GENETICALLY MODIFIED CHIMERIC DUAL-TARGET ANTIGEN RECEPTOR AND ITS USE

DE602019080240T2Active Publication Date: 2026-01-07WEST CHINA HOSPITAL SICHUAN UNIV
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
DE602019080240
Authority / Receiving Office
DE · DE
Patent Type
Patents
Current Assignee / Owner
Priority Date
2018-12-20
Filing Date
2019-11-12
Publication Date
2026-01-07
Estimated Expiration
2039-11-12

AI Technical Summary

Technical Problem

Chimeric antigen receptor (CAR-T) therapies face challenges in treating solid tumors due to on-target, off-tumor toxicity, difficulty penetrating solid tumor vasculature, and suppression within immunosuppressive microenvironments, particularly in serosal cavity metastases where PD-L1 expression upregulates, limiting their efficacy.

Method used

A genetically engineered dual-targeting chimeric antigen receptor is designed to recognize both VEGFR1 (or HER2) and PD-L1, comprising a scFv antibody, CD8 transmembrane domain, and 4-1BB intracellular domain, linked via a linker peptide, expressed in host cells like T cells to enhance tumor targeting and immune activation.

Benefits of technology

The dual-targeting CAR-Ts effectively kill tumor cells with reduced systemic toxicity, overcoming immunosuppression and enhancing therapeutic efficacy in serosal cavity metastases, particularly for lung, colon, and ovarian cancers.

✦ Generated by Eureka AI based on patent content.
Patent Text Reader
Need to check novelty before this filing date? Find Prior Art

Description

Field of the Invention

[0001] The present invention belongs to the field of genetic engineering, particularly relates to a genetically engineered dual-targeting chimeric antigen receptor, an immunoreactive cell expressing the chimeric antigen receptor, and a use of the chimeric antigen receptor and the immunoreactive cell in preparing drugs for preventing and treating serosal cavity metastasis of malignant tumors.Background of the Invention

[0002] In 2013, immunotherapy for tumors headed the list of Top 10 Scientific and Technological Advances of the Year in Science, among which CAR-T therapy, CTLA-4 and PD-1 / PD-L1 antibody therapy were considered as the three major advances in tumor immunotherapy. Chimeric antigen receptor (CAR) T cells (CAR-Ts) constructed by using antigen antibody scFv fragments in combination with intracellular activation and proliferation signals of T cells enable T cells to directly acquire antibody-specific recognition ability and become effector T cells independent of human leukocyte antigen (HLA) restriction. The killing activity of acquired CAR-Ts mainly depends on recognition of antigens by single chain receptors on surfaces of the CAR-Ts with specific killing activity. Clinical studies have confirmed that such CAR-Ts are able to amplify in vivo, survive for a long time and develop immunological memory, and exhibit efficient anti-tumor activity even for refractory hematologic tumors. Unfortunately, CAR-Ts are facing challenges in the treatment of solid tumors, and have made slow progress in clinical applications so far.

[0003] There are several challenges when CAR-Ts are used for systemic treatment of solid tumors: (1) most of therapeutic targets for solid tumors are tumor-associated antigens (TAAs). Since TAAs are expressed in normal tissues, potential toxicity is presented when targeting TAAs, and "on-target, off-tumor" toxicity is observed in clinical treatment with CAR-Ts targeting Her2, MART1 and CAIX, suggesting that systemic CAR-T treatment for TAAs needs to be designed carefully; (2) for solid tumors treated with CAR-Ts, entry of CAR-Ts into solid tumors through blood vessels is an important step to exert therapeutic effects, but it is difficult for CAR-Ts to pass through basement membrane of blood vessels, which affects the therapeutic effect; and (3) the interior of solid tumors is an immunosuppressive microenvironment in which TGF-β can be secreted, PD-1 / PD-L1 inhibitory signals can be activated, and the activity of effector cells can be suppressed through immunosuppressive cells such as MDSC and Treg. It is clear that there are many difficulties in using CAR-Ts for systemic CAR-T therapy.

[0004] It is believed that the use of CAR-Ts for local treatment of solid tumors can evade the above challenges and play a positive role in treating the specific conditions of patients with specific solid tumors. In the study, CAR-Ts are intended for serosal cavity infusion to prevent and treat serosal cavity metastasis of malignant tumors, so as to investigate the anti-tumor effect and immune mechanism of CAR-Ts in the serosal cavity.

