G10 type bovine rotavirus nanobody and application thereof
By constructing and screening G10 bovine rotavirus nanobodies, the problem of insufficient coverage of existing vaccines has been solved, achieving efficient neutralization and specific detection of G10 BRV, and providing a more effective means of prevention and control.
Patent Information
- Application Number
- CN202511902088.0
- Authority / Receiving Office
- CN · China
- Patent Type
- Patents(China)
- Current Assignee / Owner
- Filing Date
- 2025-12-17
- Publication Date
- 2026-03-03
- Estimated Expiration
- 2045-12-17
AI Technical Summary
Existing bovine rotavirus vaccines have limited coverage of circulating G10 BRV strains, and maternal antibody interference and viral mutations result in insufficient broad-spectrum and long-lasting immune protection. There is a lack of effective specific antiviral drugs and efficient prevention and control strategies.
G10 bovine rotavirus nanobodies were developed, including specific CDR and framework region amino acid sequences. By constructing phage display libraries, panning, and enriching, highly efficient and specific neutralizing nanobodies were obtained for the preparation of kits and drugs for the detection and treatment of bovine rotavirus.
The 4F nanobody exhibits high neutralizing activity and detection sensitivity, and can specifically recognize G10 type BRV at high dilutions, without cross-reactivity with other pathogens, providing a more efficient means of prevention and control.
Smart Images

Figure CN121362246B_ABST
Abstract
Description
Technical Field
[0001] This invention belongs to the field of nanobody technology, specifically relating to a G10 bovine rotavirus nanobody and its application. Background Technology
[0002] Calf diarrhea is a serious disease that severely threatens livestock farming, especially in newborn calves where morbidity and mortality rates are high. Clinically, it mainly manifests as acute watery diarrhea, dehydration, and electrolyte imbalance. Without timely treatment, the mortality rate can exceed 90%. It is also prone to secondary bacterial infections such as E. coli and Salmonella, severely impacting calf survival and farming efficiency. This disease is primarily caused by various pathogenic microorganisms, with bovine rotavirus (BRV) being the most prevalent causative agent.
[0003] BRV (Rotavirus) belongs to the genus Rotavirus of the family Reoviridae. It invades the epithelial cells of the small intestine villi, impairing their nutrient absorption function and leading to severe diarrhea. This virus is highly contagious and can be transmitted through fecal contamination of the environment, especially during cold seasons and in pastures with poor sanitation. Current treatment focuses on rehydration and acid correction, such as oral glucose-glycine solution or intravenous electrolyte solutions, supplemented by antibiotics to control secondary infections. However, there are currently no specific antiviral drugs. In terms of prevention and control, existing vaccines (including maternal immunization and active immunization) combined with hygiene management are the main methods. However, due to the existence of multiple BRV serotypes, current vaccines have limited coverage of prevalent strains such as G10. Furthermore, factors such as maternal antibody interference and continuous viral mutation result in insufficiently broad-spectrum and durable immune protection. Therefore, developing more efficient and targeted new prevention and control strategies against prevalent strains, including G10 BRV (BRV-BLR strain), is particularly urgent. Summary of the Invention
[0004] The purpose of this invention is to provide a nanobody for detecting G10 bovine rotavirus.
[0005] This invention provides a bovine rotavirus nanobody, wherein the amino acid sequence of CDR1 of the nanobody is shown in SEQ ID NO. 9, the amino acid sequence of CDR2 of the nanobody is shown in SEQ ID NO. 10, and the amino acid sequence of CDR3 of the nanobody is shown in SEQ ID NO. 11.
[0006] Further specifying, the amino acid sequence of the nanobody is shown in SEQ ID NO.7.
[0007] Further specifying, the amino acid sequence of frame region FR1 is shown in SDQ ID NO.12, the amino acid sequence of FR2 is shown in SDQ ID NO.13, the amino acid sequence of FR3 is shown in SDQ ID NO.14, and the amino acid sequence of FR4 is shown in SDQ ID NO.15.
[0008] The present invention provides a drug for treating bovine rotavirus, the drug containing the above-mentioned bovine rotavirus nanobody.
[0009] The present invention provides a nucleotide sequence encoding the above-mentioned rotavirus nanobody nucleotide sequence or its complementary sequence.
[0010] The present invention provides an expression vector containing the above-described nucleotide sequence.
[0011] The present invention provides a host cell containing the above-described expression vector.
