Comprehensive anti-aging cosmetic containing recombined collagen III and recombined collagen IV and preparation method of comprehensive anti-aging cosmetic

Abstract

The invention relates to the technical field of cosmetics, and particularly discloses a comprehensive anti-aging cosmetic containing recombined collagen III and recombined collagen IV and a preparation method of the comprehensive anti-aging cosmetic. The raw materials comprise the following raw materials in parts by weight: 5 to 8 parts of recombinant III-type collagen, 3 to 5 parts of recombinant IV-type collagen, 2 to 4 parts of sodium hyaluronate, 4 to 5 parts of nicotinamide, 1 to 2 parts of vitamin E acetate, 8 to 10 parts of squalane, 6 to 8 parts of phytosterol oleate, 8 to 12 parts of glycerol, 5 to 6 parts of butanediol, 1 to 2 parts of carbomer, 0.5 to 1.5 parts of triethanolamine, 0.8 to 1.2 parts of phenoxyethanol and 0.2 to 0.4 part of essence. According to the present invention, by matching the recombinant III-type collagen and the recombinant IV-type collagen, and through the synergistic effect of the recombinant III-type collagen and the recombinant IV-type collagen, the aging is comprehensively resisted from the skin structure level, and the multiple aging signs such as wrinkles, looseness and the like of the skin due to the age increase are effectively improved.

Description

Technical Field

[0001] The present invention belongs to the technical field of cosmetics, and in particular relates to a comprehensive anti-aging cosmetic containing recombinant type III and type IV collagen and a preparation method thereof. Background Art

[0002] With the improvement of people's living standards and the increasing attention paid to their own image, skin anti-aging has become one of the core research directions in the field of cosmetics. Skin aging is a complex physiological process, which is mainly caused by the combined effects of endogenous factors (such as the slowing of cell metabolism and the reduction of collagen and elastic fiber synthesis caused by aging) and exogenous factors (such as ultraviolet radiation, environmental pollution, bad living habits, etc.).

[0003] Among them, collagen is the main structural component of the dermis of the skin, and changes in its content and structure play a decisive role in the elasticity, firmness and glossiness of the skin. Traditional sources of collagen mainly include animal tissue extraction, but this method has many limitations, such as the possibility of inducing immunogenic reactions, limited resources and complex extraction processes. The emergence of recombinant collagen technology has brought new breakthroughs to the cosmetics industry. Recombinant type III collagen and recombinant type IV collagen are highly similar to natural human collagen in structure and function, and have good biocompatibility and biological activity.

[0004] However, despite the existence of numerous anti-aging cosmetics on the market, there are still many challenges in the rational compounding of recombinant type III and type IV collagen. Anti-aging cosmetics have a single function, and it is inconvenient to ensure the stability and activity of each ingredient during the preparation process. The active ingredients are easily destroyed during the full emulsification of the oil and water phases. Summary of the invention

[0005] The object of the present invention is to provide a comprehensive anti-aging cosmetic containing recombinant type III and type IV collagen and a preparation method thereof, so as to solve the problems raised in the above background technology.

[0006] To achieve the above object, the present invention provides the following technical solutions:

[0007] A comprehensive anti-aging cosmetic containing recombinant type III and type IV collagen. The raw materials include the following raw materials in parts by weight: 5-8 parts of recombinant type III collagen, 3-5 parts of recombinant type IV collagen, 2-4 parts of sodium hyaluronate, 4-5 parts of niacinamide, 1-2 parts of vitamin E acetate, 8-10 parts of squalane, 6-8 parts of phytosteryl oleate, 8-12 parts of glycerol, 5-6 parts of butylene glycol, 1-2 parts of carbomer, 0.5-1.5 parts of triethanolamine, 0.8-1.2 parts of phenoxyethanol, 0.2-0.4 parts of essence, 0.3-0.6 parts of tripeptide-1 copper, 0.2-0.5 parts of acetyl heptapeptide-4 and 0.5-0.8 parts of ergothioneine, which are added to 100 parts of deionized water.