[0005] Malignant tumors such as lung cancer, colon cancer, ovarian cancer, breast cancer, gastric cancer and lymphoma are prone to cause serosal cavity metastasis in pleural cavity, peritoneal cavity and pericardial cavity, often leading to effusions in pleural cavity and peritoneal cavity or further complication with malignant serosal effusion. It is difficult for tumor patients with metastasis in pleural and peritoneal cavities complicated with pleural or peritoneal effusion to tolerate systemic treatment. Even if the patients are clinically treated by drainage and infusion chemotherapy, the efficacy is still limited. Complications such as dyspnea and intestinal obstruction seriously affect the physiological functions and quality of life of patients, and the median survival time is often only 3-6 months. In addition, some tumor patients only show the manifestation of postoperative serosal cavity diffusion, such as peritoneal carcinomatosis (PC). Such patients are eligible to receive cytoreductive surgery and hyperthermic intraperitoneal chemotherapy to significantly prolong the survival rate. Unfortunately, however, even in patients who have received cytoreductive surgery and hyperthermic intraperitoneal chemotherapy, intraperitoneal recurrence occurs in approximately 80% of the patients within three years after treatment, due to inability to effectively remove tumor cells from the peritoneal cavity. Therefore, for such patients with serosal cavity metastasis, local treatment is the main treatment available, but has limited efficacy. Previous studies have shown that once tumor cells were exposed to malignant pleural / peritoneal effusion, epithelial-mesenchymal transition (EMT) could be induced, and produced high-frequency cancer stem cells (CSCs) .Such cells highly expressed drug-resistant proteins such as ABCB1 and ABCG2, generating therapeutic resistance.

[0006] Studies have shown that CAR-Ts also had effective killing activity against CSCs. Some studies have been carried out to investigate local application of CAR-Ts; for example, local intrapleural infusion of MSLN CAR-T targeting Mesothelin in animal experiments had proved the effectiveness and safety of local application. Therefore, the use of CAR-Ts is expected to be an effective means to prevent and treat serosal cavity metastasis of malignant tumors, but researches on application of CAR-Ts in serosal cavity environment are extremely limited worldwide .

[0007] Treatment with CAR-Ts through serosal cavity infusion has two advantages. First, it is safe with low systemic toxicity. CAR-Ts having specific killing activity against tumor cells completely depend on targeted tumor antigens, also kill normal tissues expressing antigens. CAR-Ts exert killing effect in the serosal cavity, despite of massive proliferation, CAR-Ts are less likely to circulate in the blood in large quantities, and are easy to handle locally to eliminate potential toxicity. Second, therapeutic targets of CAR-Ts are extended, and more TAAs can be used as therapeutic targets. Since the serosal cavity is mainly surrounded by connective tissues, and expression profiles are quite different from those of epithelial-derived tumor cells, a large number of epithelial-derived antigens may become potential therapeutic targets. More importantly, the effect of CAR-Ts mainly depends on antigens but not on tumor sources, and thus CAR-Ts have broad-spectrum tumor-killing activity (killing activity against various tumors expressing the antigens), so that serosal cavity metastasis can be treated as a separate indication clinically.

[0008] In a serosal cavity environment, the PD-L1 expression up-regulated in tumor cells and immune cells to escape from immune attacks. It is found that blocking PD-1 / PD-L1 signals can improve the efficacy of CAR-T treatment, but the clinical treatment is expensive, and tumor cells still exhibit a high expression of VEGFR1 or HER2 after treatment of malignant effusion.

[0009] In response to the challenge of up-regulated expression of PD-L1 in tumor cells and immune cells after exposing to serosal effusion, a dual-targeting CAR viral vector targeting both VEGFR1 (or HER2 ) and PD-L1 is designed and constructed based on previous work. In the present invention, dual-targeting CAR-Ts (dual CAT-Ts) of VEGFR1 (or HER2) and PD-L1 are taken as examples to illustrate that the dual-targeting chimeric antigen receptor containing a PD-L1 target can eliminate immune escape of tumor cells, relieve immunosuppression of immune cells and prevent and treat malignant tumors, and can be used for clinically relevant prevention and treatment. Exemplary embodiments of dual-targeting CARs of the prior art comprising a moiety capable of recognizing PD-L1 are disclosed in WO 2018 / 218877 A1 and CN 107 827 990 A.Summary of the Invention

[0010] The present invention is directed to subject matter as defined in the claims.

[0011] The present invention provides a genetically engineered dual-targeting chimeric antigen receptor and a host cell thereof in response to the up-regulated expression of PD-L1 in tumor cells and immune cells after exposing to malignant serosal effusion.

[0012] The first technical problem to be solved by the present invention is to provide a genetically engineered dual-targeting chimeric antigen receptor that can bind two different targets and transmit two signals.

[0013] According to the genetically engineered dual-targeting chimeric antigen receptor provided by the present invention, the dual-targeting chimeric antigen receptor is formed by linking a chimeric antigen receptor 1 and a chimeric antigen receptor 2 capable of recognizing PD-L1 through a linker peptide.

[0014] In the genetically engineered dual-targeting chimeric antigen receptor, the chimeric antigen receptor 2 comprises a single-chain fragment variable (scFv) antibody of PD-L1, a transmembrane domain and an intracellular domain.

[0015] Further, the scFv antibody of PD-L1 refers to a scFv antibody binding PD-L1 molecules on surfaces of tumor cells or immune cells.

[0016] Further, the transmembrane domain is a CD8 transmembrane domain.

[0017] Further, the intracellular domain is a 4-1BB intracellular domain.

[0018] The chimeric antigen receptor 2 is composed of a scFv antibody of human PD-L1, a CD8 transmembrane domain and a 4-1BB costimulatory molecular peptide fragment.

