A therapeutic combination comprising a t1git antagonist, a pd-1 antagonist, and a chemotherapeutic agent(s)

Abstract

Provided herein are methods of treating cancer, which comprise administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; and (c) one or more chemotherapeutic agents. Also provided are kits containing such agents and uses of therapeutic combinations of such agents for the treatment of cancer.

Description

[0001] A THERAPEUTIC COMBINATION COMPRISING A T1GIT ANTAGONIST, A PD-1 ANTAGONIST, AND A CHEMOTHERAPEUTIC AGENT(S)1

[0002] FIELD

[0003] Provided herein are methods for treating cancer, an infectious disease, or an infection using a combination of (a) a T cell immunoreceptor with Ig and ITIM domains (TIGIT) antagonist, (b) a programmed death I protein (PD-1) antagonist, and (c) one or more chemotherapeutic agents.

[0004] CROSS-REFERENCE TO RELATED APPLICATIONS

[0005] This application claims the benefit of U.S. Provisional Patent Application No, 63 / 231,525, filed August 10, 2021 and U.S. Provisional Patent Application No. 63 / 327,070, filed April 4, 2022, each of which is incorporated by reference herein in its entirety.

[0006] REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY

[0007] The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety’. The XML file, created on August 1, 2022, is named 25305-WO-PCT_SL.XML and is 352 KB in size.

[0008] BACKGROUND OF THE INVENTION

[0009] TIGIT is an immunomodulatory receptor expressed primarily on activated T cells and NK cells. TIGIT is also blown as VSIG9, VSTM3, and WUCAM. Its structure shows one extracellular immunoglobulin domain, a type 1 transmembrane region and two ITIM motifs. TIGIT forms part of a co-stimulatoty network that consists of positive (CD226) and negative (TIGIT) immunomodulatory' receptors on T cells, and ligands expressed on APCs (CD155 and CD 112).

[0010] An important feature in the structure of TIGIT is the presence of an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic tail domain. As with PD-1, the ITIM domain in the cytoplasmic region of TIGIT is predicted to recruit tyrosine phosphatases, such as SHP-1 and SHP-2, and subsequent de-phosphorylation of tyrosine residues within the immunoreceptor tyrosine-base activation motifs (IT AM) on T cell receptor (TCR) subunits. Hence, ligation of TIGIT by receptor-ligands CD155 and CD112 expressed by tumor cells or TAMS may contribute to the suppression of TCR-signaling and T cell activation, which is essential for mounting effective anti-tumor immunity. Thus, an antagonist antibody specific for TIGIT could inhibit the CD155 and CD112 induced suppression of T cell responses and enhance anti-tumor immunity. PD-1 is recognized as an important player in immune regulation and the maintenance of peripheral tolerance. Immune checkpoint therapies targeting PD-1 or its ligand (e.g., PD- L1) have resulted in groundbreaking improvements in clinical response in multiple human cancer types (Brahmer et al., N Engl J Med, 366: 2455-2465 (2012); Garon et al., N Engl J Med, 372:2018-2028 (2015); Hamid et al., N Engl J Med, 369:134-144 (2013); Robert et al., Lancet, 384:1109-1117 (2014); Robert et al., N Engl J Med, 372: 2521-2532 (2015); Robert et al., N Engl J Med, 372:320-330 (2015); Topalian et al., N Engl J Med, 366:2443-2454 (2012); Topalian et al., J Clin Oncol, 32:1020-1030 (2014); Wolchok et al., N Engl J Med, 369:122-133 (2013)). Immune therapies targeting the PD-1 axis include monoclonal antibodies directed to the PD-1 receptor (e.g., KEYTRUDA®(pembrolizumab), Merck and Co., Inc., Kenilworth, NJ; OPDIVO®(nivolumab), Bristol-Myers Squibb Company, Princeton, NJ) and those that bind to the PD-L1 ligand (e.g., TECENTRIQ®(atezolizumab), Genentech, San Francisco, CA). Chemotherapeutic agents typically provide non-specific usage of intracellular poisons to inhibit mitosis or induce DNA damage. For example, chemotherapeutic agents are cytotoxic by means of interfering with cell division (mitosis) but cancer cells vary widely in their susceptibility to these agents. Chemotherapy can be thought of as a way to damage or stress cells, which may then lead to cell death if apoptosis is initiated. SUMMARY The present disclosure provides methods, pharmaceutical compositions, uses and kits of treating a cancer, an infectious disease, or an infection using a combination of therapeutic agents, e.g., a combination of antibodies or antigen binding fragments thereof. The present disclosure provides methods of treating a cancer, an infectious disease, or an infection using a combination of a TIGIT antagonist (e.g., antibody (e.g., monoclonal antibody) or antigen binding fragment thereof), a PD-1 antagonist (e.g., antibody (e.g., monoclonal antibody) or antigen binding fragment thereof), and one or more chemotherapeutic agents (e.g., alkylating agents, antimetabolites, anti-microtubule agents, etc.). Among other things, the present disclosure encompasses insights that certain combinations of immune checkpoint inhibitors (e.g., a TIGIT antagonist and a PD-1 antagonist) in combination with one or more chemotherapeutic agents (e.g., alkylating agents (e.g., cisplatin), antimetabolites (e.g., 5-fluorouracil, gemcitabine, capecitabine), anti- microtubule agents (e.g., paclitaxel), etc.) as provided herein may enhance the efficacy without significant added toxicity as compared with existing treatments. While it has been proposed that the efficacy of anti-TIGIT