197-01920 was observed in subjects who received 50 mg CTI-1601 daily for 7 days and 100 mg CTI- 1601 daily for 13 days.

[0498] Prior clinical studies of CTI-1601 have evaluated administration of CTI-1601 daily at doses up to 100 mg for 13 days. In addition, a Phase 2 dose exploration study has evaluated administration of 25 mg and 50 mg CTI-1601 daily for 14 days followed by every other day administration for an additional 14 days. An increase in buccal and skin cell FXN concentrations was observed in subjects who received 25 mg and 50 mg CTI-1601 daily for 14 days. Similar to the SAD and MAD studies, CTI-1601 was safe and well tolerated. Adverse events (AEs) were generally mild, brief, and self-limited, and no SAEs were observed. The most commonly observed AEs were ISRs, which were generally similar in nature to the ISRs observed in the SAD and MAD studies and typically were mild, selflimited, and brief in duration. However, approximately half of subjects experienced pruritis that lasted more than 24 hours at more than 1 injection site. Three subjects in this study experienced a generalized allergic reaction. These reactions included generalized urticaria which required medical treatment. One subject experiencing urticaria received treatment with antihistamines for several days and study drug administration was paused until the urticaria resolved. When study drug was restarted, the subject received an antihistamine prior to study drug administration and again developed urticaria as well as wheezing and shortness of breath requiring supplemental oxygen and treatment with additional antihistamines and steroids. This subject was withdrawn from the study. Another subject developed generalized urticaria which resolved 1 day after treatment with an antihistamine. The subject resumed study drug administration along with pretreatment with an antihistamine and the urticaria did not recur. The third subject developed generalized urticaria relatively late in the treatment period. Despite treatment with antihistamines and corticosteroids the urticaria had not completely resolved until after the end of the treatment period and thus this subject did not resume study drug administration.

[0499] The current study will evaluate long-term safety, tolerability, and PK as well as the effect of long-term administration of CTI-1601 on tissue FXN concentrations, pharmacodynamics (PD), and clinical measures of efficacy in patients with FRDA. This study will provide CTI- 1601 to subjects who participated in a prior CTI-1601 study as part of the clinical development program.

[0500] Rationale for the Study

[0501] 67

[0502] MEI 53012850v.l Atty. Docket No. 130197-01920

[0503] Patients with FRDA have a deficiency of FXN, a protein that is essential for mitochondrial metabolism. CTI-1601, intended to be a mitochondrial FXN replacement therapy, utilizes a cell- penetrant peptide fused to human FXN in order to deliver FXN to the mitochondria where it is presumed to be processed to mature FXN and subsequently become active in mitochondrial metabolism. The specific rationale for this OLE study is to collect long-term safety, tolerability, PK, PD, and efficacy data while allowing subjects who participated in a prior study to continue receiving CTI-1601. This study will also allow those subjects who participated in a prior study and received placebo to initiate treatment with CTI- 1601.

[0504] Safety Objectives

[0505] To evaluate the safety and tolerability of long-term SC administration of CTI-1601 in subjects with FRDA.

[0506] Efficacy Objectives

[0507] • To evaluate the effect of long-term SC administration of CTI-1601 on tissue FXN concentrations.

[0508] • To evaluate the effect of long-term SC administration of CTI-1601 on clinical evaluations of FRDA as assessed by 9-hole peg test (9-HPT), the timed 25-foot walk (T25-FW) test, the modified Friedreich’s Ataxia Rating Scale (mFARS) and upright stability subscale examinations, and the Friedreich’s Ataxia Rating Scale - Activities of Daily Living (FARS-ADL), compared to an external control group.

[0509] • To evaluate the effect of long-term SC administration of CTI-1601 on other clinical evaluations of FRDA as assessed by the Patient Global Impression of Change (PGI- C), Clinical Global Impression of Change (CGLC), Modified Fatigue Impact Scale (MFIS), Functional Staging for Ataxia, left ventricular ejection fraction (LVEF), left ventricular end-diastolic volume (LV EDV), and hemoglobin Ale (HbAlc) over time.

[0510] Pharmacokinetic and Pharmacodynamic Objectives

[0511] To evaluate the PK of long-term SC administration of CTI-1601.

[0512] 68

[0513] MEI 53012850v.l Atty. Docket No. 130197-01920

[0514] • To evaluate the effect of long-term SC administration of CTI-1601 on gene expression and selected lipids.

[0515] Study Endpoints

[0516] Safety and tolerability of CTI-1601 will be assessed using:

[0517] • Incidence and severity of TEAEs;

[0518] • Change from baseline in clinical laboratory data tests (including hematology, biochemistry, HbAlc, lipid profile, and urinalysis);

[0519] • 12-lead electrocardiogram (ECG) monitoring;

[0520] • Echocardiogram (ECHO) parameters;

[0521] • Change from baseline in vital signs (VS);

[0522] • Physical examinations; and

[0523] • Responses to the Columbia Suicide Severity Rating Scale (C-SSRS).

[0524] Efficacy Endpoints

[0525] Efficacy of CTI-1601 will be assessed using:

[0526] • Change from baseline at each collection timepoint in tissue FXN concentrations normalized to total protein observed in buccal cells collected from cheek swabs, and skin cells collected from skin punch biopsies;

[0527] • Motor function as assessed by the 9-HPT

[0528] • Neurologic function as assessed by the mFARS total score;

[0529] • Motor function as assessed by the T25-FW test (for those who can perform this test);

[0530] • Neurological function as assessed by the mFARS and upright stability subscale examinations;

[0531] ADLs reported by the subject or caregiver as assessed by the FARS-ADL;

[0532] 69

[0533] MEI 53012850v.l Atty. Docket No. 130197-01920

[0534] Change from baseline in the total fatigue score and all the subscales score as assessed by the MFIS;

[0535] • Assessment of disease as assessed by the Functional Staging for Ataxia;

[0536] • Overall impression of change as assessed by the subject using the PGI-C scale;

[0537] • Overall impression of change as assessed by the clinician using the CGI-C scale;

[0538] • Cardiac function as assessed by LVEF and LV EDV obtained from an ECHO; and

[0539] • HbAlc laboratory results.

[0540] Pharmacokinetic Endpoints

[0541] Blood samples for population PK analyses will be collected at specified timepoints. Samples will be analyzed for plasma levels of CTI-1601 using a validated bioanalytical method. The date / time will be recorded for each sample as will the date / time of every dose of study drug.

[0542] Blood will be drawn at the following timepoints:

[0543] • Days 1, 30, 60, and 90: predose (within 1 hour prior to dose administration), 5, 15, and 30 minutes, and 1, 2, 4, 6, and 8 hours (serial PK) after the dose.

[0544] • Day 180: Predose (within 1 hour prior to dose administration) and at 5 and 15 minutes after the dose.

[0545] • Days 270, 360, & every 3 months (Q3M) thereafter: predose (within 1 hour prior to dose administration).

[0546] • Early Termination (ET) or study Termination (ST) visit: Study drug administration will not occur at the ET or ST visit. The PK sample should be drawn at roughly the same time predose PK samples were drawn during previous visits. If ET or ST visit occurs later than 30 hours after the last dose administered, the PK sample will not be collected.

[0547] The PK endpoints will include but not be limited to the following PK parameters during a dosing interval:

[0548] 70

[0549] MEI 53012850v.l Atty. Docket No. 130197-01920

[0550] AUCo-t: area under the concentration-time curve from time 0 to the time of last quantifiable concentration;

[0551] • CmaX: maximum observed concentration

[0552] • TmaX: time of maximum observed concentration

[0553] • Ctrough: concentration reached immediately before the next dose is administered.

[0554] Pharmacodynamic

[0555] Assessments of potential biomarkers will be performed by measuring changes from prestudy baselines in gene expression and specialized lipids. PD assessments are the following:

[0556] • Gene expression levels in buccal cells collected from cheek swabs; and

[0557] • Lipids in plasma derived from whole blood.

[0558] Anti-drug Antibodies

[0559] Anti-drug antibodies (ADAs) to CTL1601 will be measured.

[0560] Study Design

[0561] All subjects will receive CTL1601 in this study. To provide for a surrogate placebo comparator group, an external control group will be constructed from data collected from participants in the Friedreich’s Ataxia Clinical Outcome Measures Study (FACOMS), a natural history study for FRDA that collects information from an annual evaluation that includes the mFARS and upright stability subscale examinations, the T25-FW test, and the 9- HPT, if enough data are available from the natural history study.

[0562] Subjects who complete a prior study of CTI-1601, regardless of whether the subject took CTI-1601 or placebo, will be eligible to participate in this study unless the subject experienced one or more of the following in a previous CTI-1601 study:

[0563] SAE related to study drug;

[0564] 71

[0565] MEI 53012850v.l Atty. Docket No. 130197-01920

[0566] Significant AE, defined as Grade 3 or higher according to the CTCAE, Version 5.0 or higher, related to study drug;

[0567] • Some other event, related to participation in a previous study with CTI-1601, that supports the exclusion of the subject from participating in this study as determined by the sponsor (i.e., an AE considered clinically significant by the sponsor regardless of whether it met SAE criteria and regardless of CTCAE grade); and

[0568] • Withdrawal from participation in a previous study of CTI-1601 for any reason.

[0569] A subject will not be screened until all assessments pertaining to the prior study have been completed.

[0570] Concomitant use of omaveloxolone (an approved treatment for patients with FRDA) will be permitted in this study. Subjects who are currently receiving omaveloxolone or intend to receive omaveloxolone must either receive CTI-1601 for 6 months prior to their first dose of omaveloxolone or receive omaveloxolone for 6 months prior to their first dose of CTI-1601. Subjects already receiving omaveloxolone must provide documentation of their first pharmacy fulfillment date for omaveloxolone. This date will be used as the start date.

[0571] If the omaveloxolone fulfillment date is greater than or equal to 6 months relative to their estimated Day 1 visit for this study, the subjects will proceed with the screening assessments described beginning with Day -42. If the omaveloxolone fulfillment date is less than 6 months relative to their estimated Day 1 visit for this study, the subject will participate in a screening period of up to 6 months. This will include monthly calls from study staff to collect information on AEs and ongoing medications until 2 months prior to initiating treatment with CTI 1601. Subjects will then proceed with the Screening visit described for Day -30. Subjects who are not receiving omaveloxolone at the Screening visit for this study will not be permitted to use omaveloxolone concomitantly until after they have completed 6 months of treatment with CTI-1601. Subjects will proceed with the screening assessments described beginning with Day -42.