[0019] Specifically, an amino acid sequence of the chimeric antigen receptor 2 is shown in SEQ ID NO: 1:

[0020] Further, a coding nucleotide sequence of the chimeric antigen receptor 2 is shown in SEQ ID NO: 2:

[0021] The chimeric antigen receptor 1 comprises a scFv antibody capable of binding a tumor specific antigen or a tumor-associated antigen, a transmembrane domain and an intracellular immunoreceptor tyrosine-based activation motif.

[0022] The tumor specific antigen or the tumor-associated antigen is at least one of CD19, CD20, MUC1, EGFR, EGFRvIII, HER2, ERBB3, ERBB4, VEGFR1, VEGFR2, EpCAM, CD44 or IGFR.

[0023] The scFv antibody capable of binding a tumor specific antigen or a tumor-associated antigen is a scFv antibody capable of binding EGFR family proteins including EGFR, HER2, ERBB3, ERBB4 or EGFRvIII, VEGFR1, VEGFR2, EpCAM, CD19, CD20 and CD44. Preferably, the scFv antibody is VEGFR1 scFv antibody or HER2 scFv antibody.

[0024] The transmembrane domain is a CD28 transmembrane domain. The transmembrane domains of the chimeric antigen receptors 1 and 2 are selected from different transmembrane domains. In particular, the transmembrane domain of the chimeric antigen receptor 1 is a CD28 transmembrane domain, and the transmembrane domain of the chimeric antigen receptor 2 is a CD8 transmembrane domain.

[0025] The intracellular immunoreceptor tyrosine-based activation motif comprises an immunoreceptor tyrosine-based activation motif signal chain selected from CD3ζ or FcεRI.

[0026] The chimeric antigen receptor 1 is composed of a signal peptide, a scFv antibody of human VEGFR1, a CD28 transmembrane domain and a CD3ζ binding domain.

[0027] An amino acid sequence of the signal peptide is shown in SEQ ID NO: 11: MALPVTALLLPLALLLHAARP.

[0028] A nucleotide sequence of the signal peptide is shown in SEQ ID NO: 12:

[0029] Further, an amino acid sequence of the chimeric antigen receptor 1 is shown in SEQ ID NO: 3:

[0030] Further, a nucleotide sequence of the chimeric antigen receptor 1 is shown in SEQ ID NO: 4:

[0031] On the other hand, the chimeric antigen receptor 1 is composed of a signal peptide, a scFv antibody of human HER2, a CD28 transmembrane domain and a CD3ζ binding domain.

[0032] An amino acid sequence of the signal peptide is shown in SEQ ID NO: 11.

[0033] A nucleotide sequence of the signal peptide is shown in SEQ ID NO: 12.

[0034] Further, an amino acid sequence of the chimeric antigen receptor 1 is shown in SEQ ID NO: 5:

[0035] Further, a coding nucleotide sequence of the chimeric antigen receptor 1 is shown in SEQ ID NO: 6:

[0036] The linker peptide is at least one of Furin or P2A.

[0037] An amino acid sequence of the linker peptide P2A is shown in SEQ ID NO: 7, and a nucleotide sequence encoding the linker peptide P2A is shown in SEQ ID NO: 8. An amino acid sequence of the linker peptide Furin is shown in SEQ ID NO: 9, and a nucleotide sequence encoding the linker peptide Furin is shown in SEQ ID NO: 10.

[0038] An amino acid sequence of the linker peptide P2A is shown in SEQ ID NO: 7: SGSGEGRGSLLTCGDVEENPGP.

[0039] A nucleotide sequence of the linker peptide P2A is shown in SEQ ID NO: 8:

[0040] An amino acid sequence of the linker peptide Furin is shown in SEQ ID NO: 9:RRKR.

[0041] A nucleotide sequence of the linker peptide Furin is shown in SEQ ID NO 10: AGGAGGAAGAGA.

[0042] The chimeric antigen receptor 1 and the chimeric antigen receptor 2 of the present invention are co-expressed by a vector.

[0043] The present invention also provides an expression vector for simultaneous expression of the chimeric antigen receptor 1 and the chimeric antigen receptor 2. Further, the expression vector is a eukaryotic or prokaryotic expression vector, and the eukaryotic expression vector is a plasmid; the prokaryotic expression vector is a viral vector including retrovirus, recombinant lentivirus and recombinant adenovirus; further, the viral vector is pWPXLd.

[0044] The present invention further provides a host cell containing the above expression vector. Preferably, the host cell is an immunoreactive cell, preferably a T cell, a monocyte, a natural killer cell or a neutrophil; and more preferably a T cell or a natural killer cell.

[0045] The present invention further provides the dual-targeting chimeric antigen receptor, the recombinant vector containing the chimeric antigen receptor and the host cell containing the recombinant vector for use in preventing or treating serosal cavity metastasis of malignant tumors.

[0046] Further, in the above use, the malignant tumor is a solid tumor, in particular at least one of lung cancer, hepatocellular carcinoma, colon cancer, rectal cancer, breast cancer, ovarian cancer, gastric cancer, cholangiocarcinoma, gallbladder cancer, esophageal cancer, renal cancer, pancreatic cancer or prostate cancer.