[0012] This invention provides the application of the above-mentioned bovine rotavirus nanobody in the preparation of a kit for detecting bovine rotavirus or a drug for treating bovine rotavirus infection.
[0013] This invention provides the application of the above-mentioned expression vector in the preparation of a kit for detecting bovine rotavirus or a drug for treating bovine rotavirus infection.
[0014] This invention provides the use of the above-mentioned host cells in the preparation of a kit for detecting bovine rotavirus or a drug for treating bovine rotavirus infection.
[0015] This invention provides a kit for detecting bovine rotavirus, wherein the kit is an ELISA kit, and the bovine rotavirus nanobody described in any one of claims 1-3 is used as a capture antibody, and BRV-VP6 is used as a detection antibody.
[0016] Beneficial effects: Obvious lesions were observed starting from a 512-fold dilution of nanobody 4F; FRNT 50 =588, exhibiting high neutralizing activity; when the antigen is diluted to a high dilution of 1:6400 and the antibody concentration is as low as 0.625 μg / mL, its OD... 450 The value was still significantly higher than the negative control, indicating that the target antigen could still be effectively detected under these conditions, fully demonstrating the excellent detection sensitivity of VHH-4F. It showed no cross-reactivity with other non-target components (G6 BRV, BPIV3, BVDV, PPRV, IBRV, and BCoV), exhibiting high specificity. Based on checkerboard titration analysis, a 1:1600 antigen coating concentration and a VHH-4F concentration of 1.25 μg / mL are recommended as optimized working conditions for subsequent applications. This combination ensures high signal intensity (OD).450 While maintaining a target of approximately 1.030, the cost-effectiveness of antibody use should also be taken into account. Attached Figure Description
[0017] Figure 1 Image showing the results of alpaca serum titer testing;
[0018] Figure 2 Figure 1 shows the construction results of the anti-bovine rotavirus nanobody phage library; Figure 2 shows the results of the first round of nested PCR amplification; Figure 3 shows the results of the second round of nested PCR amplification; Figure 4 shows the results of the second round of nested PCR enzyme digestion; Figure 5 shows the results of phage vector enzyme digestion; Figure 6 shows the results of PCR identification of bacterial culture.
[0019] Figure 3 ELISA results of crude extracts of anti-bovine rotavirus nanobody strains after three rounds of screening; A shows the positive rate results of the first, second, and third rounds of screening; B shows the positive rate results of inter-batch and intra-batch replicates of positive strains in the third round of screening.
[0020] Figure 4 Figures showing the expression, purification, and identification results of anti-bovine rotavirus nanobodies; A is the SDS-PAGE result: 1 is the uninduced supernatant of 4F, 2 is the induced supernatant of 4F, 3 is the liquid after elution with 4F flow-through, 4 is the liquid after washing with 40mM imidazole, 5 is the liquid after washing with 60mM imidazole, 6 is the liquid after washing with 100mM imidazole, and 7-9 are the liquids after washing with 250mM imidazole; B is the ELISA identification result; C is the IFA identification result.
[0021] Figure 5 Figure showing the results of neutralizing titer assay for anti-bovine rotavirus nanobodies;
[0022] Figure 6 Image showing the specific detection results of anti-bovine rotavirus nanobodies;
[0023] Figure 7 Image showing the sensitivity detection results of anti-bovine rotavirus nanobodies;
[0024] Figure 8 The results of the application of anti-bovine rotavirus nanobody sandwich ELISA. Detailed Implementation
[0025] G6 type BRV (BRV-C73 strain) and G10 type BRV (BRV-BLR strain) are described in the article "Efficient and robust reverse genetics system for bovine rotavirus generation and its application for antiviral screening. Virol Sin. 2024 Sep 28:S1995-820X(24)00149-4.doi: 10.1016 / j.virs.2024.09.010".
[0026] Example 1. Construction of an alpaca immune and phage display library
[0027] 1.1 Alpaca Immunization
[0028] Positive immunization: The BRV-BLR strain previously isolated in our laboratory was amplified, 0.3% formaldehyde was added, and the mixture was inactivated at 37°C for 72 hours. This inactivated strain was used as the immunogen. The viral titer before antigen inactivation was 1×10⁻⁶. 8.0 TCID 50 / ml, after inactivation, prepare immunogen. For the first immunization, use 1ml of inactivated antigen and emulsify with an equal volume of Freund's complete adjuvant. For subsequent immunizations, use 1ml of inactivated antigen and emulsify with an equal volume of Freund's incomplete adjuvant. Immunize once every two weeks for a total of four immunizations. Each alpaca is immunized with 2ml each time. Venous blood is collected two weeks later.