[0572] Screening assessments will be performed by a combination of on-site and telehealth (TH) visits. On-site Screening assessments (safety laboratory tests, the physical examination, ECG, and ECHO), must be completed with results available within 30 days of Day 1. In addition, a TH visit will be completed within approximately 2 weeks of the Day - 1 visit. A

[0573] 72

[0574] MEI 53012850v.l Atty. Docket No. 130197-01920 freezer and study drug will be sent to the subject prior to the subject traveling to the site for the Day -1 visit. At the Day 1 visit, the study site or a trained subject / caregiver will prepare and administer the first dose of CTI-1601 to eligible subjects. Subjects will receive training to self-administer CTI-1601 SC if the subject has the dexterity and visual acuity to perform SC injections; otherwise, a caregiver committed to preparing and administering the injections will be trained. A back-up caregiver(s) may also be trained. Anatomic areas used as injection sites will be assessed at each scheduled visit and any associated AEs will be recorded as appropriate.

[0575] Subject safety will be assessed monthly via remote contact (TH) or OS clinic visits for the duration of the study. Most of the efficacy assessments will be completed Q3M starting at Day 90. Two Follow-up visits (after a subject discontinues study drug entirely will be performed by a visiting nurse 7 days and 30 days post last dose with a window of +3 days. All visits will occur at the study site except for the TH visits (which will occur between onsite visits) and the Follow-up visits completed by the visiting nurse and by study site staff via TH.

[0576] Study drug (CTI-1601) will be administered SC QD. The concentration of the CTI- 1601 dose formulation for SC injection is 50 mg / mE. The dose planned for this study (25 mg) appears to have been safe and well tolerated in patients with FRDA who participated in previous clinical studies.

[0577] Study Drug

[0578] CTI-1601 is a recombinant fusion protein consisting of a cell penetrant peptide linked to the complete FXN protein. CTI-1601 will be provided in liquid form in a 2.0 mL vial with each vial containing 1.25 mL of product at a concentration of 50 mg / mL. CTI-1601 contains the following excipients: histidine, sucrose, polysorbate 20, and sterile water. CTI-1601 will be administered SC QD, via syringe filled by trained subject / caregiver to contain the appropriate amount to be administered.

[0579] Study drug (25 mg CTI-1601) administration will occur QD at approximately the same time in the morning on each dosing day.

[0580] 73

[0581] MEI 53012850v.l Atty. Docket No. 130197-01920

[0582] Efficacy Assessments

[0583] Friedreich ’s Ataxia Rating Scale

[0584] The FARS comprises a functional disability measure of ataxia, an ADL scale, and a neurological rating scale. This study will only focus on 2 subscores derived from the full FARS questionnaire: mFARS (and its upright stability subcomponent) and FARS-ADE. The mFARS is a modified FARS neurological rating scale involving direct subject participation and targets specific areas impacted by FRDA (bulbar, upper limb, lower limb, and upright stability), with scores ranging from 0 to 93 points, with higher scores indicating a greater level of disability. The mFARS excludes subscale D (peripheral nervous system) and the first 2 questions of subscale A (bulbar) from the neurological rating scale of the FARS questionnaire.

[0585] The FARS_ADL score is a FARS rating scale assessing subject ability to complete ADLs (e.g., speech, cutting food, dressing, and personal hygiene), with scores ranging from 0 to 36 points, with higher scores indicating more impairment when completing ADLs. The respondent options are 1) the subject; 2) a combination of the subject and family; or 3) family member or spouse or caregiver for those subjects unable to complete the test. The respondent must be the same throughout the subject’s participation in the trial.

[0586] The 9-Hole Peg Test (9-HPT)

[0587] The 9-HPT is a quantitative measure of upper extremity (arm and hand) function. Its use with multiple sclerosis (MS) subjects was first reported in 1988, and it has seen increasing use in MS clinical trials as part of the Multiple Sclerosis Functional Composite (MSFC) score as well as in FACOMS and clinical practice. Both the dominant and nondominant hands will be tested twice (2 consecutive trials of the dominant hand, followed immediately by 2 consecutive trials of the nondominant hand). All 4 trials must be performed.

[0588] Timed 25-Foot Walk Test (T25-FW)

[0589] The T25-FW test is a quantitative measure of lower extremity function. The T25-FW was incorporated as part of a composite score for MS in 1996 as a recommendation by the

[0590] 74

[0591] MEI 53012850v.l Atty. Docket No. 130197-01920

[0592] National MS Society Clinical Outcomes Assessment Task Force. It has seen increased use in MS clinical trials as part of the MSFC score, as well as in FACOMS and clinical practice.

[0593] The T25-FW test will be performed by those who can complete it, with or without assistive devices. Those subjects requiring the use of a self-propelled wheelchair will be excluded from performing the test at the Baseline (Day -1) visit and subsequent visits during the study. It is possible that some subjects may be able to perform the test at the beginning of the study and then subsequently lose the ability to do so. The T25-FW test will be performed twice (once in each direction). The timing component will be measured to a tenth of a second.

[0594] Patient Global Impression of Severity and of Change

[0595] The PGI-S is a question that requires the subject to rate the severity of their condition. The PGI-C is a question depicting a subject’s rating of their overall improvement from baseline with study drug.

[0596] Clinical Global Impression of Severity and of Change

[0597] The CGI-S is a question that requires the clinician to rate the severity of the subject’s condition. The CGI-C is a question intended to measure change in clinical status (symptoms and functional ability) of the subject’s condition from Baseline with study drug.

[0598] Functional Staging for Ataxia

[0599] Functional Staging for Ataxia will be completed by the PI (or trained subinvestigator). The responses range from normal (Stage 0) to confined to a wheelchair or bed with total dependency for all activities of daily living (Stage 6.0). Increments of 0.5 are permitted.

[0600] Modified Fatigue Impact Scale (MFIS)

[0601] The MFIS is a modified form of the Fatigue Impact Scale based on items derived from interviews with MS patients concerning how fatigue impacts their lives. This instrument provides an assessment of the effects of fatigue in terms of physical, cognitive, and psychosocial functioning. The full-length MFIS consists of 21 items. The MFIS is a structured, self-report questionnaire that the patient can generally complete with little or no intervention from an interviewer. However, patients with visual or upper extremity

[0602] 75

[0603] MEI 53012850v.l Atty. Docket No. 130197-01920 impairments may need to have the MFIS administered as an interview. Interviewers should be trained in basic interviewing skills and in the use of this instrument. The total score for the MFIS is the sum of the scores for the 21 items. Individual subscale scores for physical, cognitive, and psychosocial functioning can also be generated by calculating the sum of specific sets of items.

[0604] Left Ventricular Ejection Fraction and Left Ventricular End-Diastolic Volume

[0605] ECHO data will be collected to assess cardiac function for purposes of safety surveillance. Changes in LVEF and LV EDV will also be evaluated over time as an efficacy endpoint.

[0606] Hemoglobin Ale

[0607] Hemoglobin Ale will be collected. Changes in HbAlc will be evaluated as a safety endpoint as well as an efficacy endpoint.

[0608] Pharmacokinetic Procedures

[0609] Blood samples will be collected to measure plasma concentrations of CTI-1601. Actual PK blood sample collection times versus time of dosing will be monitored and recorded.

[0610] Measures will be assessed to quantify tissue FXN concentrations as well as potential biomarkers. Specimen analyses for FXN concentrations and gene expression will be completed using buccal cells obtained from cheek swabs. Skin cells obtained from skin punch biopsy procedures will assess FXN concentrations. Plasma separated from blood will assess specialized lipids.

[0611] Two buccal swab systems will be used to collect cells for protein quantitation and gene expression characterization, respectively. Samples will be harvested; 1 sample from the left cheek for protein concentration and 1 sample from the right cheek for gene expression. Samples will be immediately stabilized according to purpose and the swab system manufacturer’s directions.

[0612] 76

[0613] MEI 53012850v.l Atty. Docket No. 130197-01920

[0614] Blood will be used to measure changes in specialized lipids composition. Samples will be prepared and immediately stabilized. Subjects must stop eating and drinking, except for water, 10 hours prior to PD blood lipid collections.

[0615] Subjects will undergo skin cell collection procedures. The method of collection will be a skin punch biopsy. A sample 4 mm in diameter and full thickness will be harvested from an area per the investigator’s discretion and discussion with the subject. The specimen will be immediately stabilized. The specimen will be used to measure protein concentration.

[0616] Topline Results

[0617] At the time of data cut off for this open label extension (OLE study), 14 adults with FRDA were included with up to 260 days of long-term daily treatment with 25 mg of CTI- 1601. Among these patients, 57% were nonambulatory, and the subjects were > 18 years old. The median tissue frataxin level at baseline was 1.13 pg / pg and 2.41 pg / g in buccal and skin cells, respectfully.

[0618] Safety

[0619] CTI-1601 was generally well tolerated with two serious adverse events which were resolved in 24 hours. Most common adverse events were mild and moderate injection site reactions.

[0620] Clinical Outcomes

[0621] The results of clinical assessments for 8 subjects at Day 90 following daily administration of 25 mg of CTI-1601 are presented in Table 5 below.

[0622] Table 5. Results of clinical assessments at Day 90 following daily administration of 25 mg of CTI-1601

[0623] 77

[0624] MEI 53012850v.l Atty. Docket No. 130197-01920

[0625] The results of clinical assessments presented in Table 5 indicate early trends toward improvement across clinical outcomes at Day 90 following daily administration of 25 mg of CTI-1601. Frataxin Levels

[0626] Figure 20 is a graph showing frataxin levels (pg / .g of total protein) in skin cells measured at baseline, at Day 30 and Day 90 following daily administration of 25 mg of CTI- 1601. The dotted line indicates frataxin levels that are 50% of the frataxin levels in healthy volunteers. Figure 21 is a graph showing change from baseline in frataxin levels (pg / .g of total protein) in skin cells measured at Day 30 and Day 90 following daily administration of 25 mg of CTI-1601.

[0627] Figure 22 is a graph showing frataxin levels (pg / .g of total protein) in buccal cells measured at baseline, at Day 30, Day 60 and Day 90 following daily administration of 25 mg of CTI-1601. The dotted line indicates frataxin levels that are 50% of the frataxin levels in healthy volunteers.

[0628] Figure 23 is a graph showing change from baseline in frataxin levels (pg / .g of total protein) in buccal cells measured at Day 30, Day 60 and Day 90 following daily administration of 25 mg of CTI-1601.

[0629] 78

[0630] MEI 53012850v.l Atty. Docket No. 130197-01920

[0631] The median tissue frataxin levels at Day 90 were 1.89 pg / |ig in buccal cells and 7.65 pg / |ig in skin cells. The median and mean absolute frataxin levels measured in buccal cells and skin cells are also shown in Table 6 below.