[0047] Compared with the prior the design of CAR-Ts, the present invention has the following advantageous effects: By constructing a recombinant vector containing a dual-targeting chimeric antigen receptor expression unit in the present invention, two chimeric antigen receptors can be simultaneously expressed in a host cell, one chimeric antigen receptor is a receptor that binds a tumor specific antigen or a tumor-associated antigen and is capable of exerting specific targeting effects, and the other chimeric antigen receptor is a PD-L1 receptor that is capable of binding human PD-L1 antigen . When both chimeric antigen receptors are present in the host cell, the effect of simultaneous binding of dual targets can be achieved. The dual-targeting specific binding form in the method of the present invention can be utilized for preparing drugs for preventing and treating serosal cavity metastasis of malignant tumors, and provides a basis for preventing and treating serosal cavity metastasis of malignant tumors.Brief Description of the Drawings

[0048] Fig. 1 is a schematic diagram showing the structure of the dual-targeting chimeric antigen receptor of the present invention (in which the variable region can be replaced by any scFv antibody fragment); Fig. 2 is a schematic diagram of a preferred embodiment for a dual-targeting CAR binding HER2 and PD-L1; Fig. 3 is a flow chart for measuring CAR molecule expression on surfaces of 293T cells; Fig. 4 is a flow chart for measuring CAR molecule expression on surfaces of T cells; Fig. 5 is a flow chart for constructing a stable cell strain; Fig. 6 shows the secretion of IFN-γ results of in vitro killing by two types of CAR-Ts and control T cells; Fig. 7 shows the results of in vitro killing by genetically engineered T cells, and the ratio of viable negative cells and positive cells (T includes three cell types: T, HER2 CAR-T and HER2 / PD-L1 CAR-T; k is short for k562, herk for k562-her2, and hlk for k562-her2-pdl1); Fig. 8 shows the results of HER2 CAR-T and HER2 / PD-L1 CAR-T in treating intraperitoneal implantation models of ovarian cancer SKOV3 in vivo. Detailed Description of the Preferred Embodiments

[0049] The present invention will be described in detail with reference to the preferred embodiments and accompanying drawings. In the following examples, where no specific experimental conditions indicated, they are in accordance with conventional conditions well known to those skilled in the art, such as conditions described in Sambrook J, Russell D.W., 2001,Molecular Cloning:A laboratory manual(3rd ed), Spring Harbor Laboratory Press, or conditions suggested by manufacturers.Example 1 Construction of recombinant lentiviral vector for dual-targeting chimeric antigen receptor

[0050] A recombinant vector for a dual-targeting chimeric antigen receptor was constructed with the following expression framework: HER2 scFv antibody-CD28 transmembrane domain-CD3ζ-Furin-P2A-PD-L1 scFv antibody-CD8 transmembrane domain-4-1BB from 5' to 3'.

[0051] An amino acid sequence of a signal peptide of HER2 is shown in SEQ ID NO: 11, and a nucleotide sequence of the signal peptide of HER2 is shown in SEQ ID NO: 12.

[0052] An amino acid sequence of HER2scFv antibody is shown in SEQ ID NO: 13:

[0053] A coding nucleotide sequence of HER2 scFv antibody is shown in SEQ ID NO: 14:

[0054] An amino acid sequence of a CD28 transmembrane domain is shown in SEQ ID NO: 15:

[0055] A nucleotide sequence of a CD28 transmembrane domain is shown in SEQ ID NO: 16:

[0056] An amino acid sequence of CD3ζ is shown in SEQ ID NO: 17:

[0057] A nucleotide sequence of CD3ζ is shown in SEQ ID NO: 18:

[0058] An amino acid of Furin-P2A is shown in SEQ ID NO: 19: RRKRSGSGEGRGSLLTCGDVEENPGP.

[0059] A coding nucleotide sequence of Furin-P2A is shown in SEQ ID NO: 20:

[0060] An amino acid sequence of a signal peptide of PD-L1 is shown in SEQ ID NO: 11, and a nucleotide sequence of the signal peptide of PD-L1 is shown in SEQ ID NO: 12.

[0061] An amino acid sequence of PD-L1scFv antibody is shown in SEQ ID NO: 21:

[0062] A coding nucleotide sequence of PD-L1scFv antibody is shown in SEQ ID NO: 22:

[0063] An amino acid sequence of the CD8 transmembrane domain is shown in SEQ ID NO: 23:

[0064] A nucleotide sequence of the CD8 transmembrane domain is shown in SEQ ID NO: 24:

[0065] An amino acid sequence of 4-1BB is shown in SEQ ID NO: 25: KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL.