[0029] Negative: Unimmunized alpaca venous blood was used as a negative control.
[0030] 1.2 Construction of Phage Library 50 ml of immunized alpaca venous blood was collected, and peripheral blood lymphocytes were extracted using a peripheral blood lymphocyte extraction kit. Total RNA was then extracted from the peripheral blood lymphocytes using chloroform extraction, and the RNA was reverse transcribed into cDNA using a reverse transcription kit. Primers VHH-F1 and VHH-R1 were designed based on the conserved regions at both ends of the VHH sequence. Using cDNA as a template, and using the amplified product as a template, second-round PCR primers Pb3-VHH-FR1-F and Pb3-VHH-FR4-R were designed based on the conserved regions FR1 and FR4 in the alpaca VHH sequence and the restriction enzyme sites of the pComb3 vector for nested PCR. The resulting product was the cDNA library. Primer sequences are shown in Table 1. The phage was ligated into the phage vector pComb 3, and the ligation product was then transformed into competent TG1 cells by electroporation. The bacterial culture was serially diluted 10-fold, and 100 μL of each dilution was plated onto 2×YTAG plates with two replicates for each dilution. The culture was incubated overnight at 37°C. The next day, the library volume was calculated based on the colony growth at each dilution, and 22 single colonies were randomly selected for colony PCR to verify the insertion of the VHH gene. All colonies were then collected, added to glycerol, and stored at -80°C to obtain the phage library.
[0031] Table 1 Primers required for constructing the anti-bovine rotavirus nanobody phage library and primers required for constructing the VHH-BLR prokaryotic expression plasmid.
[0032]
[0033] Note: W = A or T, R = A or G, Y = C or T, M = A or C.
[0034] The results showed that the serum titer of alpacas was highest two weeks after the fourth immunization. Figure 1 Lymphocytes were isolated from alpaca venous blood two weeks after the fourth immunization, and total RNA was extracted from the lymphocytes, reverse transcribed, and then amplified by nested PCR. The first-round amplification product was approximately 750 bp. Figure 2 In the A section, the second-round amplification product is around 400bp. Figure 2 The B in the sequence improved the specificity of the VHH sequence. Subsequently, the phage vector (pComb3) and the second round of amplification products were digested with SifⅠ enzyme. Figure 2 (C and D in the sample) were then ligated into a phage vector using T4 DNA ligase, resulting in a library with a volume of 1.9 × 10⁻⁶. 7 A phage display library of PFU / ml was used to randomly select single colonies. Colony PCR was performed to detect the positivity of recombinant phages. A target band at 750bp was considered positive, and below 750bp was considered negative. The results of the bacterial culture PCR showed (…). Figure 2Of the 23 single colonies randomly selected in the E) sample, 20 were positive, with a positive rate of 86.95%. Sequencing of the positive colonies revealed that the amino acid sequences of these 20 positive bacteria were different, indicating the rich diversity of the phage library.
[0035] Example 2. Screening and enrichment of anti-bovine rotavirus nanobodies
[0036] Purified BRV was used to coat immunotubes (2 ml / tube) at a concentration of 1:100 using CBS as the coating solution. The next day, unbound viruses were removed by washing with PBS, and the tubes were blocked for 2 hours with MPBS containing 2% skim milk powder to block non-specific binding sites on the surface of the immunotubes and reduce non-targeted phage adsorption in subsequent steps. The library of bacteria was inoculated into 2×YTAG medium and cultured until the logarithmic growth phase (OD200). 600 =0.4), KM13 helper phage was added to infect the host bacteria. After centrifugation, the medium was replaced with 2×YTAK medium (containing kanamycin and ampicillin), and cultured overnight at 30°C with shaking to induce phage secretion. The next day, after centrifugation to remove bacterial cells, the supernatant was concentrated by PEG / NaCl precipitation, followed by resuspension with PBS and blocking with MPBS to reduce nonspecific background. The treated phage was co-incubated with BRV-coated immunosorbent tubes, and unbound or weakly bound phages were removed by rigorous washing (ten washes with alternating PBST and PBS). Subsequently, specifically bound phages were eluted with 100 mM triethylamine (TEA) solution. TEA achieves gentle elution by disrupting the electrostatic or hydrogen bonding between protein and phage, avoiding damage to phage activity. After elution, the phages were neutralized with Tris-HCl (pH=7.4) and then used to infect TG1 Escherichia coli (OD1) in the logarithmic growth phase. 600 =0.4), and after centrifugation and resuspending the bacterial cells, the infected bacterial solution was plated on 2×YTAG solid medium and incubated overnight at 30°C to isolate single colonies. The plate colonies were collected and resuspended on 2×YT medium, glycerol (final concentration 15%) was added, and the mixture was aliquoted and frozen at -70°C to obtain the primary library (named VHH-C73-1). The above operations were repeated to screen the primary and secondary libraries, for a total of three rounds of screening.