[0632] Table 6. Median frataxin levels in buccal cells and skin cells measured following daily administration of 25 mg CTI-1601

[0633] IQR: Interquartile range (P25th, P75th)

[0634] NC: Skin biopsies were not collected on Day 60 per the protocol Figure 24 shows increase in frataxin levels in buccal cells as a percentage of average frataxin levels in healthy volunteers at baseline, Day 30, Day 60 and Day 90 following daily administration of 25 mg of CTI-1601. The average baseline FXN levels in buccal cells were <15% of the average of healthy volunteers. After daily dosing for 90 days, average FXN levels increased to 30%. Figure 25 shows increase in frataxin levels in skin cells as a percentage of average frataxin levels in healthy volunteers at baseline, Day 30 and Day 90 following daily administration of 25 mg of CTI-1601. The average baseline FXN levels in skin cells were <16% of the average of healthy volunteers. After daily dosing for 90 days, average FXN levels increased to 72%.

[0635] 79

[0636] MEI 53012850v.l Atty. Docket No. 130197-01920

[0637] Figure 26 is a schematic showing the number of subjects who had a shift in their frataxin levels in buccal cells as a percentage of frataxin levels of healthy volunteers following 30 days, 60 days or 90 days of daily dosing with the TAT-FXN fusion protein.

[0638] Figure 27 is a schematic showing the number of subjects who had a shift in their frataxin levels in skin cells as a percentage of frataxin levels of healthy volunteers following 30 days, or 90 days of daily dosing with the TAT-FXN fusion protein.

[0639] Daily administration of 25 mg of CTI-1601 increased and maintained tissue frataxin levels over time, reaching 30 % and 72% of the frataxin leves in healthy volunteers at day 90 in buccal and skin cells, respectfully. Tissue FXN levels appear to reach steady- state levels by 30 days in buccal cells.

[0640] The pharmacokinetic data indicates that there is quick absorption of CTI-1601 after subcutaneous administration. Dosing appeared to reach steady-state by 14 days with no further accumulation.

[0641] Example 5. An Open-Label Extension Study to Assess the Long-term Safety, Efficacy, Pharmacodynamics, Pharmacokinetics, and Tolerability of Subcutaneous TAT-FXN Fusion Protein in Subjects with Friedreich’s Ataxia

[0642] Study Protocol

[0643] A. Background Information

[0644] See the section entitled “Background Information” for Example 4.

[0645] TAT-FXN Fusion Protein - Clinical Information

[0646] See the section entitled “TAT-FXN Fusion Protein - Clinical Information” for Example 4.

[0647] In this ongoing open-label extension (OLE) study (CLIN- 1601-201) described in Example 4, 1 subject developed acute anaphylaxis 30 minutes after receiving the first dose of CTI-1601 on Day 1. This subject was withdrawn from the study and did not receive any more doses of CTI-1601. Another subject who had received approximately 44 days of CTI- 1601 dosing had a brief seizure less than a minute after receiving a dose of CTL1601. The

[0648] 80

[0649] MEI 53012850v.l Atty. Docket No. 130197-01920 seizure ended within 2 minutes, and the subject was admitted to the hospital. No more seizures were observed, and the subject was discharged a few days later. The subject chose to withdraw from the study.

[0650] B. Rationale for the Study

[0651] See the section entitled “Rationale for the Study” for Example 4.

[0652] C. Study Objectives

[0653] Primary Objective

[0654] To evaluate the effect of long-term SC administration of CTI-1601 on tissue FXN concentrations.

[0655] Secondary Obiectives

[0656] To evaluate the effect of long-term subcutaneous (SC) administration of CTI-1601 on clinical evaluations of FRDA, compared to an external group, as assessed by:

[0657] • Modified Friedreich’s Ataxia Rating Scale (mFARS) and upright stability subscale examinations;

[0658] • 9-hole peg test (9-HPT);

[0659] • Timed 25-foot walk (T25-FW) test;

[0660] • Friedreich’s Ataxia Rating Scale- Activities of Daily Diving (FARS_ADL);

[0661] To evaluate the effect of long-term SC administration of CTI-1601 on other clinical evaluations of FRDA as assessed by:

[0662] • Modified Fatigue Impact Scale (MFIS);

[0663] • Functional Staging for Ataxia;

[0664] • Patient Global Impression of Change (PGI-C);

[0665] • Clinical Global Impression of Change (CGI-C);

[0666] • Deft ventricular ejection fraction (LVEF);

[0667] • EV end-diastolic volume (EDV);

[0668] • LV mass;

[0669] LV mass index (EVMi); and

[0670] 81

[0671] MEI 53012850v.l Atty. Docket No. 130197-01920

[0672] • Hemoglobin Ale (HbAlc).

[0673] To evaluate the safety and tolerability of long-term SC administration of CTI-1601 in subjects with FRDA.

[0674] To evaluate the PK of long-term SC administration of CTI-1601.

[0675] • To characterize the immunogenicity of long-term SC administration of CTI-1601; and

[0676] • To evaluate the effect of long-term SC administration of CTI-1601 on gene expression and selected lipids.

[0677] I). Study Endpoints

[0678] Primary

[0679] Change from baseline at each collection timepoint in tissue FXN concentrations normalized to total protein (tissue FXN ratio) observed in:

[0680] • Buccal cells collected from cheek swabs; and

[0681] • Skin cells collected from skin punch biopsies.

[0682] Secondary

[0683] • Change from baseline in the mFARS and upright stability subscale examinations;

[0684] • Change from baseline in the 9-HPT;

[0685] • Change from baseline in the T25-FW test;

[0686] • Change from baseline in the FARS-ADL;

[0687] • Change from baseline in the MFIS;

[0688] • Change from baseline in Functional Staging for Ataxia;

[0689] • Overall impression of change as assessed by the subject using the PGI-C;

[0690] • Overall impression of change as assessed by the clinician using the CGI-C;

[0691] • Observed and change from baseline in LVEF, LV EDV, LV mass, and LVMi obtained from echocardiogram (ECHO);

[0692] • Observed and change from baseline in HbAlc laboratory results;

[0693] 82

[0694] MEI 53012850v.l Atty. Docket No. 130197-01920

[0695] • Number of AEs, TEAEs, study drug-related TEAEs, Grade 3 / 4 TEAEs, and SAEs;

[0696] • Change from baseline in clinical laboratory tests;

[0697] • Observed and change from baseline in electrocardiogram (ECG) parameters;

[0698] • Observed and change from baseline in ECHO parameters;

[0699] • Observed and change from baseline in vital signs (VS);

[0700] • Number of subjects with abnormal physical examination parameters;

[0701] • Number of subjects who experience Suicidal Ideation and / or Suicidal Behavior based on the C-SSRS;

[0702] • PK parameters during a dosing interval including, but not limited to, the following:

[0703] AUCo-t: Area under the concentration-time curve from time 0 to the time of last quantifiable concentration;

[0704] CmaX: Maximum observed concentration;

[0705] TmaX: Time of maximum observed concentration; and

[0706] Ctrough: Concentration reached immediately before the next dose is administered.

[0707] • Change from baseline in gene expression in buccal cells collected from cheek swabs;

[0708] • Change from baseline in lipids in plasma derived from whole blood; and

[0709] • Incidence of anti-drug antibodies (ADAs) to CTI-1601.

[0710] E. Study Design

[0711] All subjects will receive CTI-1601 in this study. To provide for a surrogate placebo comparator group, an external control group will be constructed from data collected from participants in the Friedreich’s Ataxia Clinical Outcome Measures Study (FACOMS), a natural history study for FRDA that collects information from an annual evaluation that includes the mFARS and upright stability subscale examinations, the T25-FW test, FARS- ADL, and the 9-HPT, if enough data are available from the natural history study.

[0712] 83

[0713] MEI 53012850v.l Atty. Docket No. 130197-01920

[0714] Subjects who complete a prior study of CTI-1601, regardless of whether the subject took CTI-1601 or placebo, will be eligible to participate in this study unless the subject experienced one or more of the following in a previous CTI-1601 study:

[0715] • SAE related to study drug;

[0716] • Significant AE, defined as Grade 3 or higher according to the CTCAE, Version 5.0 or higher, related to study drug;

[0717] • Some other event, related to participation in a previous study with CTI-1601, that supports the exclusion of the subject from participating in this study as determined by the sponsor (i.e., an AE considered clinically significant by the sponsor regardless of whether it met SAE criteria and regardless of CTCAE grade);

[0718] • Withdrawal from participation in a previous study of CTI-1601 for any reason

[0719] A subject will not be screened until all assessments pertaining to the prior study have been completed.

[0720] Concomitant use of omaveloxolone (an approved treatment for patients with FRDA) will be permitted in this study. Subjects who are currently receiving omaveloxolone or intend to receive omaveloxolone must either receive CTI-1601 for 6 months prior to their first dose of omaveloxolone or receive omaveloxolone for 6 months prior to their first dose of CTI-1601. Subjects already receiving omaveloxolone must provide documentation of their first pharmacy fulfillment date for omaveloxolone. This date will be used as the start date.

[0721] • If the omaveloxolone fulfillment date is greater than or equal to 6 months relative to their estimated Day 1 visit for this study, the subjects will proceed with the screening assessments described beginning with Day -42.

[0722] • If the omaveloxolone fulfillment date is less than 6 months relative to their estimated Day 1 visit for this study, the subject will participate in a screening period of up to 6 months. This will include monthly calls from study staff to collect information on Aes and ongoing medications until 2 months prior to initiating treatment with CTI 1601. Subjects will then proceed with the Screening visit described for Day -30.

[0723] Subjects who are not receiving omaveloxolone at the Screening visit for this study will not be permitted to use omaveloxolone concomitantly until after they have completed 6 months of treatment with CTI-1601. Subjects will proceed with the screening assessments described beginning with Day -42.

[0724] 84

[0725] MEI 53012850v.l Atty. Docket No. 130197-01920

[0726] Screening assessments will be performed by a combination of on-site and telehealth (TH) visits. On-site Screening assessments (safety laboratory tests, physical examination, ECG, and ECHO) must be completed with results available within 30 days of Day 1. In addition, a TH visit will be completed within approximately 2 weeks of the Day - 1 visit. A freezer and study drug will be sent to the subject prior to the subject traveling to the site for the Day -1 visit. At the Day 1 visit, the study site or a trained subject / caregiver will prepare and administer the first dose of CTI-1601 to eligible subjects. Subjects will receive training to self-administer CTI-1601 SC if the subject has the dexterity and visual acuity to perform SC injections; otherwise, a caregiver committed to preparing and administering the injections will be trained. A back-up caregiver(s) may also be trained. Anatomic areas used as injection sites will be assessed at each scheduled visit and any associated AEs will be recorded as appropriate.

[0727] Subject safety will be assessed monthly via remote contact (TH) or on-site clinic visits for the duration of the study. Most of the efficacy assessments will be completed every 3 months (Q3M) starting at Day 90. Two Follow-up visits (after a subject discontinues study drug entirely [see below]) will be performed by a visiting nurse 7 days and 30 days post last dose with a window of + 3 days. All visits will occur at the study site except for the TH visits (which will occur between on-site visits), and the Follow-up visits will be completed by the visiting nurse and by study site staff via TH.