[0008] Preferably, the raw materials include the following raw materials in parts by weight: 5 parts of recombinant type III collagen, 3 parts of recombinant type IV collagen, 2 parts of sodium hyaluronate, 4 parts of niacinamide, 1 part of vitamin E acetate, 8 parts of squalane, 6 parts of phytosteryl oleate, 10 parts of glycerol, 5 parts of butylene glycol, 1 part of carbomer, 0.5 parts of triethanolamine, 0.8 parts of phenoxyethanol, 0.2 parts of essence, 0.3 parts of tripeptide-1 copper, 0.3 parts of acetyl heptapeptide-4, and 0.5 parts of ergothioneine, which are added to 100 parts of deionized water.

[0009] A method for preparing a comprehensive anti-aging cosmetic containing recombinant type III and type IV collagen, comprising the following steps:

[0010] S1. Preparation of aqueous phase:

[0011] Add deionized water to the main stirring pot, and introduce nitrogen in advance to exclude oxygen, raise the temperature to 70-75°C, first use an ultrasonic homogenizer to briefly treat carbomer at a speed of 400-600rpm and then pour it into the stirring pot, then add glycerol and butylene glycol in turn, stir at a speed of 300-400rpm, and continue stirring for 20-30 minutes to ensure that all raw materials are fully dissolved to form a uniform water phase;

[0012] S2. Oil phase preparation:

[0013] Add squalane, phytosteryl oleate, tocopherol acetate and 0.5 parts of silane coupling agent into the oil phase pot, heat to 70-75° C., stir evenly to obtain the oil phase.

[0014] S3, emulsification:

[0015] The oil phase obtained from S2 is added to the water phase of S1, and a twin-screw emulsifier is used to mix and emulsify the oil and water phases, maintaining the temperature at 70-75°C, and homogenizing and emulsifying at a speed of 500-600rpm for 10-15 minutes to form a preliminary emulsion. When the emulsion temperature drops to 40-45°C, recombinant type III collagen, recombinant type IV collagen, niacinamide, tripeptide-1 copper, acetyl heptapeptide-4, and ergothioneine are added in sequence, and stirred evenly at a speed of 200-300rpm to maintain the system temperature unchanged; then triethanolamine is added to adjust the pH value of the system to 5.5-6.5, and then phenoxyethanol and essence are added, and stirring is continued for 10-15 minutes to mix them evenly, and finally deionized water is added to make up to 100 parts, and after stirring evenly, the material is discharged and canned after passing the inspection.

[0016] Compared with the prior art, the present invention has the following beneficial effects:

[0017] The present invention uses a ratio of recombinant type III collagen and recombinant type IV collagen, which work synergistically to comprehensively combat aging from the structural level of the skin, and effectively improve various aging signs such as wrinkles and sagging caused by aging. At the same time, moisturizing ingredients such as sodium hyaluronate, glycerin, and butylene glycol in the formula can deeply penetrate the skin, provide lasting moisture nourishment to the skin, improve dry skin, and keep the skin moisturized and smooth. The various ingredients cooperate with each other, and the antioxidant effect of vitamin E acetate can protect other ingredients from free radical damage. At the same time, it cooperates with ingredients such as niacinamide to further reduce the impact of oxidative damage on the skin, and together with recombinant collagen, it maintains the health and vitality of skin cells, and improves the comprehensive anti-aging effect of the entire cosmetic.

[0018] The present invention uses an ultrasonic homogenizer to treat carbomer in the preparation of the water phase and strictly controls the temperature, stirring speed and time, and adds a silane coupling agent in the preparation of the oil phase, so as to improve the dispersibility and stability of each raw material in the corresponding phase, lay a good foundation for the subsequent emulsification and addition of active ingredients, reduce the occurrence of unstable phenomena such as component agglomeration and precipitation, and ensure the quality stability of the product during storage and use. A twin-screw emulsifier is used for oil-water phase mixing and emulsification, and is operated at a specific temperature and speed, so that the oil-water phase can be fully emulsified and high-speed shearing can be avoided to cause damage to active ingredients such as recombinant type III collagen, recombinant type IV collagen and nicotinamide. Active ingredients are added at a suitable temperature and the pH value of the system is accurately adjusted, so that the biological activity of each active ingredient is retained to the greatest extent, ensuring that the product can effectively exert its anti-aging effect when used, so that consumers can fully enjoy the benefits claimed by the product.