[0037] The results, as shown in Table 2, indicate that after three rounds of screening, the output number of each round increases with the number of screenings. The output number of the first round is 2.05 × 10⁻⁶. 6 PFU / ml, increased to 1.50×10 in the second round. 7 PFU / ml, increased to 3.21×10 in the third round. 9 PFU / ml, and the output count in each round using coated CBS as a negative control did not show significant changes, all remaining within 10. 4The enrichment data showed that the enrichment degree from the first round of screening to the second round was 0.119, indicating a good enrichment effect. The enrichment degree from the second round to the third round of screening was 0.04, indicating a good enrichment effect. Moreover, the output number of the third round of screening increased by about 100 times compared with the second round. Therefore, screening was stopped and preliminary identification of the Chinese library bacteria in the third round of screening was started.
[0038] Table 2 Results of three rounds of screening for anti-bovine rotavirus nanobodies
[0039]
[0040] Example 3. Specificity identification of crude extract of anti-bovine rotavirus nanobody
[0041] The specificity of the strains output from each round of screening was preliminarily identified by ELISA. Eighty monoclonal strains were picked from each output plate from each round of screening and inoculated into three 96-well deep-well plates. Each well contained 200 μL of 2×YTAG medium and was incubated at 30°C with shaking. After 8 hours, 20 μL of bacterial culture was transferred from each well and inoculated into 180 μL of 2×YTAG medium, and incubated at 37°C with shaking. The remaining bacterial culture on the original plates was diluted with 60 μL of 60% glycerol to a final concentration of 15%, and the culture was stored at -80°C. After 1 hour of incubation with shaking, KM13 helper phage was added to each well, and the plates were incubated at 37°C for 30 minutes, followed by shaking at 37°C for 40 minutes. The plates were centrifuged at 1800 × g for 10 minutes, the supernatant was discarded, and the pellet was resuspended in 400 μL of 2×YTAK medium in each well and incubated overnight with shaking at 30°C. The following day, the deep-well plate was centrifuged at 5000 × g for 10 minutes. 250 μL of phage supernatant was transferred from each well to a new deep-well plate, and 200 μL of blocking buffer (PBS buffer containing 5% BSA) was added to each well. The plate was incubated at 37°C for 1 hour, ready for indirect ELISA detection. Purified BRV was used to coat 96-well microplates at a concentration of 1:100, 100 μL per well, and incubated overnight at 4°C. A CBS-coated microplate was also used as a negative control. The following day, the coating liquid was discarded, and 200 μL of 5% BSA was added to each well, which was then blocked at 37°C for 1 hour. Discard the blocking buffer from the wells. Add 100 μL of phage supernatant treated with the blocking buffer to each well as primary antibody. Incubate at 37°C for 1 hour. Wash the plate three times with PBST. Add 100 μL of HRP-M13 Antibody (1:10000 dilution) to each well and incubate at 37°C for 1 hour. Wash the plate three times with PBST. Add 100 μL of chromogenic substrate to each well and incubate in the dark for 15 minutes. Then add 100 μL of stop solution to each well to terminate the reaction. Read the OD values using a microplate reader at a main wavelength of 450 nm and a reference wavelength of 630 nm. Analyze the ELISA results and determine the positive well numbers.
[0042] The results showed that 80 single colonies were selected from the plates output from the first round of screening to prepare crude nanobody extract, which was detected by ELISA. Figure 3 In step A), three positive bacteria were found, with a positive rate of approximately 4%. Eighty single colonies were picked from the plates output from the second round of screening to prepare crude nanobody extracts, which were then analyzed by ELISA. Figure 3 In step A), 51 positive bacteria were found, with a positive rate of approximately 73.7%. Eighty single colonies were picked from the plates output from the third round of screening to prepare crude nanobody extracts, which were then detected by ELISA. Figure 3In section A), 75 positive bacteria were found, with a positive rate of approximately 94%. Subsequently, inter-batch and intra-batch replicates were performed on the crude nanobody extract of the third round of exported bacteria. The results of inter-batch and intra-batch replicates (…) Figure 3 B) The results were the same as the initial test. Subsequently, the positive bacteria in the third round of output were sequenced, and the positive bacteria with better ELISA identification results were selected for expression identification.