antagonistic antibodies and anti-PD-1 antagonistic antibodies might be enhanced if administered in combination with other approved or experimental cancer therapies, there are no clear guidelines as to which agent combined with the anti-TIGIT antagonistic antibodies and anti-PD-1 antagonistic antibodies may be effective or in which patients the combination may enhance the efficacy of treatment. The present disclosure provides methods of treating cancer (e.g., esophageal cancer, triple negative breast cancer (TNBC), biliary cancer, gastric cancer, etc.) using a combination of a TIGIT antagonist, a PD-1 antagonist, 5-fluorouracil represented by Formula (I), and cisplatin represented by Formula (II). I) I) osure provides methods of treating cancer (e.g., esophageal cancer, TNBC, biliary cancer, gastric cancer etc.) using a combination of a TIGIT antagonist, a PD-1 antagonist, and paclitaxel represented by Formula (III) or a pharmaceutically acceptable salt thereof. I) of treating cancer (e.g., esophageal cancer, TNBC, biliary cancer, etc.) using a combination of a TIGIT antagonist, a PD-1 antagonist, gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof, and cisplatin represented by Formula (II). V) rovides methods of treating cancer (e.g., esophageal cancer, TNBC, biliary cancer, etc.) using a combination of a TIGIT antagonist, a PD-1 antagonist, capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof, and oxaliplatin represented by Formula (VI). V) ides kits including a TIGIT antagonist, a PD-1 antagonist, 5-fluorouracil and cisplatin. The present disclosure further provides kits including a TIGIT antagonist, a PD-1 antagonist, and paclitaxel or a pharmaceutically acceptable salt thereof. The present disclosure further provides kits including a TIGIT antagonist, a PD-1 antagonist, gemcitabine or pharmaceutically acceptable salt thereof and cisplatin. The present disclosure further provides kits including a TIGIT antagonist, a PD-1 antagonist, capecitabine or pharmaceutically acceptable salt thereof and oxaliplatin. Also provided herein are uses of a therapeutic combination for treating cancer (e.g., esophageal cancer), wherein the therapeutic combination includes a TIGIT antagonist, a PD-1 antagonist, 5-fluorouracil and cisplatin. Also provided herein are uses of a therapeutic combination for treating cancer (e.g., TNBC), wherein the therapeutic combination includes a TIGIT antagonist, a PD-1 antagonist, and paclitaxel or a pharmaceutically acceptable salt thereof. Also provided herein are uses of a therapeutic combination for treating cancer (e.g., biliary cancer), wherein the therapeutic combination includes a TIGIT antagonist, a PD-1 antagonist, gemcitabine or pharmaceutically acceptable salt thereof and cisplatin. Also provided herein are uses of a therapeutic combination for treating cancer (e.g., gastric cancer), wherein the therapeutic combination includes a TIGIT antagonist, a PD-1 antagonist, capecitabine or pharmaceutically acceptable salt thereof and oxaliplatin. In one aspect, provided herein is a method of treating cancer, comprising administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) 5-fluorouracil; and (d) cisplatin. In one aspect, provided herein are therapeutic combinations for use in treating cancer, comprising administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In one aspect, provided herein is a method of treating cancer, comprising administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) gemcitabine or pharmaceutically acceptable salt thereof; and (d) cisplatin. In one aspect, provided herein is a method of treating cancer, comprising administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) capecitabine or pharmaceutically acceptable salt thereof; and (d) oxaliplatin. In some embodiments, the cancer is selected from the group consisting of osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney cancer, leukemia, renal transitional cell cancer, bladder cancer, Wilm’s cancer, ovarian cancer, pancreatic cancer, breast cancer, prostate cancer, bone cancer, lung cancer (e.g., non-small cell lung cancer), gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, head and neck cancer, squamous cell carcinoma, lymphoma (e.g., diffuse large B-cell lymphoma (DLBCL) or non- Hodgkin lymphoma (NHL)), multiple myeloma, renal cell cancer, retinoblastoma, hepatoblastoma, hepatocellular carcinoma, melanoma, rhabdoid tumor of the kidney, Ewing's sarcoma, chondrosarcoma, brain cancer, glioblastoma, meningioma, pituitary adenoma, vestibular schwannoma, primitive neuroectodermal tumor, medulloblastoma, astrocytoma, anaplastic astrocytoma, oligodendroglioma, ependymoma, choroid plexus papilloma, polycythemia vera, thrombocythemia, idiopathic myelfibrosis, soft tissue sarcoma, thyroid cancer, endometrial cancer, and carcinoid cancer. In some embodiments, the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, triple negative breast cancer (TNBC) and gastric cancer. In some embodiments, the cancer is esophageal cancer, TNBC, biliary cancer or gastric cancer. In certain embodiments, the cancer is metastatic. In some embodiments, the cancer is relapsed. In other embodiments, the cancer is refractory. In yet other embodiments, the cancer is relapsed and refractory. In certain embodiments, the cancer is resectable. In another aspect, provided herein is a kit comprising: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) 5-fluorouracil; and (d) cisplatin. In