[0066] A nucleotide sequence of 4-1BB is shown in SEQ ID NO: 26:

[0067] A dual-targeting chimeric antigen receptor was synthesized according to the above sequences and inserted into a BamH1-NdeI site (see Fig. 2) of a lentiviral pWPXLd vector (Invitrogen), and then transformed into competent cells of Escherichia coli. After accurate sequencing, plasmids were extracted and purified with a plasmid purification kit from Qiagen by referring to the Kit Instructions for the purification steps to obtain high quality plasmids of the recombinant expression vector. Results of the inserted target fragments are shown in Fig. 1.Example 2 Transformation of cells with recombinant vector1. Culture and passage of 293T cells:

[0068] A biosafety cabinet was opened, then the countertop was wiped with 75% alcohol cotton, and pipettes, pipette tip boxes, 15ml centrifuge tubes, a centrifuge tube rack and 10cm 2< new cell culture dishes were put in the biosafety cabinet. After the cabinet door was closed, a UV switch of the biosafety cabinet was turned on to irradiate for half an hour for disinfection and sterilization. DMEM containing 10% fetal bovine serum and 100U / ml penicillin streptomycin and pancreatin were preheated in a 37°C water bath. The biosafety cabinet was opened, a ventilation switch was turned on, and the culture dish for 293T cells grown to 80%-90% was taken out of a 37°C incubator with 5% CO 2 and put into the biosafety cabinet. The hands, mouth of a medium bottle and a pipette cylinder were disinfected with 75% alcohol. Medium in the culture dish was pipetted completely with a sterile pipette and discarded into a disposal bottle, then 1ml of pancreatin was added to roughly rinse off residual medium in the dish to neutralize a pancreatin inhibitor, and the resulting mixture was subsequently pipetted completely and removed. Next, 1-2ml of pancreatin was added to the culture dish dropwise, cells were observed microscopically, and the pancreatin was pipetted after the cells became round and separated. Then 6-8ml of fresh complete medium was added to the culture dish, and the cells were gently blown down. The cell suspension was divided and put into other culture dishes, and a medium was added to a volume of 10ml per dish. The culture dishes were shaken several times in a cross way for mixing the cells well and put into a 37°C incubator after observation under a microscope. The cell state was observed 24h later, and the next subculture was carried out when the cells grew to 80%-90%.2. Acquisition of lentiviral stock solution:

[0069] Day 1: plating. 90% density of 293T cells were digested, subcultured at 1:5, and cultured overnight at 37°C with 5% CO 2 in an approximately 1.0 × 10 7< cells / 20ml / 15 cm dish. The cell density at 24h was about 50-70% (no more than 70%). Day 2: transfection. The culture solution was changed 2h before transfection, i.e., 20ml preheated 10%DMEM medium with high glucose / dish. All reagents were balanced to room temperature. Transfection steps: a. A DNA mixture of 22.5 µg psPAX2 (packaging plasmid), 11.25 µg pMD.2G (envelope plasmid) and 22.5 µg pWPXLd (lentiviral vector) was prepared in a 50 ml BD tube (per 15cm 2< dish); b. Water was added to 1125 µl; c. 125 µl of 2.5M CaCl 2 was added to the DNA solution dropwise and vortexed for 5s; d. The BD tube was placed on a vortexer (gear 4), then a 2×BBS (1250 µl ) solution was added to the DNA-CaCl 2 mixture dropwise before oscillation for 5s; e. The resulting solution was allowed to stand at room temperature for 15 min, then 2.25ml of transfection mixture was added to the dishes dropwise, gently shaken and mixed well in a cross way (10 times each), and cultured at 37°C with 3% CO 2 (12-16h). The medium was pipetted and washed once with 10 ml PBS. The culture solution was changed, i.e., 15ml of preheated 5%DMEM medium, and cultured at 37°C with 5%CO 2 to 48h. Day 4: 48h after transfection, the cell supernatant was collected, then 15ml of preheated 5%FBS fresh DMEM medium was added, and cultured at 37°C with 5%CO 2 ; the viral supernatant was filtered through a 0.45µm filter and stored at 4°C (no more than 1 week). Day 5: 72h after transfection, the viral supernatant was collected, filtered through a 0.45µm filter and stored at 4°C.3. Concentration of lentivirus:

[0070] Instruments: ultra-speed centrifuge, matched rotor and sleeves, ultra-speed centrifuge tubes and balancing balance. The sleeves and a balance were disinfected under a UV meter in the biosafety cabinet. Appropriate centrifuge tubes were placed into the sleeves after ensuring that there is no droplet in each sleeve. A viral suspension filtered through a 0.45um filter was added to the centrifuge tubes. All centrifuge tubes filled with the viral suspension were strictly balanced by using a balance with accuracy of 0.001g or above. With the sleeves covered, the balance was used again to verify whether the centrifuge tubes were completely balanced. The balanced sleeves were loaded into the rotor of the centrifuge, and prepared for centrifugation. Centrifugation: centrifugation conditions: 20°C, 70000 × g, 2h; wait until the speed of the centrifuge rises to 70000 × g before the centrifugation. After centrifugation, the medium was poured off, and the centrifuge tubes were placed upside down on sterilized filter paper to absorb the remaining medium. The viral precipitate was resuspended with commercially available PBS, with the amount of PBS in each centrifuge tube depending on respective needs, generally 100 µl for each centrifuge tube. Finally, each centrifuge tube was washed with 100 µl of PBS and the eluate was pipetted. The resuspended virus was filled into small EP tubes and stored in a -80°C refrigerator for later use.4. Detection of CAR molecule expression on surfaces of 293T cells infected with concentrated viral solution