[0043] Example 4. Expression, purification and identification of anti-bovine rotavirus nanobodies
[0044] Glyceryl bacteria corresponding to the positive wells were inoculated into 1 ml of 2 × YTAG medium and cultured at 37°C with shaking. The culture was then sent to a sequencing company for sequencing. After the sequencing results were returned, they were analyzed and combined with the preliminary specificity identification results of ELISA to determine the prokaryotic expression clone. Glyceryl bacteria of the strain to be cloned were inoculated into 5 ml of 2 × YTAG medium and cultured at 37°C with shaking for 12 h. Plasmids were extracted using a plasmid mini-extraction kit as template plasmids for prokaryotic expression. Primers for prokaryotic expression (Pcold-VHH-BRV-F, Pcold-VHH-BRV-R, see Table 1) were then designed based on the sequence information to amplify the VHH sequence of the nanobody and ligate it into the pCold-6×his prokaryotic expression vector via infusion to construct recombinant plasmids for prokaryotic expression of the nanobody. The recombinant plasmids were transformed into the BL21(DE3) strain to obtain the corresponding nanobody expression strain and induced at 16°C with shaking for 20 h. The expression of the nanobody was verified by SDS-PAGE, and the nanobody expressed in the supernatant was purified for further verification.
[0045] Protein purification: Inoculate 100 mL of LB medium with engineered bacteria containing the target plasmid. Incubate at 37°C and 220 rpm with shaking until the bacterial culture reaches OD500. 600 Reach a concentration of 0.4-0.6. Add IPTG to the culture to a final concentration of 0.5 mM. Adjust the temperature to 16℃ and the rotation speed to 200 rpm, inducing expression for 14-16 hours. After induction, aliquot the bacterial culture into 50 mL centrifuge tubes. Centrifuge at 12,000 g for 5 minutes at 4℃, collect the bacterial pellet, and carefully discard the supernatant. Add 10 mL of Lysis Buffer to each bacterial pellet. Resuspend the bacterial pellet thoroughly using a vortex mixer or pipette. Place the resuspended bacterial culture on ice and sonicate to disrupt the protein.
[0046] Sonication parameters: 3 seconds on, 5 seconds off, total duration 20 minutes or until the bacterial suspension becomes clear. Centrifuge the sonicated lysate at 4°C and 12,000g for 15-20 minutes. After centrifugation, carefully transfer the supernatant (containing soluble target protein) to a new centrifuge tube. Filter the supernatant using a 0.45 μm filter membrane to remove residual small particles and prevent column clogging. Take 3 mL of nickel column affinity packing and equilibrate with Lysis Buffer for at least 5-10 column volumes. Mix the filtered supernatant obtained in the previous step with the equilibrated nickel column packing at 4°C. Place on a rotary shaker or mixer and gently mix for 1-2 hours to ensure the target protein fully binds to the packing. Repack the packing into the column and collect the flow-through.
[0047] The column was washed sequentially with wash buffers containing different concentrations of imidazole to remove non-specifically bound proteins. Washing was repeated with 40 mM imidazole wash buffer, followed by 60 mM imidazole wash buffer, and then 100 mM imidazole wash buffer. The target protein was eluted with elution buffer containing 250 mM imidazole, collecting 1 mL of eluent per tube for a total of 3-5 tubes. The eluent was immediately analyzed by SDS-PAGE to determine which tubes contained high-purity target protein. For ELISA identification, purified BRV was coated onto 96-well microplates at a concentration of 1:100, 100 μL per well, and incubated overnight at 4°C. CBS coating was used as a negative control. The next day, the coating liquid was discarded, and 200 μL of 5% BSA was added to each well, blocking at 37°C for 1 hour. Discard the blocking buffer from the wells. Add 100 μL of purified nanobody as primary antibody to each well, incubate at 37°C for 1 hour, wash three times with PBST, add 100 μL of HRP-Anti-Llama (Sino Biological, 1:10000) to each well, incubate at 37°C for 1 hour, and wash three times with PBST. Add 100 μL of chromogenic substrate to each well, incubate in the dark for 15 minutes, and then add 100 μL of stop solution to each well to terminate the reaction. Read the OD values using a microplate reader at a main wavelength of 450 nm and a reference wavelength of 630 nm. Analyze the ELISA results and determine the positive well numbers. The rest is the same.