certain embodiments, the kit further comprises instructions for administering to a human patient the TIGIT antagonist, the PD-1 antagonist, 5-fluorouracil, and cisplatin. In another aspect, provided herein is a kit comprising: (a) a TIGIT antagonist; (b) a PD-1 antagonist; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In certain embodiments, the kit further comprises instructions for administering to a human patient the TIGIT antagonist, the PD-1 antagonist, and paclitaxel or a pharmaceutically acceptable salt thereof. In another aspect, provided herein is a kit comprising: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) gemcitabine or pharmaceutically acceptable salt thereof; and (d) cisplatin. In certain embodiments, the kit further comprises instructions for administering to a human patient the TIGIT antagonist, the PD-1 antagonist, gemcitabine or a pharmaceutically acceptable salt thereof and cisplatin. In another aspect, provided herein is a kit comprising: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) capecitabine or pharmaceutically acceptable salt thereof; and (d) oxaliplatin. In certain embodiments, the kit further comprises instructions for administering to a human patient the TIGIT antagonist, the PD-1 antagonist, capecitabine or a pharmaceutically acceptable salt thereof and oxaliplatin. In still another aspect, provided herein is use of a therapeutic combination for treating cancer in a human patient in need thereof, wherein the therapeutic combination comprises an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) 5-fluorouracil; and (d) cisplatin. In still another aspect, provided herein is use of a therapeutic combination for treating cancer in a human patient in need thereof, wherein the therapeutic combination comprises an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In still another aspect, provided herein is use of a therapeutic combination for treating cancer in a human patient in need thereof, wherein the therapeutic combination comprises an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) gemcitabine or pharmaceutically acceptable salt thereof; and (d) cisplatin. In still another aspect, provided herein is use of a therapeutic combination for treating cancer in a human patient in need thereof, wherein the therapeutic combination comprises an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) capecitabine or pharmaceutically acceptable salt thereof; and (d) oxaliplatin. In certain embodiments of the methods, pharmaceutical compositions, kits, uses, or the combinations for use provided herein, the subject is a human patient. In certain embodiments the methods, pharmaceutical compositions, kits, uses, or the combinations for use provided herein are for treating cancer. In certain embodiments of the methods, pharmaceutical compositions, kits, uses or the combinations for use provided herein, the cancer is esophageal cancer, TNBC, biliary cancer, or gastric cancer. In certain embodiments of the methods, pharmaceutical compositions, kits, or uses provided herein, the PD-1 antagonist is an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof. In other embodiments of the methods, pharmaceutical compositions, kits, or uses provided herein, the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof. In some embodiments of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody is a humanized antibody. In other embodiments of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody is a human antibody. In some embodiments of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-L1 monoclonal antibody is a humanized antibody. In other embodiments of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-L1 monoclonal antibody is a human antibody. In certain embodiments of the methods, pharmaceutical compositions, kits, or uses provided herein, the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof. In some embodiments of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human TIGIT monoclonal antibody is a humanized antibody. In other embodiments of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human TIGIT monoclonal antibody is a human antibody. In still other embodiments of the methods, pharmaceutical compositions, kits, uses provided herein, the anti-PD-1 antibody is independently selected from pembrolizumab, nivolumab, cemiplimab, sintilimab, tislelizumab, camrelizumab and toripalimab. In one embodiment of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody is pembrolizumab. In another embodiment of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody is nivolumab. In another embodiment of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody is cemiplimab. In yet another embodiment of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is pidilizumab (U.S. Pat. No.7,332,582). In yet another embodiment of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is AMP-514 (MedImmune LLC, Gaithersburg, MD). In yet another embodiment of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is PDR001 (U.S. Pat. No.9,683,048). In yet another embodiment of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is BGB-A317 (U.S. Pat. No.8,735,553). In yet another embodiment of the methods, pharmaceutical compositions, kits, or uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is MGA012 (MacroGenics, Rockville, MD). In certain embodiments of the methods, kits, or uses provided herein, the anti-human TIGIT monoclonal