[0071] 293Td cells were infected with the HER2-PDL1 dual-CAR viral supernatant. 293Td cells were spread on a 6-well plate, and viral supernatant at 48h was collected. The cells were infected with the supernatant and 10% FBS medium mixture (the supernatant: 10% FBS medium=1:1, 1ml each), 2 ml of 10% FBS medium was changed at 24h, and flow cytometry was carried out at 48h to detect CAR expression (see Fig. 3).5. Separation of human peripheral blood T lymphocytes:

[0072] Blood was taken into anticoagulation tubes, generally 15-20ml at a time. A FICOLL lymphocyte separation medium was slowly added dropwise to the extracted blood at a ratio of lymphocyte separation medium to blood of 1:1. The mixture of lymphocyte separation medium and blood was centrifuged at 1000 × g and 32°C for 45min, the rotate speed was increased / decreased at 3. After centrifugation, it could be seen that the blood was divided into 3 layers, and the layer where lymphocytes were present was an intermediate transparent layer. Lymphocytes in the intermediate transparent layer were pipetted slowly through a pipette tip, without pipetting liquid in the other two layers. The pipetted lymphocytes were added to a 20mL serum-free and antibiotic-free X-VIVO medium and centrifuged at 500 × g for 10min. With the supernatant removed, the precipitated lymphocytes were resuspended with a 10mL sterile red blood cell lysis buffer, with the lysis time not exceeding 5min (2-3min was sufficient). Then the precipitated lymphocytes were centrifuged at 500 × g for 10min. The supernatant was removed, then T lymphocytes were resuspended in 4 ml of 5% human AB serum, 2.5% IL-2 X-vivo medium and ready-for-use X-VIVO medium containing serum and IL-2, followed by cell counting, and the amount of medium added to each well of the 6-well plate was determined according to the cell count, generally with a volume of 3 × 10 6< lymphocytes per well. However, the exact amount to be added was calculated based on the titer of the virus and the amount used to kill experimental cells.

[0073] On the day before viral infection of T cells, the 6-well plate to be used in the viral infection experiment was coated with a RetroNectin diluent (Retronectin was diluted with PBS to a concentration of 50 µg / ml), and each well of the six-well plate was coated with 2ml of diluted retronectin. Then the six-well plate was sealed at 4°C overnight for later use. On the day of infection, the RetroNectin diluent was pipetted, and the 6-well plate was sealed with a 2%BSA (bovine serum albumin) solution (prepared with PBS) for 30min. After BSA was pipetted, the 6-well plate was rinsed several times with PBS (after the step, the 6-well plate can be stored at 4°C for one week). For each well, 1ml lentiviral suspension was prepared, mixed well and added to the 6-well plate for centrifugation at 32°C and 1000 × g for 2h. The 6-well plate was taken out, and rinsed once with PBS after the supernatant was pipetted off. Each well was added with 2mL of PBMC cell suspension at a concentration of 1.5 × 10 6< cell / mL. Then centrifuged at 32°C and 1000 × g for 10min. Then the 6-well plate was cultured in a 37°C incubator with 5% CO 2 , and the culture solution was changed 48h later. During the lentiviral infection, an MOI value between 4 and 40 is optimal.6. Detection of CAR molecule expression on surfaces of T cells after infection of T cells with concentrated virus:

[0074] T cells were infected with the HER2-PDL1 dual-CAR viral supernatant. 293Td cells were spread on a 6-well plate, and viral supernatant at 48h was collected. The cells were infected with the supernatant and 10% medium mixture (the supernatant: 10% medium=1:1, 1ml each), 2mL of 10% medium was changed at 24h, and flow cytometry was carried out at 48h to detect CAR expression (see Fig. 4).

[0075] Screening of target cells: HER2 and / or PDL1-positive tumor cell lines (see Fig. 5) were screened by flow antibody molecule staining, constructing stable target cells / cell strains.

[0076] K562 cell lines are HER2 and PDL1 double negative cell lines, and K562 cell lines capable of stably expressing HER2 and / or PDL1 molecules were constructed by means of lentiviral infection to transfer HER2 and / or PDL1 molecules (see Fig. 5).Culturing of CAR-Ts:

[0077] Peripheral blood mononuclear cells separated from a lymphocyte separation medium (Fillco) by density gradient centrifugation were counted with a cell counting plate to acquire total cell count, and then the same number of identical CD3 / CD28 magnetic beads (Gibco) were added at a ratio of 1:1. In the presence of a magnetic rack, about 10mL of X-VIVO medium was added to a 50mL BD tube, and then the actual volume of magnetic beads calculated by counting was added. After gently blowing for resuspension, the BD tube was placed in the magnetic rack and allowed to stand for 3-4 min, leaving only pure magnetic beads adsorbed on the wall of the BD tube. Peripheral blood mononuclear cells (PBMCs) resuspended with X-VIVO were added to the BD tube. The concentration of the PBMCs was controlled as much as possible at 1-2×10 6< / mL, followed by blowing with a pipette for resuspension. Commercial human AB serum (sigma) with a volume of 5% of the total medium volume was added. With the density of T cells controlled at 1-2×10 6< / mL, up to 3 × 10 6< T cells could be cultured in one well of a 6-well plate, beyond which T cells could be distributed to 2 wells, and so on. The culture solution was changed at least once every 48h, or once every 24h and readjust the cell density if the medium showed obvious yellowing. In the culture of T cells, the clonal morphology was observed every 24h to know the morphological changes of T cells, the tendency of apoptotic senescence and the presence of fungal bacterial contamination. Meanwhile, the total amount of T cells was estimated. Every time the culture solution was changed, serum and IL-2 were dissolved and prepared in real time. It is recommended that T cells are centrifuged at 1300rpm / min at room temperature for 3min with 5mL BD tubes as centrifuge tubes. Example 3 Determination of performance of dual-target CAR-Ts of HER2 and PDL11. Determination of in vitro killing ability of CAR-Ts

[0078] Effector cells and target cells were stained with a Cell Trace ™< CFSE Cell Proliferation Kit (Thermo) and a Cell Trace ™< Far Red Cell Proliferation Kit (Thermo) respectively. The effector cells (e.g., T cells and CAR-Ts) and the target cells (e.g., SKOV3 and 293T cells) were added to a 12-well plate at a ratio of effector cells: target cells (E: T) of 1:1, 2:1, 4:1 and 8:1, with 1*10 6< target cells in each well, and control wells with only effector cells or target cells were added. Among them, SKOV3 was target cells and 293T cell was control negative cells. Results of flow cytometry were observed, and the death or proliferation of the target cells reflected the in vitro killing ability of CAR-Ts (see Fig. 7). The results in Fig. 7 show that the in vitro killing ability of dual-targeting CAR-Ts of HER2 and PDL1 to tumor cells is obviously better than that of single-targeting CAR-Ts of HER2 to the same tumor cells, and even better than that of simple T cells to the same tumor cells.2. Evaluation the killing ability of CAR-Ts and IFN-y secretion in vitro

[0079] An IFN gamma Human ELISA Kit (Thermo) was used, the number of strips required for an experiment was calculated, required strips were taken out and put in a frame, while temporarily unused strips were put back into sealed aluminum foil bags and stored at 4°C. It was recommended to set a background correction well, i.e., a blank well, by simply adding a TMB substrate and a stop buffer to the well. A standard control was required and a standard curve was plotted for each experiment. Samples or standards at different concentrations (100 µl / well) were added to the corresponding wells, and reaction wells were sealed with sealing tape and incubated at room temperature for 120 min. For serum or plasma samples, 50 µl of sample analysis buffer and 50 µl of samples were added successively. For the large dilution volume, the samples and the sample analysis buffer were added in an equal amount. The plate was washed for 5 times and dried on thick absorbent paper at the last time. A biotinylated antibody working solution was added (100µl / well), and reaction wells were sealed with sealing tape and incubated at room temperature for 60 min. The plate was washed for 5 times and dried on thick absorbent paper at the last time. An enzyme conjugate working solution was added (100 µl / well), and reaction wells were sealed with sealing tape and incubated at room temperature away from light for 20 min. The plate was washed for 5 times and dried on thick absorbent paper at the last time. A color developing agent TMB was added (100 µl / well), then the plate was incubated at room temperature away from light for 20 min, and a stop buffer was added (50 µl / well) to measure OD450 immediately after mixing. Judgment of results: the results are valid only when the values of replicate wells are within 20% of the difference range, and mean values of the replicate wells can be used as measured values; and the OD value of each standard or sample should be subtracted from the OD value of the background correction well to plot a standard curve. With the concentrations of standards as the X-coordinate and OD values as the Y-coordinate, coordinate points of the standards are connected by a smooth line. The concentration of each sample can be found on the standard curve by the corresponding OD value; if the OD value of the sample is higher than the upper limit of the standard curve, the sample should be re-tested after appropriate dilution, and the concentration should be calculated by multiplying the dilution factor (see Fig. 6). The results in Fig. 6 show that the in vitro killing ability of dual-target CAR-Ts of ERBB2 and PDL1 to tumor cells is obviously better than that of simple T cells to the same tumor cells.3. HER2 CAR-Ts and HER2 / PD-L1 dual-targeting CAR-Ts for treatment of intraperitoneal implantation models of ovarian cancer SKOV3 in mice

[0080] Intraperitoneal models of ovarian cancer SKOV3 in mice. Female 8-12week old NOD.Cg-PrkdcscidIl2rgtmWjl / SzJ (NSG) mice were selected, and injected intraperitoneally with 5 × 10 5< FLuc-GFP SKOV3 cells. Different types of 5 × 10 6< CAR T cells were injected intraperitoneally 10 days later, and the second intraperitoneal injection of CAR-Ts was performed 7 days later. Tumor burden was measured by bioluminescence imaging with a Xenogen IVIS imaging system (Xenogen) every 7 days from the first injection of CAR-Ts. The acquired bioluminescence data were analyzed by Living Image software (Xenogen). According to the results in Fig. 8, dual-targeting CAR-Ts of HER2 / PDL1 were significantly more efficacious than HER2 CAR-Ts in the treatment of intraperitoneal models of SKOV3 in mice.