[0048] Indirect immunofluorescence (IFA) identification: Marc-145 cells were first seeded in 96-well plates and cultured for 48 h, then inoculated with G10 BRV (BRV-BLR strain). After obvious lesions appeared, the cells were fixed with pre-cooled anhydrous ethanol at -20°C for 30 min. The cells were washed with PBS to remove fixative residue, and then 200 μL of blocking buffer (PBS buffer solution containing 5% BSA) was added and incubated at 37°C for 1 h. The purified nanobody was then added and incubated overnight at 4°C. The next day, His-Tag monoclonal antibody (Proteintech, 1:1000) was added and incubated at 37°C for 1 h. Finally, FITC-labeled goat anti-mouse IgG was added and incubated at 37°C for 1 h. After washing, the fluorescence signal was observed under a fluorescence microscope.
[0049] The results showed that the obtained 4F nanobody sequence was cloned into the pcold-6×His vector for expression verification, and the SDS-PAGE results were as follows ( Figure 4 As shown in A), the obtained nanobody molecular weight is around 15 kDa, and the nanobody expression level is high. ELISA identification results ( Figure 4 B) shows that, compared with alpaca negative and positive sera, the purified nanobody 4F can specifically bind to G10 type BRV (BRV-BLR strain); IFA identification results ( Figure 4 As shown in C), the purified nanobody 4F can specifically bind to G10 type BRV (BRV-BLR strain) and exhibits a specific fluorescent signal, while no obvious fluorescent signal is observed in the cellular background.
[0050] 4F amino acid sequence: (SEQ ID NO.7) QGVQAQVQLVESGGGTVQPGGSLRLSCAISGSISSMNAMGWYRQIPGKERELVAALSSSDSPWYTDSPVKGRSTIARDKNKNTLYLNIYNLKPEDTATYYCAAWRYENRIVVPATAVGYWGKGTQVTVTT;
[0051] 4F nucleotide sequence: (SEQ ID NO.8) CAAGGTGTCCAGGCTCAGGTGCAGCTCGTGGAGTCTGGGGGAGGCACGGTGCAGCCCGGGGGGTCTCTGAGACTCTCCTGTGCAATCTCTGGAAGCATTTCCAGTATGAATGCCATGGGCTGGTATCGCCAAATTCCCGGGAAGGAGCGCGAGTTAGTCGCAGCCCTTAGTAGTTCTGATAGTCCATGGTACA CAGACTCTCCTGTGAAGGGCCGGTCCACCATCGCCCGAGACAAGAACAAGAACACGCTGTATTTAAATATTTACAACCTGAAAACCTGAGGACACGGCCACTTATTACTGCGCGGCGTGGCGATACGAAAATCGTATAGTGGTACCGGCCACCGCGGTGGGGTACTGGGGCAAAGGGACCCAGGTCACCGTCACCACA;
[0052] 4F Complementary Determinant Region:
[0053] CDR1: AISGSISSMNAM (SEQ ID NO.9);
[0054] CDR2: LSSSDSPWYT (SEQ ID NO.10);
[0055] CDR3:AAWRYENRIVVPATAV (SEQ ID NO.11);
[0056] 4F Frame Area:
[0057] FR1: QGVQAQVQLVESGGGTVQPGGSLRLSC (SEQ ID NO.12);
[0058] FR2: MGWYRQIPGKERELVAA (SEQ ID NO.13);
[0059] FR3:DSPVKGRSTIARDKNKNTLYLNIYNLKPEDTATYYC (SEQ ID NO.14);
[0060] FR4: GYWGKGTQVTVTT (SEQ ID NO. 15).
[0061] Example 5. Application of anti-bovine rotavirus nanobodies
[0062] Neutralization activity assay: G10 BRV (BRV-BLR strain) was treated with 50 μg / ml trypsin solution at 37°C for 1 hour; purified nanobodies were serially diluted 2-fold starting at a 1:4 ratio using serum-free DMEM maintenance medium containing 10 μg trypsin; the trypsin-treated virus was diluted to 1000 TCID. 50 The diluent was serum-free DMEM containing 10 μg / ml trypsin. An equal volume of the diluted virus was added to the serially diluted nanobody sample, shaken at 75 rpm for 5 min, and neutralized at 37°C for 1 hour. Marc-145 cells cultured in 96-well cells for 48 hours were washed twice with 100 μL / well PBS. The serum-virus mixture was added to the 96-well cells, with two replicates per sample, added sequentially according to the nanobody dilution factor from highest to lowest. Adsorption was performed at 37°C for 1 hour. The adsorption buffer was discarded, and the cells were washed once with 100 μL / well PBS. Serum-free DMEM containing 10 μg / ml trypsin was added for maintenance, and the cells were incubated at 37°C. CPE was observed daily. The endpoint was determined after 5 days of culture, and the neutralizing antibody titer was calculated using the Reed-Muench method.