antibody comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110. In some embodiments of the methods, kits, or uses provided herein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152. In other embodiments of the methods, kits, or uses provided herein, the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295. In one specific embodiment of the methods, kits, or uses provided herein, the PD-1 antagonist is pembrolizumab; and the TIGIT antagonist is a monoclonal antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110. In one specific embodiment of the methods, kits, or uses provided herein, the PD-1 antagonist is nivolumab; and the TIGIT antagonist is a monoclonal antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110. In one specific embodiment of the methods, kits, or uses provided herein, the PD-1 antagonist is cemiplimab; and the TIGIT antagonist is a monoclonal antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110. In another aspect, provided herein is a method of enhancing T cell activity, comprising contacting the T cells with: (a) an anti-human TIGIT antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (b) an anti-human PD-1 antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (c) 5-fluorouracil; and (d) cisplatin. In another aspect, provided herein is a method of enhancing T cell activity, comprising contacting the T cells with: (a) an anti-human TIGIT antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (b) an anti-human PD-1 antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In another aspect, provided herein is a method of enhancing T cell activity, comprising contacting the T cells with: (a) an anti-human TIGIT antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (b) an anti-human PD-1 antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (c) gemcitabine or a pharmaceutically acceptable salt thereof; and (d) cisplatin. In another aspect, provided herein is a method of enhancing T cell activity, comprising contacting the T cells with: (a) an anti-human TIGIT antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (b) an anti-human PD-1 antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (c) capecitabine or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin. In some embodiments, the enhancement of T cell activity occurs in vitro. In other embodiments, the enhancement of T cell activity occurs in vivo. For example, the enhancement is in a subject including but not limited to a human subject or human patient. In certain embodiments, the enhancement of T cell activity is measured by increased cytokine production. In other embodiments, the enhancement of T cell activity is measured by increased cell proliferation. In some embodiments, provided herein is a method of increasing cytokine production of T cells, comprising contacting the T cells with: (a) an anti-human TIGIT antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (b) an anti-human PD-1 antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (c) 5-fluorouracil; and (d) cisplatin. In some embodiments, provided herein is a method of increasing cytokine production of T cells, comprising contacting the T cells with: (a) an anti-human TIGIT antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (b) an anti-human PD-1 antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In some embodiments, provided herein is a method of increasing cytokine production of T cells, comprising contacting the T cells with: (a) an anti-human TIGIT antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (b) an anti-human PD-1 antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (c) gemcitabine or a pharmaceutically acceptable salt thereof; and (d) cisplatin. In some embodiments, provided herein is a method of increasing cytokine production of T cells, comprising contacting the T cells with: (a) an anti-human TIGIT antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (b) an anti-human PD-1 antibody (e.g., monoclonal antibody) or antigen binding fragment thereof; (c) capecitabine or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin. In some embodiments, the increased cytokine production of T cells occurs in vitro. In other embodiments, the increased cytokine production of T cells occurs in vivo. In some embodiments of the methods, kits, or uses described herein, the human patient is administered about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab, and pembrolizumab is administered once every three weeks. In one embodiment, the human patient is administered about 200 mg pembrolizumab once every three weeks. In one embodiment, the human patient is administered about 240 mg pembrolizumab once every three weeks. In one embodiment, the human patient is administered about 2 mg / kg pembrolizumab once every three weeks. In certain embodiments of the methods, kits, or uses described herein, the human patient is administered about 400 mg pembrolizumab, and pembrolizumab is administered once every six weeks. In other embodiments of the methods, kits, or uses described herein, the human patient is administered about 240 mg or about 3 mg / kg nivolumab once every two weeks, or about 480 mg nivolumab once every four weeks. In one specific embodiment, the human patient is administered about 240 mg nivolumab once every two weeks. In one specific embodiment, the human patient is administered about 3 mg / kg nivolumab once every two weeks. In one specific embodiment, the human patient