[0081] According to the above test results, the dual-targeting chimeric antigen receptor containing HER2 and PD-L1 constructed in the present invention had a certain anti-tumor effect in vitro, and the in vitro tests have verified the efficiency thereof, providing a more effective treatment method for malignant tumors. The results showed that the in vitro killing ability of dual-targeting CAR-Ts of HER2 and PDL1 provided by the present invention to tumor cells is obviously better than that of single-targeting CAR-Ts of HER2 to the same tumor cells, and even better than that of simple T cells to the same tumor cells.

Claims

1. A genetically engineered dual-targeting chimeric antigen receptor, characterized in that the dual-target chimeric antigen receptor is formed by linking a chimeric antigen receptor 1 and a chimeric antigen receptor 2 capable of recognizing PD-L1 through a linker peptide, the linker peptide is at least one of Furin or P2A; the chimeric antigen receptor 2 comprises a single-chain fragment variable (scFv) antibody of PD-L1, a CD8 transmembrane domain and a 4-1BB intracellular domain; the scFv antibody of PD-L1 refers to a scFv antibody of binding PD-L1 molecules on surfaces of tumor cells or immune cells; the chimeric antigen receptor 1 comprises a scFv antibody capable of binding a tumor specific antigen or a tumor-associated antigen, a CD28 transmembrane domain and an intracellular immunoreceptor tyrosine-based activation motif; the tumor specific antigen or the tumor-associated antigen is at least one of CD19, CD20, MUC1, EGFR, EGFRvIII, HER2, ERBB3, ERBB4, VEGFR1, VEGFR2, EpCAM, CD44 or IGFR; the intracellular immunoreceptor tyrosine-based activation motif comprises an immunoreceptor tyrosine-based activation motif signal chain selected from CD3ζ or FcεRI.

2. The dual-targeting chimeric antigen receptor according to claim 1, characterized in that the dual-targeting chimeric antigen receptor is characterized in that the chimeric antigen receptor 2 is composed of a scFv antibody of human PD-L1, a CD8 transmembrane domain and a 4-1BB costimulatory molecular peptide fragment.

3. The dual-targeting chimeric antigen receptor according to claim 2, characterized in that an amino acid sequence of the chimeric antigen receptor 2 is shown in SEQ ID NO: 1 or a coding nucleotide sequence of the chimeric antigen receptor 2 is shown in SEQ ID NO: 2.

4. The dual-targeting chimeric antigen receptor according to claim 1, characterized in that the scFv antibody capable of binding a tumor specific antigen or a tumor-associated antigen is a scFv antibody capable of binding EGFR, HER2, ERBB3, ERBB4, EGFRvIII, VEGFR1, VEGFR2, EpCAM, CD19, CD20 or CD44; preferably the dual-targeting chimeric antigen receptor is further characterized in that the scFv antibody capable of binding a tumor specific antigen or a tumor-associated antigen is VEGFR1 scFv antibody or HER2 scFv antibody.

5. The dual-targeting chimeric antigen receptor according to claim1, characterized in that the chimeric antigen receptor 1 is a scFv antibody of human VEGFR1, a CD28 transmembrane domain and a CD3ζ binding domain; preferably the dual-targeting chimeric antigen receptor is further characterized in that an amino acid sequence of the chimeric antigen receptor 1 is shown in SEQ ID NO: 3 or in that a coding nucleotide sequence of the chimeric antigen receptor 1 is shown in SEQ ID NO: 4.

6. The dual-targeting chimeric antigen receptor according to claim 1, characterized in that the chimeric antigen receptor 1 is a scFv antibody of human HER2, a CD28 transmembrane domain and a CD3ζ binding domain; preferably the dual-targeting chimeric antigen receptor is further characterized in that an amino acid sequence of the chimeric antigen receptor 1 is shown in SEQ ID NO: 5 or in that a coding nucleotide sequence of the chimeric antigen receptor 1 is shown in SEQ ID NO: 6.

7. The dual-targeting chimeric antigen receptor according to claim 1, characterized in that the chimeric antigen receptor 1 and the chimeric antigen receptor 2 are co-expressed by a vector.

8. An expression vector for simultaneous expression of the dual-targeting chimeric antigen receptor according to any one of claims 1 to 7.

9. A host cell containing the expression vector according to claim 8.

10. The dual-targeting chimeric antigen receptor according to any one of claims 1 to 7, the expression vector according to claim 8 and the host cell according to claim 9 for use in preventing or treating serosal cavity metastasis of a malignant tumor; preferably the malignant tumor is a solid tumor and is at least one of lung cancer, hepatocellular carcinoma, colon cancer, rectal cancer, breast cancer, ovarian cancer, gastric cancer, cholangiocarcinoma, gallbladder cancer, esophageal cancer, renal cancer, pancreatic cancer or prostate cancer.