[0728] At the initiation of the OLE study described in Example 4, CTI-1601 25 mg was administered SC QD each morning starting on Day 1. Under this amended protocol, CTI- 1601 50 mg will be administered SC QD each morning based on the subject’s status below:

[0729] • New subjects enrolled and subjects currently in screening who have not had their Day 1 visits will initiate dosing with CTI-1601 50 mg administered SC QD each morning.

[0730] • Subjects receiving CTI-1601 25 mg for < 60 days will initiate dosing with CTI-1601 50 mg during the Day 60 on-site visit.

[0731] • Subjects receiving CTI-1601 25 mg for > 60 days but < 90 days will initiate dosing with CTI-1601 50 mg during the Day 90 on-site visit.

[0732] • Subjects receiving CTI-1601 25 mg for > 90 days will initiate dosing with CTI-1601 50 mg either at the next scheduled on-site visit or at an additional on-site visit approximately 30 days prior to the next scheduled on-site visit.

[0733] 85

[0734] MEI 53012850v.l Atty. Docket No. 130197-01920

[0735] For subjects transitioning from CTI-1601 25 mg to CTI-1601 50 mg, safety laboratory evaluations (blood samples for hematology and chemistry) will be performed approximately 14 days after initiating CTI-1601 50 mg.

[0736] Study drug (CTI-1601) will be administered SC QD. The concentration of the CTI- 1601 dose formulation for SC injection is 50 mg / mL. The dose planned for this study appears to have been safe and well tolerated in patients with FRDA who participated in previous clinical studies.

[0737] F. Study Drug

[0738] CTI-1601 is a recombinant fusion protein consisting of a cell penetrant peptide linked to the complete FXN protein. CTI-1601 will be provided in liquid form in a 2.0 mL vial with each vial containing 1.25 mL of product at a concentration of 50 mg / mL. CTI-1601 contains the following excipients: histidine, sucrose, polysorbate 20, and sterile water.

[0739] CTI-1601 will be administered SC QD, via syringe filled by trained subject / caregiver to contain the appropriate amount to be administered.

[0740] Study drug (50 mg CTI-1601) administration will occur QD at approximately the same time in the morning on each dosing day.

[0741] G. Study Evaluations and Procedures

[0742] See section entitled “Study Evaluations and Procedures” in Example 4.

[0743] II. Topline Results

[0744] At the time of data cut off for this OLE study, 39 participants in the OL study had received at least one dose of CTI-1601 and 25 participants were receiving daily dosing of CTI-1601 for up to 527 days (mean 154 days). This includes the time from the initial dose of 25 or 50 mg to the last dose of CTI-1601 prior to the data cut off. Among the study participants, approximately 50% were non-ambulatory at baseline.

[0745] Safety

[0746] In participants receiving long term continuous treatment, including 14 participants on CTI-1601 for at least 6 months, 8 of whom continue to be on CTI-1601 for over 1 year, daily administration of CTI-1601 was generally well-tolerated. Most common adverse events continue to be local injection site reactions that were mild to moderate and did not lead to any

[0747] 86

[0748] MEI 53012850v.l Atty. Docket No. 130197-01920 participant withdrawal from the study. 65 patients have received at least one dose of CTI- 1601 in 4 completed studies and the ongoing OL study.

[0749] Frataxin Levels

[0750] Increases in skin FXN levels were observed with long-term daily CTI-1601, as summarized in Table 7 below and shown in Figure 28. All of ten participants with data at 6 months achieved skin FXN levels over 50% of the median levels in healthy volunteers, which is similar to levels in asymptomatic carriers, as shown in Table 8 below and in Figure 29.

[0751] Table 7. Observed Increases in FXN with Long-term Daily CTI-1601 in All Participants

[0752] FXN = frataxin; IQR = interquartile range

[0753] Note: Median skin FXN levels in Larimar’s noninterventional healthy volunteer study= 16.34 pg / g: * Data include all participants with quantifiable FXN levels at each measurement point who had received 25 mg, 50 mg or had the dose increased from 25 mg to 50 mg

[0754] Table 8. All Participants who Received CTI-1601 for 6 months Achieved Skin FXN Levels Similar to Levels Found in Asymptomatic Carriers without Disease

[0755] *Data include all participants with quantifiable FXN levels at each measurement point who had received 25 mg, 50 mg or had the dose increased from 25 mg to 50 mg ; **8.2 pg / pg represents 50% of the median FXN concentration

[0756] Clinical Outcomes

[0757] Consistent directional improvement was observed across 4 key clinical outcomes. Trends towards improvement were observed in modified Friedreich Ataxia Rating Scale (mFARS), FARS-Activities of Daily Living (ADL), 9 Hole Peg Test (9-HPT), and Modified

[0758] 87

[0759] MEI 53012850v.l Atty. Docket No. 130197-01920

[0760] Fatigue Impact Scale (MFIS) at 1 year relative to baseline. These clinical findings support that FXN increases after treatment with CTI-1601 may lead to a potential clinical benefit across a broad spectrum of patients with FA, including those with advanced disease

[0761] The results of the OL study clinical data relative to FA natural history study data supports the potential for clinical benefit with CTI-1601. Friedreich’s Ataxia Clinical Outcome Measures Study (FACOMS), a longitudinal natural history study (N = 955), includes patients with confirmed FA diagnosis. Based on the range of baseline characteristics of participants in the OL study, Larimar identified patients from the FACOMS dataset with similar characteristics using data recorded over the last 4 years for each patient. mFARS has been used as a primary outcome measure in other clinical trials. OL study participants treated for 1 year with CTI-1601 daily demonstrated a median improvement in mFARS score of 2.25 relative to a worsening of 1.00 observed in patients in the FACOMS reference population. Directional improvements in the other three clinical outcomes (FARS- ADL, 9-HPT, MFIS) were also observed in OL study participants, while worsening in these outcomes was observed in the FACOMS reference population. The results of these clinical assessments are presented in Table 9 below.

[0762] Table 9. Results of clinical assessments at 1 year following daily administration of CTI- 1601

[0763] IQR = interquartile rangeaMFIS presented here is at 2 years because it was not assessed at 1 year

[0764] Pharmacokinetics

[0765] The long-term pharmacokinetic profile observed was consistent with prior studies. Rapid absorption was observed after subcutaneous administration. Exposure appeared to reach steady state in plasma by Day 30 at both the 25 mg and 50 mg doses with no further accumulation. The pharmacokinetic profile is consistent with Phase 1 and Phase 2 studies.

[0766] 88

[0767] MEI 53012850v.l Atty. Docket No. 130197-01920

[0768] Example 6. A Phase 1 Study to Assess the Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of Subcutaneous CTI-1601 in Adolescents and Children with Friedreich’s Ataxia

[0769] Study Protocol

[0770] Background Information

[0771] Friedreich’s ataxia (FRDA) is the most common inherited ataxia in humans and results from a deficiency of the mitochondrial protein, frataxin (FXN). FRDA is a rare progressive multisystem disease with an incidence that is estimated to be 1:29,000, and a carrier frequency of -1:85. In the United States (US), there are an estimated 4,000 to 5,000 cases, primarily in Caucasians of European descent, with an equal frequency in men and women. The age of onset may be as early as 2 years of age but may vary considerably. However, the age of diagnosis typically occurs approximately 2 years after the age of onset. Because the range of normal variation in coordination and agility is wide prior to 7 years of age, it is difficult to detect symptoms of ataxia in children less than 7 years of age.

[0772] Patients with FRDA suffer from multiple symptoms, including progressive neurologic and cardiac dysfunction. A key feature of FRDA is the primary neurodegeneration of the dorsal root ganglia and the dentate nucleus of the cerebellum leading to the hallmark clinical findings of progressive limb ataxia and dysarthria. Hypertrophic cardiomyopathy is common and associated with early mortality in the 3rd to 5th decade of life. Other clinical findings can include scoliosis, fatigue, diabetes, visual impairment, and hearing loss.

[0773] Inheritance of FRDA is autosomal recessive and is predominantly caused by an inherited guanine adenine adenine (GAA) triplet expansion in the first intron of both alleles of the FXN gene. This triplet expansion causes transcriptional repression of the FXN gene, so patients produce only small quantities of FXN. There is some correlation between GAA repeat number and the onset and severity of clinical symptoms, with higher repeat numbers associated with earlier onset and more severe disease. Hetero zygotes (carriers) typically have FXN levels at ~ 50% of normal individuals but are phenotypically normal. The FXN levels in whole blood in both heterozygotes and in FRDA patients have been shown to be stable over time.

[0774] 89

[0775] MEI 53012850v.l Atty. Docket No. 130197-01920

[0776] CTI-1601 is being developed as a novel, specific treatment to supplement FXN levels in mitochondria of adults and children with FRDA. Currently, there is no approved FXN replacement therapy available for the treatment of FRDA. The only approved treatment for FRDA approved by the US FDA is omaveloxolone, which targets oxidative stress and does not address low levels of FXN, the core deficit of FRDA.

[0777] CTI-1601, intended to be a mitochondrial FXN replacement therapy, is a recombinant fusion protein and is intended to deliver FXN, the protein deficient in FRDA, to the mitochondria where it is intended to increase mitochondrial levels of FXN and restore normal mitochondrial function in patients with FRDA.

[0778] Clinical Information

[0779] CTI-1601 administered SC in a single dose was well tolerated at doses of 25, 50, 75, and 100 mg in the single ascending dose (SAD) study, CLIN- 1601-101. Twenty-eight (28) subjects participated in the SAD study, as follows: 6 in Cohort 1; 7 in Cohort 2; 8 in Cohort 3, and 7 in Cohort 4. Most treatment-emergent adverse events (TEAEs) were CTCAE Grade 1 and 2 in severity. There were no fatal events or serious adverse events (SAEs) reported in this study.

[0780] Injection site reactions (ISRs), (all Grade 1 in severity) were the most commonly reported types of TEAEs, reported in all (100%) subjects treated with CTI-1601, whereas these events were much less frequent (10%) in subjects who received placebo. The majority of TEAEs of ISRs occurred on the day of study drug administration and were considered related to study drug; most of these events resolved on the same day of onset.

[0781] The incidence of injection site findings, including discoloration, tenderness, ecchymosis, and scratch marks, was higher (56%) in CTI-1601 treated subjects compared to none in placebo subject. The most common finding was tenderness, reported in 39% of all treated subjects, more frequently reported in subjects treated at a dose of 75 mg. Discoloration was only reported in 17% of all treated subject and only reported in subjects treated at 100 mg. Injection site findings were transient and mostly observed at 6 to 12 hours postdose, with discolored areas diminishing in size as of 12 hours postdose and thereafter. Perceived pain at the injection site was minimal and temporary; no subjects perceived pain on Day 2 postdose and thereafter.