is administered about 480 mg nivolumab once every four weeks. In yet other embodiments of the methods, kits, or uses described herein, the human patient is administered about 350 mg cemiplimab, and cemiplimab is administered once every three weeks. In some embodiments of the methods, kits, or uses described herein, the human patient is administered about 200 mg, about 240 mg, or about 2 mg / kg of the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprising a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295, and the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof is administered once every three weeks. In one embodiment, the human patient is administered about 200 mg of the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof once every three weeks. In one embodiment, the human patient is administered about 240 mg of the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof once every three weeks. In one embodiment, the human patient is administered about 2 mg / kg of the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof once every three weeks. In certain embodiments of the methods, kits, or uses described herein, the human patient is administered about 400 mg of the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprising a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295, and e anti-human TIGIT monoclonal antibody or antigen binding fragment thereof is administered once every six weeks. In yet still other embodiments of the methods, kits, or uses described herein, the human patient is administered about 3000 mg / m2to about 4000 mg / m25-fluorouracil, wherein the 5-fluorouracil is administered five times every three weeks. In some embodiments, the human patient is administered about 600 or about 800 mg / m25- fluorouracil a day. In some embodiments, the human patient is administered about 40 mg / m2to about 100 mg / m2cisplatin, wherein the cisplatin is administered once every three weeks. In some embodiments, the human patient is administered about 60 or about 80 mg / m2cisplatin, wherein the cisplatin is administered once every three weeks. In some embodiments, the human patient is administered: (a) about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks; (b) about 200 mg, about 240 mg, or about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three or six weeks; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil per cycle (e.g., about 600 mg / m2or 800 mg / m2per day five times every three weeks); and (d) about 60 mg / m2or 80 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks; (b) about 200 mg, about 240 mg, or about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil per cycle (e.g., about 600 mg / m2or 800 mg / m2per day five times every three weeks); and (d) about 60 mg / m2or 80 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 200 mg pembrolizumab once every three weeks; (b) about 200 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil per cycle (e.g., about 600 mg / m2or 800 mg / m2per day five times every three weeks); and (d) about 60 mg / m2or 80 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 240 mg pembrolizumab once every three weeks; (b) about 240 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil per cycle (e.g., about 600 mg / m2or 800 mg / m2per day five times every three weeks); and (d) about 60 mg / m2or 80 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 2 mg / kg pembrolizumab once every three weeks; (b) about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil per cycle (e.g., about 600 mg / m2or 800 mg / m2per day five times every three weeks); and (d) about 60 mg / m2or 80 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 400 mg pembrolizumab once every six weeks; (b) about 400 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every six weeks; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil per cycle (e.g., about 600 mg / m2or 800 mg / m2per day five times every three weeks); and (d) about 60 mg / m2or 80 mg / m2cisplatin once every three weeks. In a specific embodiment, provided herein is a method of treating esophageal cancer, comprising administering to a human patient in need thereof: (a) about 200 mg pembrolizumab once every three weeks; (b) about 200 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil per cycle (e.g., about 600 mg / m2or 800 mg / m2per day five times every three weeks); and (d) about 60 mg / m2or 80 mg / m2cisplatin once every three weeks. In some embodiments, the human patient is administered about 70 mg / m2to about 100 mg / m2paclitaxel, wherein the paclitaxel is administered once every week. In some embodiments, the human patient is administered about 80 mg / m2or about 90 mg / m2paclitaxel, wherein the paclitaxel is administered once every week. In some embodiments, the human patient is administered: (a) about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks; (b) about 200 mg, about 240 mg, or about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three or six weeks; and (c) about 80 mg / m2or about 90 mg / m2paclitaxel once every week. In certain embodiments, the human patient is administered: (a) about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks; (b) about 200 mg, about 240 mg, or about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; and (c) about 80 mg / m2or about 90 mg / m2paclitaxel once every week. In certain embodiments, the human patient is administered: (a) about 200 mg pembrolizumab once every