[0019] The copper tripeptide-1 of the present invention can stimulate the production of collagen, elastic fibers and hyaluronic acid, and acetyl heptapeptide-4 can reduce the transmission of muscle contraction signals and reduce the production of wrinkles. Recombinant type III and type IV collagen themselves provide structural support and repair for the skin. The three work together, and the copper tripeptide-1 and acetyl heptapeptide-4 work from two aspects: promoting production and reducing wrinkle formation, and together with collagen, they build a tighter and more elastic skin structure. Collagen provides the basis for the other two peptides, and the peptides further enhance the efficacy of collagen, significantly improving the firmness of the skin and reducing the effect of wrinkles. Compared with existing anti-wrinkle products that may only focus on a single anti-wrinkle mechanism, this formula integrates multiple anti-wrinkle ingredients to work synergistically, acting on the skin from different angles, with a more comprehensive and in-depth anti-wrinkle effect, which can better improve various types of wrinkles and make the skin firmer and smoother. DETAILED DESCRIPTION

[0020] The following will be combined with the embodiments of the present invention to clearly and completely describe the technical solutions in the embodiments of the present invention. Obviously, the described embodiments are only part of the embodiments of the present invention, not all of the embodiments. Based on the embodiments of the present invention, all other embodiments obtained by ordinary technicians in this field without making creative work are within the scope of protection of the present invention.

[0021] Embodiment 1:

[0022] A comprehensive anti-aging cosmetic containing recombinant type III and type IV collagen and a preparation method thereof: raw material preparation: 5 parts of recombinant type III collagen: 3 parts of recombinant type IV collagen: 2 parts of sodium hyaluronate; niacinamide: 4 parts; vitamin E acetate: 1 part; squalane: 8 parts; phytosteryl oleate: 6 parts; glycerin: 10 parts; butylene glycol: 5 parts; carbomer: 1 part; triethanolamine: 0.5 parts; phenoxyethanol: 0.8 parts; essence: 0.2 parts; tripeptide-1 copper 0.3 parts, acetyl heptapeptide-4 0.2 parts, ergothioneine 0.8 parts, add to 100 parts of deionized water.

[0023] Add 100 parts of deionized water to the main stirring pot, turn on the nitrogen inlet device to remove oxygen from the stirring pot to prevent oxidation of the raw materials. Then heat the stirring pot to 70-75°C. Take 1 part of carbomer and use an ultrasonic homogenizer to briefly treat it at a speed of 400-600rpm (about 2-3 minutes), and then quickly pour it into the stirring pot. Then add 10 parts of glycerol and 5 parts of butylene glycol to the stirring pot in turn, stir at a speed of 300-400rpm, and continue stirring for 20-30 minutes. During this period, constantly observe the dissolution of the raw materials to ensure that carbomer, glycerol and butylene glycol are fully dissolved to form a uniform aqueous phase.

[0024] Add 8 parts of squalane, 6 parts of phytosterol oleate, 1 part of tocopherol acetate and 0.5 parts of silane coupling agent to the oil phase pot. Heat the oil phase pot to 70-75°C, turn on the stirring device, stir for 10-15 minutes, mix all the oil raw materials evenly, and obtain the oil phase. Slowly add the prepared oil phase to the water phase, use a twin-screw emulsifier to mix and emulsify the oil and water phases, maintain the temperature at 70-75°C during the addition process, and homogenize and emulsify at a speed of 500-600rpm for 10-15 minutes to form a preliminary emulsion. When the emulsion temperature drops to 40-45°C, add 5 parts of recombinant type III collagen, 3 parts of recombinant type IV collagen, 4 parts of niacinamide, 0.3 parts of tripeptide-1 copper, 0.2 parts of acetyl heptapeptide-4, and 0.8 parts of ergothioneine to the emulsion in sequence, and stir evenly at a speed of 200-300rpm. During the stirring process, pay close attention to the system temperature and maintain the system temperature unchanged to avoid the impact of temperature fluctuations on the active ingredients. Then add 0.5 parts of triethanolamine to adjust the pH value of the system to 5.5-6.5, then add 0.8 parts of phenoxyethanol and 0.2 parts of essence, and continue stirring for 10-15 minutes to mix evenly.