[0782] 90

[0783] MEI 53012850v.l Atty. Docket No. 130197-01920

[0784] The multiple ascending dose (MAD) study consisted of 3 dosing regimen cohorts. Cohort 1 received either placebo or 25 mg administered daily for 4 days followed by a dose administered every 72 hours on Days 7, 10, and 13. Cohort 2 received either placebo or 50 mg administered daily for 7 days followed by a dose administered every 48 hours on Days 9, 11, and 13. Cohort 3 received either placebo or 100 mg administered daily for 13 days.

[0785] Twenty-seven subjects (11 de novo and 16 who are also participated in the SAD study) participated in the MAD study, as follows: 8 in Cohort 1, 9 in Cohort 2, and 10 in Cohort 3. One subject in Cohort 2 withdrew from the study on Day 2 due to episodes of nausea and vomiting.

[0786] Consistent with the observations from the SAD study, CTI-1601 was safe and well tolerated. Adverse events (AEs) were generally mild, brief, and self-limited, and no SAEs were observed. The most commonly observed AE was ISRs, which were similar in nature to the ISRs observed in the SAD study and generally resolved. Other AEs that occurred in more than 1 subject included gastrointestinal complaints (nausea, vomiting, diarrhea) and headache. These AEs occurred sporadically across the 3 cohorts, and the frequency or severity of these AEs did not change with increasing dose. One subject in Cohort 2 (50 mg) discontinued the study after the first dose because of Grade 2 nausea and Grade 1 vomiting which were considered drug related. An increase in buccal and skin cell FXN concentrations was observed in subjects who received 50 mg CTI-1601 daily for 7 days and 100 mg CTI- 1601 daily for 13 days.

[0787] Prior clinical studies of CTI-1601 have evaluated administration of CTI-1601 daily at doses up to 100 mg for 13 days. In addition, a Phase 2 dose exploration study has evaluated administration of 25 mg and 50 mg CTI-1601 daily for 14 days followed by every other day administration for an additional 14 days. An increase in buccal and skin cell FXN concentrations was observed in subjects who received 25 mg and 50 mg CTI-1601 daily for 14 days. Similar to the SAD and MAD study, CTI-1601 was safe and well tolerated. AEs were generally mild, brief, and self-limited, and no SAEs were observed. The most commonly observed AE was ISRs, which were generally similar in nature to the ISRs observed in the SAD and MAD studies and typically were mild, self-limited, and brief in duration. However, approximately half of subjects experienced itching that lasted for more than 24 hours at more than 1 injection site. In addition, approximately half of subjects developed eosinophilia at Day 14, and 3 subjects in this study experienced a generalized

[0788] 91

[0789] MEI 53012850v.l Atty. Docket No. 130197-01920 allergic reaction. These reactions included generalized urticaria which required medical treatment.

[0790] One subject experiencing urticaria received treatment with antihistamines for several days and study drug administration was paused until the urticaria resolved. When study drug was restarted, the subject received an antihistamine prior to study drug administration and again developed urticaria as well as wheezing and shortness of breath requiring supplemental oxygen and treatment with additional antihistamines and steroids. This subject was withdrawn from the study. Another subject developed generalized urticaria which resolved in 1 day after treatment with an antihistamine. The subject resumed study drug administration along with pretreatment with an antihistamine and urticaria did not recur. The third subject developed generalized urticaria relatively late in the treatment period and despite treatment with antihistamines and corticosteroids the urticaria had not completely resolved until after the end of the treatment period and thus this subject did not resume study drug administration. An elevation of liver- associated enzymes was noted in 2 subjects in the 50 mg dose cohort (Cohort 2) at Day 14. Neither subject had associated symptoms, signs, or other laboratory abnormalities. Administration of CTI-1601 continued through Day 28, and the liver-associated enzyme values decreased over time.

[0791] In the ongoing open label extension (OLE) study, 1 subject developed acute anaphylaxis 30 minutes after receiving the first dose of CTI-1601 on Day 1. This subject was withdrawn from the study and did not receive any more doses of CTI-1601. Another subject who had received approximately 44 days of CTI-1601 dosing had a brief seizure less than a minute after receiving a dose of CTI-1601. The seizure ended within 2 minutes, and the subject was admitted to the hospital. No more seizures were observed, and the subject was discharged a few days later. The subject chose to withdraw from the study.

[0792] This study, CLIN- 1601-103, will evaluate the safety and tolerability, PK, and change in FXN concentrations in buccal cells in adolescents and children with FRDA after 7 days of administration CTI-1601 via SC injection. Cohorts may be added, if required.

[0793] Rationale for the Study

[0794] FRDA is the most common inherited ataxia in humans and results from a deficiency of the mitochondrial protein FXN. CTI-1601 is being developed as a novel, specific treatment to supplement FXN levels in the mitochondria of adults and children with FRDA.

[0795] 92

[0796] MEI 53012850v.l Atty. Docket No. 130197-01920

[0797] The only currently approved treatment for FRDA, omaveloxolone, is not approved for use in patients with FRDA who are less than 16 years of age. Short-term safety and tolerability, PK, and changes in tissue FXN concentrations after administration of CTI-1601 administration via SC injection have been previously evaluated in clinical studies enrolling adults with FRDA. In these studies, CTI-1601 administered daily at doses of 25 mg and 50 mg appears to have a favorable safety profile. In addition, tissue FXN concentration data observed in the previous clinical studies, as well as the modeling and simulation supported by these data, predict that both 25 mg and 50 mg CTI-1601 administered daily to patients with FRDA will result in increases in tissue FXN concentrations that have the potential to result in a clinical benefit. Furthermore, simulations of a population of virtual FRDA patients predict that daily administration of 50 mg CTI-1601 will result in skin frataxin concentrations that approximate those expected in asymptomatic heterozygous carriers.

[0798] This study will be the first to evaluate CTI-1601 in pediatric subjects and is intended to evaluate the safety and tolerability, PK, and changes in tissue FXN concentrations of CTI- 1601 administered daily for 7 days in adolescents and children with FRDA. A population PK model with combined data from studies in adults with FRDA was developed and allometrically scaled to children. Pediatric simulations conducted to predict exposure metrics demonstrate that the weight-based dose of CTI-1601 administered in this study is expected to match the exposure of an adult dose of 50 mg. Data from this study will facilitate the inclusion of adolescents and children into the CTI-1601 clinical development program, and in particular will further inform the selection of a dose of CTI-1601 for use in adolescents and children in future studies.

[0799] Study Objectives and Endpoints

[0800] 93

[0801] MEI 53012850v.l Atty. Docket No. 130197-01920

[0802] 94

[0803] MEI 53012850v.l Atty. Docket No. 130197-01920

[0804] Study Design

[0805] This is a randomized double-blind, placebo-controlled study of CTI-1601 versus placebo in adolescents and children with FRDA. The study will consist of 2 cohorts with 12 to 15 subjects in each cohort. Subjects will participate in only 1 cohort. Efforts will be made to include at least 2 subjects of each sex in each cohort. The cohorts will be:

[0806] • Cohort 1: Subjects > 12 to < 18 years of age with FRDA.

[0807] • Cohort 2: Subjects > 2 to < 12 years of age with FRDA.

[0808] The dose for subjects randomized to receive CTI-1601 will be 0.8 mg / kg, with a maximum dose of 50 mg. This dose is estimated by modeling to achieve an exposure of CTI- 1601 equivalent to the exposure observed in adults with FRDA who received 50 mg CTI- 1601.

[0809] At least 12 subjects, but not more than 15 subjects, will be randomized with an allocation ratio of 2:1 for each cohort. Once dosing has completed, an independent Data Monitoring Committee (DMC) will evaluate the safety, tolerability, and PK data before making a recommendation on how to proceed with the study.

[0810] During the Screening Period, all subjects will be assessed to ensure that they meet all inclusion criteria and do not meet any exclusion criteria. In addition, baseline disease characteristics will be evaluated as subjects’ abilities allow. During the Dosing / Treatment Period, subjects will receive daily SC injections of study drug (CTI-1601 or placebo) for 7 consecutive days.

[0811] After completion of the Dosing / Treatment Period and discharge from the clinical research unit (CRU), subjects will have 2 Follow-Up Visits from a visiting nurse at approximately 7 days and 30 days from the last dose. Subjects who complete this study may be eligible to enroll in Study CEIN- 1601-201, an OEE study, to provide the prospect for direct benefit, provided that all inclusion and no exclusion criteria are met.

[0812] 95

[0813] MEI 53012850v.l Atty. Docket No. 130197-01920

[0814] FRDA is a rare genetic disorder. As a result, the FRDA pediatric population was selected for this study in order to maximize the contribution of all subjects studied to the understanding of the safety, tolerability, PK, and pharmacodynamics (PD) of CTI-1601 in pediatric subjects.

[0815] The use of placebo in the design of this study is justified because administration of placebo will provide a comparator relative to CTI-1601 regarding safety and AEs.

[0816] Figure 30 shows study schema.

[0817] The durations associated with each study period are listed below:

[0818] • The Screening Period will be up to 35 days to determine eligibility;

[0819] • The Dosing / Treatment Period will occur QD over 7 days

[0820] • The Follow-up Period is approximately 30 days post last dose. There are 2 visits in the Follow-up Period: Day 14 (-1 / +2 days) and Day 37 (± 3 days)

[0821] The maximum study duration for each subject in this study is approximately 72 days (± up to 3 days), including the Screening Period. The study completion date is used to ascertain timing for study results posting and reporting. For posting purposes, the study completion date includes the final subject’s Follow-Up Visit or last contact, whichever is later.

[0822] Study Drug

[0823] CTI-1601 is a recombinant fusion protein consisting of a cell penetrant peptide linked to the complete FXN protein. CTI-1601 will be provided as a frozen single use vial in a 2 mL glass vial containing 1.25 mL of product at a concentration of 50 mg / mL. The reference / comparator product is placebo, which is provided as a frozen single use vial in a 2 mL glass vial containing 1.2 mL (extractable volume of 1.0 mL) solution. Both CTI-1601 and placebo will contain the following excipients: histidine, sucrose, polysorbate 20, and sterile water.

[0824] The study drug, either CTI-1601 or placebo, will be administered SC QD via a syringe that is filled by the CRU pharmacy and will contain the appropriate amount to be administered. All doses of study drug will be administered by the CRU staff.

[0825] 96

[0826] MEI 53012850v.l Atty. Docket No. 130197-01920

[0827] This is a double-blind, placebo-controlled study. The actual study drug given to individual subjects is determined by the randomization schedule. Details of individual subject treatment are only available to the unblinded pharmacist at the CRU, the unblinded statistician, and the unblinded clinical research associate (CRA) for drug accountability purposes.