three weeks; (b) about 200 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; and (c) about 80 mg / m2or about 90 mg / m2paclitaxel once every week. In certain embodiments, the human patient is administered: (a) about 240 mg pembrolizumab once every three weeks; (b) about 240 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; and (c) about 80 mg / m2or about 90 mg / m2paclitaxel once every week. In certain embodiments, the human patient is administered: (a) about 2 mg / kg pembrolizumab once every three weeks; (b) about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; and (c) about 80 mg / m2or about 90 mg / m2paclitaxel once every week. In certain embodiments, the human patient is administered: (a) about 400 mg pembrolizumab once every six weeks; (b) about 400 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every six weeks; and (c) about 80 mg / m2or about 90 mg / m2paclitaxel once every week. In a specific embodiment, provided herein is a method of treating TNBC, comprising administering to a human patient in need thereof: (a) about 200 mg pembrolizumab once every three weeks; (b) about 200 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; and (c) about 80 mg / m2or about 90 mg / m2paclitaxel once every week. In yet still other embodiments of the methods, kits, or uses described herein, the human patient is administered about 500 mg / m2to about 1500 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof, wherein the gemcitabine or a pharmaceutically acceptable salt thereof is administered every three weeks. In some embodiments, the human patient is administered about 800 mg / m2to about 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof, wherein the gemcitabine or a pharmaceutically acceptable salt thereof is administered every three weeks. In some embodiments, the human patient is administered about 800 mg / m2or about 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof, wherein the gemcitabine or a pharmaceutically acceptable salt thereof is administered every three weeks. In some embodiments, the human patient is administered about 10 mg / m2to about 50 mg / m2cisplatin, wherein the cisplatin is administered once every three weeks. In some embodiments, the human patient is administered about 20 mg / m2to about 25 mg / m2cisplatin, wherein the cisplatin is administered once every three weeks. In some embodiments, the human patient is administered about 20 or about 25 mg / m2cisplatin, wherein the cisplatin is administered once every three weeks. In some embodiments, the human patient is administered: (a) about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks; (b) about 200 mg, about 240 mg, or about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three or six weeks; (c) about 800 mg / m2or 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks; and (d) about 20 mg / m2or 25 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks; (b) about 200 mg, about 240 mg, or about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 800 mg / m2or 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks; and (d) about 20 mg / m2or 25 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 200 mg pembrolizumab once every three weeks; (b) about 200 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 800 mg / m2or 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks; and (d) about 20 mg / m2or 25 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 240 mg pembrolizumab once every three weeks; (b) about 240 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 800 mg / m2or 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks; and (d) about 20 mg / m2or 25 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 2 mg / kg pembrolizumab once every three weeks; (b) about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 800 mg / m2or 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks; and (d) about 20 mg / m2or 25 mg / m2cisplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 400 mg pembrolizumab once every six weeks; (b) about 400 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every six weeks; (c) about 800 mg / m2or 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks; and (d) about 20 mg / m2or 25 mg / m2cisplatin once every three weeks. In a specific embodiment, provided herein is a method of treating biliary cancer, comprising administering to a human patient in need thereof: (a) about 200 mg pembrolizumab once every three weeks; (b) about 200 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 800 mg / m2or 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks; and (d) about 20 mg / m2or 25 mg / m2cisplatin once every three weeks. In some embodiments of the methods, kits, or uses described herein, the human patient is administered about 500 mg / m2to about 1500 mg / m2capecitabine or a pharmaceutically acceptable salt thereof, wherein the capecitabine or a pharmaceutically acceptable salt thereof is administered twice a day. In some embodiments, the human patient is administered about 750 mg / m2to about 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof, wherein the capecitabine or a pharmaceutically acceptable salt thereof is administered twice a day. In some embodiments, the human patient is administered about 750 mg / m2or about 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof, wherein the capecitabine or a pharmaceutically acceptable salt thereof is administered twice a day. In some embodiments, the