[0025] Finally, add deionized water to 100 parts, stir evenly, and then conduct quality inspection on the product. The inspection items include appearance, pH value, viscosity, microbial indicators, content of effective ingredients, etc. After passing the inspection, the product is discharged and canned to obtain a comprehensive anti-aging cosmetic product containing recombinant type III and type IV collagen.

[0026] Embodiment 2:

[0027] A comprehensive anti-aging cosmetic containing recombinant type III and type IV collagen and a preparation method thereof: recombinant type III collagen: 6 parts; recombinant type IV collagen: 4 parts; sodium hyaluronate: 3 parts; niacinamide: 4.5 parts; vitamin E acetate: 1.5 parts; squalane: 9 parts; phytosteryl oleate: 7 parts; glycerol: 11 parts; butylene glycol: 5.5 parts; carbomer: 1.5 parts; triethanolamine: 1 part; phenoxyethanol: 1 part; essence: 0.3 parts; tripeptide-1 copper 0.3 parts, acetyl heptapeptide-4 0.2 parts, ergothioneine 0.8 parts, added to 100 parts of deionized water.

[0028] Preparation steps: Pour 105 parts of deionized water into the main stirring pot, and pass nitrogen at a flow rate of 2L / min for 10 minutes to fully remove the oxygen in the pot. Then raise the temperature of the stirring pot to 72°C. Take 1.5 parts of carbomer and place it in an ultrasonic homogenizer, set the speed to 500rpm, and process for 2.5 minutes. After the treatment is completed, add carbomer to the main stirring pot immediately. Then add 11 parts of glycerol and 5.5 parts of butylene glycol to the stirring pot in turn, and start stirring at a speed of 350rpm. During the stirring process, use a scraper to scrape the wall of the pot every 5 minutes to ensure that the raw materials are fully mixed and dissolved. Continue stirring for 25 minutes to form a uniform and particle-free aqueous phase.

[0029] Add 9 parts of squalane, 7 parts of phytosterol oleate, 1.5 parts of tocopherol acetate and 0.5 parts of silane coupling agent to the oil phase pot in sequence. Heat the oil phase pot to 73°C and stir at 400rpm for 12 minutes to fully blend the oil raw materials to obtain the oil phase. Slowly pour the oil phase into the water phase pot and use a twin-screw emulsifier for emulsification. Keep the temperature constant at 72°C during the emulsification process, and homogenize and emulsify at 550rpm for 12 minutes to form a preliminary emulsion. When the emulsion temperature naturally cools down to 42°C, add 6 parts of recombinant type III collagen, 4 parts of recombinant type IV collagen, 4.5 parts of niacinamide, 0.3 parts of tripeptide-1 copper, 0.2 parts of acetyl heptapeptide-4, and 0.8 parts of ergothioneine to the emulsion in sequence, and stir gently at 250rpm for 10 minutes to ensure that the active ingredients are evenly dispersed and the system temperature is stable at 42°C. Then add 1 part of triethanolamine to adjust the pH value of the system to 6. Then add 1 part of phenoxyethanol and 0.3 parts of essence, continue stirring for 12 minutes, so that the ingredients are fully mixed. Finally, add deionized water to a total weight of 105 parts. After stirring for 5 minutes, take samples for comprehensive quality testing, including physical and chemical index testing, including appearance, pH value, viscosity, microbial index testing including total colony count, total mold and yeast count, specific harmful bacteria detection, etc., effective ingredient testing including recombinant collagen, niacinamide, etc. content detection and stability testing including heat resistance, cold resistance stability testing and safety testing including skin irritation test, allergic reaction test. After testing that all indicators meet the standards, the material is discharged and canned to obtain the finished product of the comprehensive anti-aging cosmetics of the present invention.

[0030] When using, clean your face first, apply an appropriate amount (about 0.5-1g) of the product evenly on the face, avoiding the area around the eyes, and then gently massage the facial skin from the inside to the outside and from the bottom to the top for 1-2 minutes until the product is completely absorbed by the skin. After continuous use for a period of time, the skin's firmness, elasticity and glossiness will be significantly improved, and signs of aging such as wrinkles and spots will gradually decrease, providing comprehensive and effective anti-aging care for the skin.