[0828] Study Evaluations and Procedures , Medical History, and Other Baseline Characteristics

[0829] A complete medical and medication history, as well as demographic information, will be performed at the Screening TH Visit by a qualified licensed physician, physician’s assistant, a nurse practitioner, or nurse. The demographics and medical history will be reviewed and recorded, including: age; sex; race and ethnicity; recent medications (within 30 days prior to entering the Screening Period); history of respiratory, cardiovascular, renal, gastrointestinal, hepatic, endocrine (for subjects with diabetes mellitus, their usual range of blood glucose values will be recorded), hematological, neurological, psychiatric, and other diseases; smoking habits (if applicable); caffeine habits (if applicable); baseline disease characteristics including age at symptom onset, first symptom, age at diagnosis, the number of triplet GAA repeat length (for both alleles, if available), absence of a point mutation, ambulation status, and history of use of assistive devices; and diagnosis of scoliosis, date of diagnosis, and date of surgery for or related to scoliosis.

[0830] Physical Examination

[0831] A complete or problem-focused physical examination will be performed y a qualified licensed physician, physician’s assistant, or a nurse practitioner. The complete physical examination will include a review of the following body systems: general appearance; skin; head, eyes, ears, nose, and throat; spine / neck / thyroid; musculoskeletal; respiratory; cardiovascular; neurological; and abdomen (including liver).

[0832] Changes after the Screening Visit will be captured as AEs on the AE CRF page, if deemed clinically significant by the investigator. Height and weight will be measured.

[0833] Adverse Event Collection

[0834] 97

[0835] MEI 53012850v.l Atty. Docket No. 130197-01920

[0836] At each study visit, subjects will be questioned in a general way to ascertain if AEs have occurred (e.g., “How are you feeling?”). This information will be collected prior to completion of other study assessments. In addition, any symptoms / conditions reported during assessments and deemed to be clinically significant by the investigator will be assessed as AEs which will be collected from the time the ICF is signed through completion of the Follow-Up Period (refer to Section 8).

[0837] Vital Signs

[0838] Vital signs outside the provided window or out of order will be considered a protocol deviation. Predose vital signs will be collected within 1 hour of study drug administration. Postdose vital signs collection must not deviate from the nominal collection time set forth by more than ± 15 minutes at the 1, 2-, 4-, and 8-hours postdose timepoints. Vital signs may be obtained outside designated times if required to collect PK blood samples at the protocol- scheduled time or if the subject reports an AE and requires medical attention. Blood pressure and heart rate, respiratory rate and body temperature will be measured.

[0839] Clinical Laboratory Evaluations

[0840] The following clinical laboratory assessments will be performed:

[0841] • Biochemistry: sodium, potassium, glucose, blood urea nitrogen, creatinine, calcium, chloride, phosphorus, ferritin, total protein, total CO2, albumin, AST, ALT, GGT, ALP, total bilirubin, uric acid, P-hCG (WCBP only);

[0842] • Hemoglobin Ale;

[0843] • Hematology: hemoglobin, hematocrit, red blood cell count, red cell distribution width, mean corpuscular volume, mean corpuscular hemoglobin, platelet count, mean platelet volume, WBC count (total and differential), absolute neutrophil count, eosinophils (absolute), monocytes (absolute), basophils (absolute), and lymphocytes (absolute);

[0844] • Lipid profile: cholesterol, high-density lipoprotein, cholesterol, low-density lipoprotein cholesterol, triglycerides, and very low- density lipoprotein cholesterol, calculated

[0845] • Urinalysis: pH, glucose, protein, blood, ketones, bilirubin, urobilinogen, nitrites, leukocyte esterase, color, and specific gravity. Microscopic examination will be

[0846] 98

[0847] MEI 53012850v.l Atty. Docket No. 130197-01920 conducted if protein and / or blood is / are detected during urinalysis. At a minimum, the microscopic examination will consist of red blood cells, WBCs, casts, and bacteria.

[0848] • A serum P-hCG pregnancy test will be performed on all women of child bearing potential (WCBP) at the visiting nurse Screening Visit, and a urine P-hCG pregnancy test at the Day -2 Visit or Day -1 Visit (if Day -2 and Day -1 visits are combined), or at any time if pregnancy is suspected.

[0849] • A urine screen for drugs of abuse and alcohol will be performed at the Screening Visit. Additional drug and alcohol screenings may be performed at the investigator’s discretion. Urine samples at Screening are to be tested for amphetamines, barbiturates, benzodiazepines, cannabinoids, cocaine, opiate metabolite, phencyclidine, methadone, and propoxyphene. Results of urine drug and alcohol screens will be reviewed and verified by the study monitor. The UDS results (positive / negative, if positive: specify) will be recorded in the CRF. Any positive result for drugs of abuse or alcohol at Screening will exclude the subject from further participation in the study unless the drug is consistent with the subject’s medical history or concomitant medications. However, a UDS positive for THC is acceptable. If a repeat or unscheduled drug and alcohol screen is needed, a visiting nurse may be scheduled to conduct this repeat testing.

[0850] Blood samples will be drawn to test for the presence of AD As to CTI-1601. These samples may be tested periodically or stored until tested at the end of the study; however, if a subject experiences AEs that might be associated with an ADA reaction, samples for the subject will be tested sooner.

[0851] A twelve-lead ECG will be performed. The following parameters will be collected: HR, PR interval, RR interval, QRS width, QT interval, including QTcF.

[0852] ECHOs will be collected. The parameters collected include, but are not limited to, the following: ejection fraction, left ventricular end-diastolic and systolic volumes, relative wall thickness, left ventricular mass, left ventricular posterior wall thickness and septal wall thickness, evaluation of valvular regurgitation for all 4 valves, fractional shortening, and pulmonary hypertension as assessed by pulmonary artery systolic pressure and right ventricular outflow tract acceleration time.

[0853] 99

[0854] MEI 53012850v.l Atty. Docket No. 130197-01920

[0855] The anatomic areas used as injection sites will be assessed both visually and using palpation at each scheduled on-site visit and prior to on-site administration of study drug. Any associated findings at the injection site will be noted in the source document and on the CRF and AEs will be recorded as appropriate.

[0856] The C-SSRS is a semi- structured interview that captures the occurrence, severity, and frequency of suicide -related thoughts and behaviors during the assessment period. The interview includes definitions and suggested questions to solicit the type of information needed to determine if a suicide-related thought or behavior occurred. The interview and rating for the C-SSRS must be completed by the same, appropriately trained CRU staff member whenever possible. Documentation of successful training should be retained in the trial master file.

[0857] Assessments of Disease Severity

[0858] At the Baseline Visit (Day -1), assessments of disease severity should be completed. Younger subjects may not be able to successfully complete all assessments.

[0859] Friedreich’s Ataxia Rating Scale

[0860] The Friedreich’s Ataxia Rating Scale (FARS) comprises a functional disability measure of ataxia, an activities for daily living (ADE) scale, and a neurological rating scale. This study will only focus on 2 subscores derived from the full FARS questionnaire, as follows: mFARS (and its Upright Stability subcomponent) and FARS-ADL.

[0861] The mFARS is a modified FARS neurological rating scale involving direct subject participation and targets specific areas impacted by FRDA (bulbar, upper limb, lower limb, and Upright Stability), with scores ranging from 0 to 93 points, with higher scores indicating a greater level of disability. The mFARS excludes subscale D (peripheral nervous system) and the first 2 questions of subscale A (bulbar) from the neurological rating scale of the FARS questionnaire.

[0862] Friedreich’s Ataxia Rating Scale Activities of Daily Living

[0863] The FARS-ADL score is a FARS rating scale assessing subject ability to complete ADLs (e.g., speech, cutting food, dressing, and personal hygiene), with scores ranging from 0 to 36 points, with higher scores indicating more impairment when completing ADLs.

[0864] 100

[0865] MEI 53012850v.l Atty. Docket No. 130197-01920 respondent options are 1) the subject; 2) a combination of the subject and family; or 3) family member or spouse or caregiver for those subjects unable to complete the test. The respondent must be the same throughout the subject’s participation in the study.

[0866] The 9-Hole Peg Test

[0867] The 9-HPT is a quantitative measure of upper extremity (arm and hand) function. Its use with multiple sclerosis (MS) subjects was first reported in 1988, and it has seen increasing use in MS clinical studies as part of the Multiple Sclerosis Functional Composite score as well as in Friedreich’s Ataxia Clinical Outcome Measures Study (FACOMS) and clinical practice.

[0868] Both the dominant and non-dominant hands will be tested twice (2 consecutive trials of the dominant hand, followed immediately by 2 consecutive trials of the non-dominant hand). All 4 trials must be performed. It is important that the 9-HPT be administered on a solid table (not a rolling hospital bedside table) and that the 9-HPT apparatus be anchored (e.g., using rubber contact grip liner). The 9-HPT will be performed at the timepoints indicated in Table 1 and scores will be recorded to a tenth of a second.

[0869] Timed 25-Foot Walk Test

[0870] The T25-FW test is a quantitative measure of lower extremity function. The T25-FW was incorporated as part of a composite score for MS in 1996 as a recommendation by the National MS Society Clinical Outcomes Assessment Task Force. It has seen increased use in MS clinical studies as part of the Multiple Sclerosis Functional Composite score, as well as in FACOMS and clinical practice.

[0871] Site staff will determine if a subject can complete the T25-FW test. The T25-FW test will be performed by those who can complete it, with or without assistive devices. At Day - 1, all subjects will be asked to traverse a distance of 25 feet with or without some assistive device (cane, walker, crutches, self-propelled wheelchair) to confirm that the subject has adequate independent mobility appropriate for the period of confinement at the CRU. Subjects who are able to ambulate with or without an assistive device will perform the T25- FW twice (once in each direction). The ambulatory subjects will be timed to a tenth of a second as they complete each 25-foot segment. The non-ambulatory subjects requiring use of a self-propelled wheelchair will perform the T25-FW, however they will not be timed.

[0872] 101

[0873] MEI 53012850v.l Atty. Docket No. 130197-01920

[0874] It is possible that some subjects may be able to perform the test at the beginning of the study and then subsequently lose the ability to do so.

[0875] Functional Staging for Ataxia

[0876] Functional Staging for Ataxia will be completed by the investigator (or trained subinvestigator). The responses range from normal (Stage 0) to confined to a wheelchair or bed with total dependency for all ADL (Stage 6.0). Increments of 0.5 are permitted.

[0877] Pharmacokinetic Procedures

[0878] Blood samples will be collected to measure plasma concentrations of CTI-1601. Actual PK blood sample collection times versus time of dosing will be monitored and recorded.