human patient is administered about 80 mg / m2to about 150 mg / m2oxaliplatin, wherein the oxaliplatin is administered once every three weeks. In some embodiments, the human patient is administered about 100 mg / m2to about 130 mg / m2oxaliplatin, wherein the oxaliplatin is administered once every three weeks. In some embodiments, the human patient is administered about 100 or about 130 mg / m2oxaliplatin, wherein the oxaliplatin is administered once every three weeks. In some embodiments, the human patient is administered: (a) about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks; (b) about 200 mg, about 240 mg, or about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three or six weeks; (c) about 750 mg / m2or 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks; (b) about 200 mg, about 240 mg, or about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 750 mg / m2or 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 200 mg pembrolizumab once every three weeks; (b) about 200 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 750 mg / m2or 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 240 mg pembrolizumab once every three weeks; (b) about 240 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 750 mg / m2or 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 2 mg / kg pembrolizumab once every three weeks; (b) about 2 mg / kg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 750 mg / m2or 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin once every three weeks. In certain embodiments, the human patient is administered: (a) about 400 mg pembrolizumab once every six weeks; (b) about 400 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every six weeks; (c) about 750 mg / m2or 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin once every three weeks. In a specific embodiment, provided herein is a method of treating gastric cancer, comprising administering to a human patient in need thereof: (a) about 200 mg pembrolizumab once every three weeks; (b) about 200 mg of an anti-human TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 once every three weeks; (c) about 750 mg / m2or 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin once every three weeks. In certain embodiments of the methods, kits and uses provided herein, the anti-human TIGIT monoclonal antibody and the anti-human PD-1 monoclonal antibody are administered on the same day. In some embodiments, the anti-human TIGIT monoclonal antibody and the anti-human PD-1 monoclonal antibody are administered sequentially. In other embodiments, the anti-human TIGIT monoclonal antibody and the anti-human PD-1 monoclonal antibody are administered concurrently. In some embodiments, the anti-human TIGIT monoclonal antibody and the anti-human PD-1 monoclonal antibody are co-formulated. BRIEF DESCRIPTION OF THE FIGURES Figure 1 shows tumor volume size as a function of time for one or more cancer treatments, including the combination treatment of a PD-1 antagonist, a TIGIT antagonist, 5- Fluorouracil (5-FU) and cisplatin. Figure 2 shows changes in tumor volume at Day 17 for one or more cancer treatments, including the combination treatment of a PD-1 antagonist, a TIGIT antagonist, 5- FU and cisplatin. Figure 3 depicts tumor volume size as a function of time for one or more cancer treatments, including the combination treatment of a PD-1 antagonist, a TIGIT antagonist, gemcitabine and cisplatin. Figure 4 depicts best overall response shown as percentage change in tumor volume at the end of study for one or more cancer treatments, including the combination treatment of a PD-1 antagonist, a TIGIT antagonist, gemcitabine and cisplatin. DETAILED DESCRIPTION OF THE INVENTION Definitions Certain technical and scientific terms are specifically defined below. Unless specifically defined elsewhere in this document, all other technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this disclosure relates. “About” when used to modify a numerically defined parameter (e.g., the dose of an anti-TIGIT antibody or antigen binding fragment thereof, an anti-PD-1 antibody or antigen binding fragment thereof, 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin twice a day or the length of treatment time with a combination therapy described herein) means that the parameter is within 20%, within 15%, within 10%, within 9%, within 8%, within 7%, within 6%, within 5%, within 4%, within 3%, within 2%, within 1%, or less of the stated numerical value or range for that parameter; where appropriate, the stated parameter may be rounded to the nearest whole number. For example, a dose of about 5 mg / kg may vary between 4.5 mg / kg and 5.5 mg / kg. As used herein, including the appended claims, the singular forms of words such as “a,” “an,” and “the,” include their corresponding plural references unless the context clearly dictates otherwise. The terms “administration” or “administer” refers to the act of injecting or otherwise physically delivering a substance as it exists outside the body (e.g., an anti-TIGIT antibody, an anti-PD-1 antibody, 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin as described herein) into a patient, such as by oral, mucosal, intradermal, intravenous, subcutaneous, intramuscular delivery, and / or any other methods of physical delivery described herein or known in the art. As used herein, the term “antibody” refers to any form of immunoglobulin molecule that exhibits the desired