[0063] Specificity identification: Different pathogens—G6 BRV (BRV-C73 strain), G10 BRV (BRV-BLR strain), bovine parainfluenza virus type 3 (BPIV3), bovine epidemic diarrhea virus (BVDV), small ruminant disease virus (PPRV), bovine infectious rhinotracheitis virus (IBRV), and bovine coronavirus (BCoV)—were coated onto 96-well ELISA plates at a concentration of 1:16, with 100 μL per well. The plates were incubated overnight at 4°C. A CBS-coated ELISA plate was used as a negative control. The next day, the coating liquid was discarded, and 200 μL of 5% BSA was added to each well, which was then blocked at 37°C for 1 hour. Discard the blocking solution in each well. Add the nanobody to be tested to each well and incubate at 37°C for 1 hour. Wash the plate three times with PBST. Add 100 μL of HRP-Anti-Llama (Sino Biological, 1:10000, dilution 1:10000) to each well and incubate at 37°C for 1 hour. Wash the plate three times with PBST. Add 100 μL of chromogenic substrate to each well and incubate in the dark for 15 minutes. Then add 100 μL of stop solution to each well to terminate the reaction. Read the OD values using a microplate reader at a main wavelength of 450 nm and a reference wavelength of 630 nm.
[0064] Sensitivity determination: G10 BRV (BRV-BLR strain) was serially diluted and coated onto 96-well microplates at concentrations of 1:100, 1:200, 1:400, 1:800, 1:1600, 1:3200, 1:6400, and 1:12800, with 100 μL per well. The plates were incubated overnight at 4°C. A CBS-coated microplate was used as a negative control. The next day, the coating liquid was discarded, and 200 μL of 5% BSA was added to each well, which was then blocked at 37°C for 1 hour. Discard the blocking solution in each well. Add different concentrations of the target nanobody 4F to each well: 10 μg / mL, 5 μg / mL, 2.5 μg / mL, 1.25 μg / mL, 0.625 μg / mL, 0.312 μg / mL, 0.156 μg / mL, and 0 μg / mL. Incubate at 37°C for 1 hour, then wash three times with PBST. Add 100 μL of HRP-Anti-Llama (Sino Biological, 1:10000), diluted 1:10000, to each well and incubate at 37°C for 1 hour, then wash three times with PBST. Add 100 μL of chromogenic substrate to each well and incubate in the dark for 15 minutes. Finally, add 100 μL of stop solution to each well to terminate the reaction. Read the OD values using a microplate reader at a main wavelength of 450 nm and a reference wavelength of 630 nm.
[0065] Establishment of the sandwich ELISA method: Purified nanobody 4F was diluted to a concentration of 100 ng / 100 μL / well as the capture antibody, and then coated overnight at 4 °C. Next, 200 μL of blocking buffer (PBS buffer containing 5% BSA) was added and incubated at 37 °C for 1 hour. Then, 50 μL of the test antigen (purified BRV-BLR strain) was added to each well and incubated at 37 °C for 1 hour. Next, rabbit anti-BRV-VP6 (100 ng / well, VP6 was used as a serum antibody obtained by injecting rabbits with the antigen) was added and incubated at 37 °C for 1 hour. Then, HRP-Anti-rabbit (Thermo, 1:10000) was added and incubated at 37 °C for 1 hour. 100 μL of TMB chromogenic solution was added to each well and reacted in the dark for 15 minutes (positive wells showed a blue color). Immediately afterward, 100 μL of stop solution was added to terminate the reaction. OD values were read using a microplate reader at a main wavelength of 450 nm and a reference wavelength of 630 nm.
[0066] The results showed that the purified anti-bovine rotavirus nanobody underwent a neutralization test, such as... Figure 5 The results showed that 4F nanobodies exhibited significant lesions starting from a 512-fold dilution, FRNT. 50 =558, exhibiting high neutralizing activity.