[0879] Tissue Frataxin Concentration and Pharmacodynamic Assessments

[0880] Measures will be assessed to quantify tissue FXN concentrations and potential biomarkers at baseline prior to treatment. Specimen analyses for FXN concentrations in buccal cells obtained from cheek swabs will be performed pretreatment and after the conclusion of the Dosing / Treatment Period to assess change in tissue FXN concentrations. Pretreatment measures of gene expression and specialized lipids will be used to characterize the study population and may be used as treatment- naive baseline values in future studies. Specimen analyses for FXN concentrations and gene expression will be completed using buccal cells obtained from cheek swabs. Plasma separated from blood will assess specialized lipids.

[0881] Buccal Swabs

[0882] Two buccal swab systems will be used to collect cells for protein quantitation and gene expression characterization, respectively. Samples will be harvested as follows: 1 sample from the left cheek for protein concentration and 1 sample from the right cheek for gene expression. Samples will be immediately stabilized according to purpose and the swab system manufacturer’s directions.

[0883] Blood

[0884] 102

[0885] MEI 53012850v.l Atty. Docket No. 130197-01920

[0886] Blood will be used to measure the predose specialized lipids composition and possibly circulating levels of protein biomarkers (volume permitting). Samples will be prepared and immediately stabilized.

[0887] Study Update

[0888] The study objective was to evaluate the safety and pharmacokinetics (PK) of CTI- 1601 in children with Friedreich’s ataxia (FRDA) and confirm that the pediatric weight-based dose estimated using population PK (PopPK) modeling to match exposures observed in adults with FRDA receiving 50 mg CTI-1601.

[0889] Adolescents with FRDA were randomized 2:1 to receive either CTI-1601 at the dose of 0.8 mg / kg or placebo. Study drug was administered daily for 7 days. Blood samples were obtained on Days 1 and 7 to assess safety and PK. Buccal cells were collected on Days 1 and 7 to assess tissue FXN concentrations. PK profiles were calculated from plasma CTI-1601 concentrations.

[0890] Fourteen (6 male) adolescents completed the study. The mean age was 14.8 years (range 12-17). Mean age of symptom onset was 8.4 years (range 4-13). Mean baseline buccal cell FXN concentration was 1.30 pg / ptg (range 0.46-2.86). CTI-1601 administration was well tolerated. The only treatment emergent adverse events were mild injection site reactions reported by 9 subjects over 7 days of study drug administration. The mean PK profile in this adolescent cohort matched the mean PK profile observed in adults who received 50 mg CTI-1601. A modest increase in mean buccal cell FXN concentration was observed at Day 7 compared to the mean baseline value.

[0891] Short term administration of CTI-1601 was well tolerated in adolescents with FRDA. PopPK modeling accurately predicted that 0.8 mg / kg CTI-1601 administered to adolescents match CTI-1601 exposure observed in adults with FRDA receiving 50 mg CTI-1601.

[0892] SEQUENCES OF APPLICATION

[0893] MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASS

[0894] NQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDL

[0895] 103

[0896] MEI 53012850v.l Atty. Docket No. 130197-01920

[0897] ADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWT

[0898] GKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

[0899] MYGRKKRRQRRRGGMWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRG

[0900] LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERL

[0901] AEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIW

[0902] LSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

[0903] SEQ ID NO: 6 (peptide derived from mature human FXN protein)

[0904] SGTLGHPGSLDETTYER

[0905] SEQ ID NO: 7 (peptide derived from mature human FXN protein)

[0906] LGGDLGTYVINK

[0907] 104

[0908] MEI 53012850v.l

Claims

Atty. Docket No. 130197-01920CLAIMS1. A method of treating Friedreich’s Ataxia in a subject in need thereof, said method comprising administering to said subject a TAT-FXN fusion protein at a dose of about 25 mg; wherein said dose is administered once daily for at least 90 days; wherein said TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that said administration of the TAT-FXN fusion protein results in one or more of the following:(i) no change or a decrease in a modified Friedreich’s Ataxia Rating Scale (mFARS) score, as compared to the mFARS score prior to the administration of the TAT- FXN fusion protein;(ii) no change or a decrease in Friedreich’s Ataxia Rating Scale - Activities of Daily Living (FARS-ADL) score, as compared to the FARS-ADL score prior to the administration of the TAT-FXN fusion protein;(iii) no change or a decrease in a 9-Hole Peg Test (9-HPT) score, as compared to the 9-HPT score prior to the administration of the TAT-FXN fusion protein;(iv) no change or a decrease in a Timed 25-Foot Walk (T25-FW) test score, as compared to the T25-FW score prior to the administration of the TAT-FXN fusion protein;(v) no change or a decrease in Patient Global Impression of Severity (PGLS) score, as compared to the PGLS score prior to the administration of the TAT-FXN fusion protein;(vi) no change or a decrease in Patient Global Impression of Change (PGLC) score, as compared to the PGLC score prior to the administration of the TAT-FXN fusion protein;105MEI 53012850v.lAtty. Docket No. 130197-01920(vii) no change or a decrease in Clinical Global Impression of Severity (CGI-S) score, as compared to the CGI-S score prior to the administration of the TAT-FXN fusion protein;(viii) no change or a decrease in Clinical Global Impression of Change (CGI-C) score, as compared to the CGI-C score prior to the administration of the TAT-FXN fusion protein;(ix) no change or a decrease in the Functional Staging for Ataxia score, as compared to the Functional Staging for Ataxia score prior to the administration of the TAT- FXN fusion protein;(x) no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score, as compared to the MFIS score prior to the administration of the TAT-FXN fusion protein;(xi) no change or an increase in left ventricular ejection fraction, as compared to the left ventricular ejection fraction prior to the administration of the TAT-FXN fusion protein;(xii) no change or a decrease in left ventricular end-diastolic volume, as compared to the left ventricular end-diastolic volume prior to the administration of the TAT-FXN fusion protein; and(xiii) no change or a decrease in hemoglobin Ale (HbAlc) levels, as compared to the HbAlc levels prior to the administration of the TAT-FXN fusion protein.

2. The method of claim 1, wherein said administration of the TAT-FXN fusion protein results in no change or a decrease in the mFARS score.

3. The method of claim 2, wherein said administration of the TAT-FXN fusion protein results in a decrease in the mFARS score of at least about 0.5 points, at least about 0.1 points, at least about 0.2 points, at least about 0.3 points, at least about 0.4 points, at least about 0.5 points, at least about 0.6 points, at least about 0.7 points, at least about 0.8 points, at least about 0.9 points, at least about 1 point, at least about 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points or at least about 6 or more points.106MEI 53012850v.lAtty. Docket No. 130197-019204. The method of claim 1, wherein said administration of the TAT-FXN fusion protein results in no change or a decrease in the FARS-ADL score.

5. The method of claim 4, wherein said administration of the TAT-FXN fusion protein results in a decrease in the FARS-ADL score of at least about 0.1 points, at least about 0.2 points, at least about 0.3 points, at least about 0.4 points, at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points or at least about 10 or more points.

6. The method of claim 1, wherein said administration of the TAT-FXN fusion protein results in no change or a decrease in the 9-HPT score.

7. The method of claim 6, wherein said administration of the TAT-FXN fusion protein results in a decrease in the 9-HPT score of at least 1 second, at least 2 seconds, at least 5 seconds, at least 7 seconds, at least 9 seconds, at least 10 seconds, at least 15 seconds, at least 20 seconds, at least 25 seconds, at least 30 seconds, at least 35 seconds, at least 40 seconds, at least 45 seconds, at least 50 seconds, at least 55 seconds, at least 60 seconds, at least 65 seconds, at least 70 seconds, or at least 75 seconds.

8. The method of claim 1, wherein said administration of the TAT-FXN fusion protein results in no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score.

9. The method of claim 1, wherein said administration of the TAT-FXN fusion protein results in a decrease in the Modified Fatigue Impact Scale (MFIS) score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points, at least about 10 points, at least about 12 points, at least about 14 points, at least about 16 points, at least about 18 points, at least about 20 points, at least about 22 points, at least about 24 points, at least about 26 points, at least about 28 points or at least about 30 points.107MEI 53012850v.lAtty. Docket No. 130197-0192010. The method of any one of claims 1-9, wherein the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

11. The method of claim 10, wherein said solid tissue sample is a skin biopsy.

12. The method of claim 11, wherein said solid tissue sample is a buccal tissue.

13. The method of any one of claims 10-12, wherein the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 70% of the level of FXN protein in a healthy subject.

14. The method of any one of claims 10-13, wherein the level of FXN protein in a buccal sample following administration of the TAT-FXN fusion protein is about 1.4 to about 3.7 pg / ptg of total protein.

15. The method of any one of claims 10-14, wherein the level of FXN protein in a buccal tissue sample following administration of the TAT-FXN fusion protein is increased by about 0.5 to about 2.6 pg / ptg of total protein, as compared to the level of FXN protein prior to administration of the TAT-FXN fusion protein.

16. The method of any one of claims 10-15, wherein the level of FXN protein in a buccal tissue sample following administration of the TAT-FXN fusion protein is increased to at least about 30% of the level of FXN protein in a healthy subject following administration of the TAT-FXN fusion protein.

17. The method of any one of claims 10-16, wherein the level of FXN protein in a skin biopsy sample following administration of the TAT-FXN fusion protein is about 7.0 to about 10.5 pg / ptg of total protein.

18. The method of any one of claims 10-17, wherein the level of FXN protein in a skin biopsy sample following administration of the TAT-FXN fusion protein is increased by about 4.2 to about 9.0 pg / ptg of total protein, as compared to the level of FXN protein prior to administration of the TAT-FXN fusion protein.108MEI 53012850v.lAtty. Docket No. 130197-0192019. The method of any one of claims 10-19, wherein the level of FXN protein in a skin biopsy sample following administration of the TAT-FXN fusion protein is increased to at least about 70% of the level of FXN protein in a healthy subject following administration of the TAT-FXN fusion protein.

20. The method of any one of claims 1-19, wherein said TAT-FXN fusion protein is administered for at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least 13 months, at least 14 months, at least 15 months, at least 16 months, at least 17 months, at least 18 months, at least 19 months or at least 20 or more months.