[0031] Embodiment three:

[0032] A comprehensive anti-aging cosmetic containing recombinant type III and type IV collagen and a preparation method thereof:

[0033] Preparation of raw materials: recombinant type III collagen: 8 parts; recombinant type IV collagen: 5 parts; sodium hyaluronate: 4 parts; niacinamide: 5 parts; vitamin E acetate: 2 parts; squalane: 10 parts; phytosteryl oleate: 8 parts; glycerin: 12 parts; butylene glycol: 6 parts; carbomer: 2 parts; triethanolamine: 1.5 parts; phenoxyethanol: 1.2 parts; flavor: 0.4 parts; tripeptide-1 copper 0.5 parts, acetyl heptapeptide-4 0.5 parts, ergothioneine 0.8 parts, add to 100 parts of deionized water.

[0034] Preparation process: Add 110 parts of deionized water to the main stirring pot with a constant temperature heating device and a stirring paddle, open the nitrogen inlet valve, and allow nitrogen to continue to flow into the stirring pot at a flow rate of 3L / min for 15 minutes to exhaust the air in the pot, and then raise the temperature to 75°C. Place 2 parts of carbomer in an ultrasonic homogenizer, set the speed to 600rpm, and after running for 3 minutes, pour the treated carbomer into the main stirring pot. Then add 12 parts of glycerol and 6 parts of butylene glycol to the main stirring pot in turn, turn on the stirring paddle, and stir at a speed of 400rpm. During stirring, use a stainless steel scraper to scrape the raw materials on the pot wall into the solution every 6 minutes to ensure that the raw materials are fully mixed. Continue stirring for 30 minutes to obtain a uniform and transparent aqueous phase.

[0035] Add 10 parts of squalane, 8 parts of phytosteryl oleate, 2 parts of tocopherol acetate and 0.5 parts of silane coupling agent to the oil phase pot. Turn on the heating device of the oil phase pot, raise the temperature to 75°C, start the stirring device at the same time, and stir at 450 rpm for 15 minutes to fully mix the ingredients in the oil phase to form an oil phase.

[0036] The oil phase was slowly added to the water phase using a peristaltic pump. During the addition process, the temperature of the main stirring pot was maintained at 75°C, and the twin-screw emulsifier was turned on for emulsification. The emulsification speed was set to 600 rpm and the emulsification time was 15 minutes to obtain a preliminary emulsion.

[0037] When the emulsion temperature drops to 45°C, 8 parts of recombinant type III collagen, 5 parts of recombinant type IV collagen, 5 parts of niacinamide, 0.5 parts of tripeptide-1 copper, 0.5 parts of acetyl heptapeptide-4, and 0.8 parts of ergothioneine are added to the emulsion in sequence, and stirred at a speed of 300 rpm for 12 minutes to uniformly disperse the active ingredients in the emulsion, and the system temperature is maintained at 45°C by a water bath thermostat during the whole process.

[0038] Then add 1.5 parts of triethanolamine to adjust the pH value of the system to 6.5, then add 1.2 parts of phenoxyethanol and 0.4 parts of fragrance, and continue stirring for 15 minutes to ensure that all ingredients are evenly mixed.

[0039] Finally, add deionized water to a total weight of 110 parts, stir evenly, and inspect according to the cosmetic quality inspection standard. After passing the inspection, discharge and can be canned to obtain the comprehensive anti-aging cosmetic product of the present invention.

[0040] To sum up, the finished cosmetics can be used for daily skin care. After cleansing in the morning and evening, apply an appropriate amount evenly on the facial skin and gently massage until completely absorbed. Long-term use can effectively improve the skin's firmness, elasticity, and glossiness, reduce wrinkles, spots and other aging phenomena, and provide comprehensive anti-aging care for the skin.

[0041] The recombinant type IV collagen of the present invention is specifically a recombinant plasmid construct based on pET-30b(+) plasmid, comprising a 1041bp gene fragment, which is inserted between the NdeI and HindIII restriction sites and carries kanamycin resistance. The gene fragment encodes a protein composed of multiple repeated amino acid sequence units, the expected molecular weight of the protein encoded by the gene fragment is 34316.84, the theoretical isoelectric point of the protein encoded by the gene fragment is 9.65, and the nucleic acid sequence inserted in the plasmid, the amino acid sequence encoded by the nucleic acid sequence is a repetitive pattern, which is multiple

[0042] A series connection of the "GEFYFDLRLKGDKGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGS" unit.