[0067] The prepared anti-bovine rotavirus nanobody 4F was specifically identified using ELISA, and the results are as follows: Figure 6 As shown in the figure. Among them, nanobody 4F showed a specific response to G10 bovine rotavirus (BRV-BLR strain), but no significant reactivity was detected against G6 BRV or other pathogens; sensitivity testing of VHH-4F yielded the following results: Figure 7 As shown, it exhibits a high level of specificity across a wide range of antigen dilutions and antibody concentration gradients, OD 450 The absorbance value showed a clear dose-dependent relationship with both antigen and antibody concentrations. Even when the antigen was diluted to a high dilution of 1:6400 and the antibody concentration was as low as 0.625 μg / mL, its OD value remained relatively stable. 450 The OD values were still significantly higher than those of the negative control, indicating that the target antigen could still be effectively detected under these conditions, fully demonstrating the excellent detection sensitivity of VHH-4F. Furthermore, the reaction system showed extremely low background interference, and the OD values of all CBS-coated negative control wells remained stable at around 0.10, indicating that the antibody did not cross-react with other non-target components and possessed high specificity. Based on the checkerboard titration results, it is recommended that a 1:1600 antigen coating concentration and a VHH-4F concentration of 1.25 μg / mL be used as optimized working conditions in subsequent applications. This combination can ensure high signal intensity (OD... 450 While ≈ 1.030), the cost-effectiveness of antibody use is also taken into account.
[0068] Figure 8 This indicates that BRV-G10 is the detection well for the antigen BRV-BLR strain to be detected, and its OD... 450 The value was 1.14, showing a clear positive signal. The OD of the DMEM negative control well was... 450 The value was 0.16, indicating a low background level, demonstrating that nanobody 4F effectively captured the BRV-BLR antigen and successfully formed a "capture-detection" complex with the subsequently added rabbit anti-BRV-VP6 detection antibody and enzyme-labeled secondary antibody system, thus producing a specific colorimetric reaction. The low negative control value indicates weak non-specific binding and a clean background in the experimental system. These results confirm that nanobody 4F has good capture ability and specificity in a sandwich ELISA system and can be used as an effective capture antibody for detecting G10 bovine rotavirus.
Claims
1. A G10 bovine rotavirus nanobody, characterized in that, The amino acid sequence of CDR1 of the nanobody is shown in SEQ ID NO.9, the amino acid sequence of CDR2 of the nanobody is shown in SEQ ID NO.10, and the amino acid sequence of CDR3 of the nanobody is shown in SEQ ID NO.
11.
2. The G10 bovine rotavirus nanobody according to claim 1, characterized in that, The amino acid sequence of the nanobody is shown in SEQ ID NO.7; the amino acid sequence of the frame region FR1 is shown in SDQ ID NO.12, the amino acid sequence of FR2 is shown in SDQ ID NO.13, the amino acid sequence of FR3 is shown in SDQ ID NO.14, and the amino acid sequence of FR4 is shown in SDQ ID NO.
15.
3. A drug for treating G10 bovine rotavirus, characterized in that, The drug contains the G10 bovine rotavirus nanobody as described in claim 1.
4. A nucleic acid molecule, characterized in that, The nucleic acid molecule encodes the G10 bovine rotavirus nanobody as described in any one of claims 1-3.
5. An expression carrier, characterized in that, The expression vector contains the nucleic acid molecule as described in claim 4.
6. A host cell, characterized in that, The host cell contains the expression vector as described in claim 5.
7. The use of the G10 bovine rotavirus nanobody according to claim 1 or 2 in the preparation of a kit for detecting G10 bovine rotavirus or a medicament for treating G10 bovine rotavirus infection.
8. The use of the expression vector according to claim 5 in the preparation of a kit for detecting G10 bovine rotavirus or a medicament for treating G10 bovine rotavirus infection.
9. The use of the host cell according to claim 6 in the preparation of a kit for detecting G10 bovine rotavirus or a medicament for treating G10 bovine rotavirus infection.
10. A kit for detecting G10 bovine rotavirus, characterized in that, The kit is an ELISA kit, with the G10 bovine rotavirus nanobody as described in any one of claims 1 or 2 as the capture antibody and rabbit anti-BRV-VP6 as the detection antibody; the rabbit anti-BRV-VP6 is a serum antibody obtained by injecting antigen VP6 into a rabbit.
Citation Information
Patent Citations
Heavy chain and domain antibodies
CN101128182A
Bovine rotavirus recombinant VP6 protein antigen and method of preparing the same
CN101367870A