21. A method of treating Friedreich’s Ataxia in a subject in need thereof, said method comprising administering to said subject a TAT-FXN fusion protein at a dose of about 50 mg; wherein said dose is administered once daily for at least 90 days; wherein said TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that said administration of the TAT-FXN fusion protein results in one or more of the following:(i) no change or a decrease in a modified Friedreich’s Ataxia Rating Scale (mFARS) score, as compared to the mFARS score prior to the administration of the TAT- FXN fusion protein;(ii) no change or a decrease in Friedreich’s Ataxia Rating Scale - Activities of Daily Living (FARS-ADL) score, as compared to the FARS-ADL score prior to the administration of the TAT-FXN fusion protein;(iii) no change or a decrease in a 9-Hole Peg Test (9-HPT) score, as compared to the 9-HPT score prior to the administration of the TAT-FXN fusion protein;(iv) no change or a decrease in a Timed 25-Foot Walk (T25-FW) test score, as compared to the T25-FW score prior to the administration of the TAT-FXN fusion protein;109MEI 53012850v.lAtty. Docket No. 130197-01920(v) no change or a decrease in Patient Global Impression of Severity (PGI-S) score, as compared to the PGI-S score prior to the administration of the TAT-FXN fusion protein;(vi) no change or a decrease in Patient Global Impression of Change (PGI-C) score, as compared to the PGI-C score prior to the administration of the TAT-FXN fusion protein;(vii) no change or a decrease in Clinical Global Impression of Severity (CGI-S) score, as compared to the CGI-S score prior to the administration of the TAT-FXN fusion protein;(viii) no change or a decrease in Clinical Global Impression of Change (CGI-C) score, as compared to the CGI-C score prior to the administration of the TAT-FXN fusion protein;(ix) no change or a decrease in the Functional Staging for Ataxia score, as compared to the Functional Staging for Ataxia score prior to the administration of the TAT- FXN fusion protein;(x) no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score, as compared to the MFIS score prior to the administration of the TAT-FXN fusion protein;(xi) no change or an increase in left ventricular ejection fraction, as compared to the left ventricular ejection fraction prior to the administration of the TAT-FXN fusion protein;(xii) no change or a decrease in left ventricular end-diastolic volume, as compared to the left ventricular end-diastolic volume prior to the administration of the TAT-FXN fusion protein; and(xiii) no change or a decrease in hemoglobin Ale (HbAlc) levels, as compared to the HbAlc levels prior to the administration of the TAT-FXN fusion protein.

22. The method of claim 21, wherein said administration of the TAT-FXN fusion protein results in no change or a decrease in the mFARS score.110MEI 53012850v.lAtty. Docket No. 130197-0192023. The method of claim 22, wherein said administration of the TAT-FXN fusion protein results in a decrease in the mFARS score of at least about 0.1 points, at least about 0.2 points, at least about 0.3 points, at least about 0.4 points, at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points or at least about 6 or more points.

24. The method of claim 22, wherein said administration of the TAT-FXN fusion protein results in a decrease in the mFARS score of about 0.3 points to about 4 points.

25. The method of claim 21, wherein said administration of the TAT-FXN fusion protein results in no change or a decrease in the FARS-ADL score.

26. The method of claim 25, wherein said administration of the TAT-FXN fusion protein results in a decrease in the FARS-ADL score of at least about 0.1 points, at least about 0.2 points, at least about 0.3 points, at least about 0.4 points, at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points or at least about 10 or more points.

27. The method of claim 25, wherein said administration of the TAT-FXN fusion protein results in a decrease in the FARS-ADL score of about 0.1 points to about 1 point.

28. The method of claim 21, wherein said administration of the TAT-FXN fusion protein results in no change or a decrease in the 9-HPT score.

29. The method of claim 28, wherein said administration of the TAT-FXN fusion protein results in a decrease in the 9-HPT score of at least 1 second, at least 2 seconds, at least 5 seconds, at least 7 seconds, at least 9 seconds, at least 10 seconds, at least 15 seconds, at least 20 seconds, at least 25 seconds, at least 30 seconds, at least 35 seconds, at least 40 seconds, at least 45 seconds, at least 50 seconds, at least 55 seconds, at least 60 seconds, at least 65 seconds, at least 70 seconds, or at least 75 seconds.111MEI 53012850v.lAtty. Docket No. 130197-0192030. The method of claim 28, wherein said administration of the TAT-FXN fusion protein results in a decrease in the 9-HPT score of about 2 seconds to about 40 seconds.

31. The method of claim 21, wherein said administration of the TAT-FXN fusion protein results in no change or a decrease in the T-25-FW score.

32. The method of claim 21, wherein said administration of the TAT-FXN fusion protein results in no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score.

33. The method of claim 32, wherein said administration of the TAT-FXN fusion protein results in a decrease in the Modified Fatigue Impact Scale (MFIS) score of at least about 0.5 points, at least about 1 point, 1.5 points, at least about 2 points, at least about 2.5 points, at least about 3 points, at least about 3.5 points, at least about 4 points, at least about 4.5 points, at least about 5 points, at least about 5.5 points, at least about 6 points, at least about 6.5 points, at least about 7 points, at least about 7.5 points, at least about 8 points, at least about 8.5 points, at least about 9 points, at least about 9.5 points, at least about 10 points, at least about 12 points, at least about 14 points, at least about 16 points, at least about 18 points, at least about 20 points, at least about 22 points, at least about 24 points, at least about 26 points, at least about 28 points or at least about 30 points.

34. The method of claim 32, wherein said administration of the TAT-FXN fusion protein results in a decrease in the Modified Fatigue Impact Scale (MFIS) score of about 0.5 points to about 20 points.

35. The method of any one of claims 21-34, wherein the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

36. The method of claim 35, wherein said solid tissue sample is a skin biopsy.

37. The method of claim 35, wherein said solid tissue sample is a buccal tissue.

38. The method of any one of claims 35-37, wherein the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased by at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at112MEI 53012850v.lAtty. Docket No. 130197-01920 least about 250%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at least about 1000%, at least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%.

39. The method of any one of claims 35-38, wherein the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 75% of the level of FXN protein in a healthy subject.

40. The method of any one of claims 35-39, wherein the level of FXN protein in a skin sample obtained from said subject is about 5 pg / ptg of total protein to about 30 pg / ptg of total protein.

41. The method of any one of claims 21-40, wherein said TAT-FXN fusion protein is administered for at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least 13 months, at least 14 months, at least 15 months, at least 16 months, at least 17 months, at least 18 months, at least 19 months or at least 20 or more months.

42. The method of any one of claims 1-41, wherein the subject is a human. subject.

43. The method of claim 42, wherein the subject is at least 18 years of age or older.

44. A method of increasing level of frataxin (FXN) protein in an FXN deficient pediatric subject, said method comprising administering to said subject a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg; wherein said dose is administered once daily for at least 7 days; and wherein said TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5; such that the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased as compared to the level of FXN protein prior to the administration of the TAT-FXN fusion protein.

45. The method of claim 44, wherein said solid tissue sample is a buccal tissue sample or a skin biopsy sample.113MEI 53012850v.lAtty. Docket No. 130197-0192046. The method of claim 45, wherein said solid tissue sarnie is a buccal tissue sample.

47. The method of any one of claims 44-46, wherein said TAT-FXN fusion protein is administered to said subject for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, or at least 12 weeks.

48. The method of any one of claims 44-47, wherein said TAT-FXN fusion protein is administered to said subject for more than 10 weeks.

49. The method of any one of claims 44-48, wherein the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 250%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at least about 1000%, at least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%.

50. The method of any one of claims 44-49, wherein the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 70% of the level of FXN protein in a healthy subject.

51. A method of treating Friedreich’s Ataxia in a pediatric subject in need thereof, said method comprising administering to said subject a TAT-FXN fusion protein at a dose of about 0.8 mg / kg, up to a maximum dose of about 50 mg; wherein said dose is administered once daily for at least 7 days; and wherein said TAT-FXN fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5, such that the Friedreich’s Ataxia in the pediatric subject is treated.

52. The method of claim 51, wherein the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased as compared to the level of FXN protein prior to the administration of the TAT- FXN fusion protein.114MEI 53012850v.lAtty. Docket No. 130197-0192053. The method of claim 51 or 52, wherein said solid tissue sample is a buccal tissue sample or a skin biopsy sample.

54. The method of any one of claims 51-53, wherein said solid tissue sample is a buccal tissue sample.

55. The method of any one of claims 51-54, wherein said TAT-FXN fusion protein is administered to said subject for at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, or at least 12 weeks.

56. The method of any one of claims 51-55, wherein said TAT-FXN fusion protein is administered to said subject for more than 10 weeks.

57. The method of any one of claims 51-56, wherein the level of TAT-FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 250%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, at least about 1000%, at least about 1500%, at least about 2000%, at least about 2500%, at least about 5000% or at least about 10000%.

58. The method of any one of claims 51-57, wherein the level of FXN protein in a solid tissue sample obtained from said subject following administration of the TAT-FXN fusion protein is increased to at least about 12.5%, at least about 25%, at least about 37.5%, at least about 50% or at least about 70% of the level of FXN protein in a healthy subject.

59. The method of any one of claims 44-58, wherein said administration of the TAT-FXN fusion protein to said subject results in one or more of the following:(i) no change or a decrease in a modified Friedreich’s Ataxia Rating Scale (mFARS) score, as compared to the mFARS score prior to the administration of the TAT- FXN fusion protein;115MEI 53012850v.lAtty. Docket No. 130197-01920(ii) no change or a decrease in Friedreich’s Ataxia Rating Scale - Activities of Daily Living (FARS-ADL) score, as compared to the FARS-ADL score prior to the administration of the TAT-FXN fusion protein;(iii) no change or a decrease in a 9-Hole Peg Test (9-HPT) score, as compared to the 9-HPT score prior to the administration of the TAT-FXN fusion protein;(iv) no change or a decrease in a Timed 25-Foot Walk (T25-FW) test score, as compared to the T25-FW score prior to the administration of the TAT-FXN fusion protein;(v) no change or a decrease in Patient Global Impression of Severity (PGLS) score, as compared to the PGLS score prior to the administration of the TAT-FXN fusion protein;(vi) no change or a decrease in Patient Global Impression of Change (PGLC) score, as compared to the PGLC score prior to the administration of the TAT-FXN fusion protein;(vii) no change or a decrease in Clinical Global Impression of Severity (CGLS) score, as compared to the CGLS score prior to the administration of the TAT-FXN fusion protein;(viii) no change or a decrease in Clinical Global Impression of Change (CGLC) score, as compared to the CGLC score prior to the administration of the TAT-FXN fusion protein;(ix) no change or a decrease in the Functional Staging for Ataxia score, as compared to the Functional Staging for Ataxia score prior to the administration of the TAT- FXN fusion protein;(x) no change or a decrease in the Modified Fatigue Impact Scale (MFIS) score, as compared to the MFIS score prior to the administration of the TAT-FXN fusion protein;(xi) no change or an increase in left ventricular ejection fraction, as compared to the left ventricular ejection fraction prior to the administration of the TAT-FXN fusion protein;116MEI 53012850v.lAtty. Docket No. 130197-01920(xii) no change or a decrease in left ventricular end-diastolic volume, as compared to the left ventricular end-diastolic volume prior to the administration of the TAT-FXN fusion protein; and(xiii) no change or a decrease in hemoglobin Ale (HbAlc) levels, as compared to the HbAlc levels prior to the administration of the TAT-FXN fusion protein.

60. The method of any one of claims 44-59, wherein the pediatric subject is human.117MEI 53012850v.l