[0043] It will be appreciated that in the development of any actual implementation, as in any engineering or design project, numerous implementation-specific decisions may be made. Such a development effort may be complex and time-consuming, but will be a routine task of design, fabrication, and production for those of ordinary skill having the benefit of this disclosure without undue experimentation.

[0044] It should be noted that the above embodiments are only used to illustrate the technical solutions of the present invention rather than to limit it. Although the present invention has been described in detail with reference to the preferred embodiments, those skilled in the art should understand that the technical solutions of the present invention may be modified or replaced by equivalents without departing from the spirit and scope of the technical solutions of the present invention, which should all be included in the scope of the claims of the present invention.

Claims

1. A comprehensive anti-aging cosmetic comprising recombinant type III and type IV collagen, characterized in that: The raw materials include the following raw materials in parts by weight: 5-8 parts of recombinant type III collagen, 3-5 parts of recombinant type IV collagen, 2-4 parts of sodium hyaluronate, 4-5 parts of niacinamide, 1-2 parts of vitamin E acetate, 8-10 parts of squalane, 6-8 parts of phytosteryl oleate, 8-12 parts of glycerol, 5-6 parts of butylene glycol, 1-2 parts of carbomer, 0.5-1.5 parts of triethanolamine, 0.8-1.2 parts of phenoxyethanol, 0.2-0.4 parts of essence, 0.3-0.6 parts of tripeptide-1 copper, 0.2-0.5 parts of acetyl heptapeptide-4, and 0.5-0.8 parts of ergothioneine, which are added to 100 parts of deionized water.

2. The comprehensive anti-aging cosmetic comprising recombinant type III and type IV collagen according to claim 1, characterized in that: The raw materials include the following raw materials in parts by weight: 5 parts of recombinant type III collagen, 3 parts of recombinant type IV collagen, 2 parts of sodium hyaluronate, 4 parts of niacinamide, 1 part of vitamin E acetate, 8 parts of squalane, 6 parts of phytosteryl oleate, 10 parts of glycerol, 5 parts of butylene glycol, 1 part of carbomer, 0.5 parts of triethanolamine, 0.8 parts of phenoxyethanol, 0.2 parts of essence, 0.3 parts of tripeptide-1 copper, 0.3 parts of acetyl heptapeptide-4, and 0.5 parts of ergothioneine, which are added to 100 parts of deionized water.

3. The method for preparing a comprehensive anti-aging cosmetic containing recombinant type III and type IV collagen according to claim 1, characterized in that: The following steps are involved: S1. Preparation of aqueous phase: Add deionized water to the main stirring pot, and introduce nitrogen in advance to exclude oxygen, raise the temperature to 70-75°C, first use an ultrasonic homogenizer to briefly treat carbomer at a speed of 400-600rpm and then pour it into the stirring pot, then add glycerol and butylene glycol in turn, stir at a speed of 300-400rpm, and continue stirring for 20-30 minutes to ensure that all raw materials are fully dissolved to form a uniform water phase; S2. Oil phase preparation: Add squalane, phytosteryl oleate, tocopherol acetate and 0.5 parts of silane coupling agent into the oil phase pot, heat to 70-75° C., stir evenly to obtain the oil phase. S3, emulsification: The oil phase obtained from S2 is added to the water phase of S1, and a twin-screw emulsifier is used to mix and emulsify the oil and water phases, maintaining the temperature at 70-75°C, and homogenizing and emulsifying at a speed of 500-600rpm for 10-15 minutes to form a preliminary emulsion. When the emulsion temperature drops to 40-45°C, recombinant type III collagen, recombinant type IV collagen, niacinamide, tripeptide-1 copper, acetyl heptapeptide-4, and ergothioneine are added in sequence, and stirred evenly at a speed of 200-300rpm to maintain the system temperature unchanged; then triethanolamine is added to adjust the pH value of the system to 5.5-6.5, and then phenoxyethanol and essence are added, and stirring is continued for 10-15 minutes to mix, and finally deionized water is added to make up to 100 parts, and after stirring evenly, the material is discharged and canned after passing the inspection.