biological or binding activity. Thus, it is used in the broadest sense and specifically covers, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), humanized, fully human antibodies, and chimeric antibodies. “Parental antibodies” are antibodies obtained by exposure of an immune system to an antigen prior to modification of the antibodies for an intended use, such as humanization of an antibody for use as a human therapeutic. As used herein, the term “antibody” encompasses not only intact polyclonal or monoclonal antibodies, but also, unless otherwise specified, fusion proteins comprising an antigen binding portion, and any other modified configuration of the immunoglobulin molecule that comprises an antigen binding fragment thereof that competes with the intact antibody for specific binding. In general, the basic antibody structural unit comprises a tetramer. Each tetramer includes two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The variable regions of each light / heavy chain pair form the antibody binding site. Thus, in general, an intact antibody has two binding sites. The carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function. Typically, human light chains are classified as kappa and lambda light chains. Furthermore, human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody’s isotype as IgM, IgD, IgG, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch.7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989). “Variable regions” or “V region” or “V chain” as used herein means the segment of IgG chains which is variable in sequence between different antibodies. A “variable region” of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination. The variable region of the heavy chain may be referred to as “VH.” The variable region of the light chain may be referred to as “VL.” Typically, the variable regions of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), which are located within relatively conserved framework regions (FR). The CDRs are usually aligned by the framework regions, enabling binding to a specific epitope. In general, from N-terminal to C-terminal, both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. As referred to herein the light chain CDRs are CDRL1, CDRL2 and CDRL3, respectively, and the heavy chain CDRs are CDRH1, CDRH2 and CDRH3, respectively. The assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5th ed.; NIH Publ. No.91-3242 (1991); Kabat (1978) Adv. Prot. Chem.32:1-75; Kabat, et al., (1977) J. Biol. Chem.252:6609-6616; Chothia, et al., (1987) J Mol. Biol.196:901-917 or Chothia, et al., (1989) Nature 342:878- 883. A “CDR” refers to one of three hypervariable regions (H1, H2, or H3) within the non- framework region of the antibody VH β-sheet framework, or one of three hypervariable regions (L1, L2, or L3) within the non-framework region of the antibody VLβ-sheet framework. Accordingly, CDRs are variable region sequences interspersed within the framework region sequences. CDR regions are well known to those skilled in the art and have been defined by, for example, Kabat as the regions of most hypervariability within the antibody variable domains. CDR region sequences also have been defined structurally by Chothia as those residues that are not part of the conserved b-sheet framework, and thus are able to adapt to different conformation. Both terminologies are well recognized in the art. CDR region sequences have also been defined by AbM, Contact, and IMGT. The positions of CDRs within a canonical antibody variable region have been determined by comparison of numerous structures (Al-Lazikani et al., 1997, J. Mol. Biol.273:927-48; Morea et al., 2000, Methods 20:267-79). Because the number of residues within a hypervariable region varies in different antibodies, additional residues relative to the canonical positions are conventionally numbered with a, b, c and so forth next to the residue number in the canonical variable region numbering scheme (Al-Lazikani et al., supra). Such nomenclature is similarly well known to those skilled in the art. Correspondence between the numbering system, including, for example, the Kabat numbering and the IMGT unique numbering system, is well known to one skilled in the art and shown below in Table 1. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system. Table 1. Correspondence between the CDR Numbering Systems Kabat + IMGT Kabat AbM Chothia Contact Chothia VHCDR2 50-65 56-65 50-65 50-58 52-56 47-58 VHCDR3 95-102 105-117 95-102 95-102 95-102 93-101 VLCDR1 24-34 27-38 24-34 24-34 24-34 30-36 VLCDR2 50-56 56-65 50-56 50-56 50-56 46-55 VLCDR3 89-97 105-117 89-97 89-97 89-97 89-96 “Chimeric antibody” refers to an antibody in which a portion of the heavy and / or light chain contains sequences derived from a particular species (e.g., human) or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is derived from another species (e.g., mouse) or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity. “Human antibody” refers to an antibody that comprises human immunoglobulin protein sequences or derivatives thereof. A human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell, or in a hybridoma derived from a mouse cell. Similarly, “mouse antibody” or “rat antibody” refer to an antibody that comprises only mouse or rat immunoglobulin sequences or derivatives thereof, respectively. “Humanized antibody” refers to forms of antibodies that contain sequences from non- human (e.g., murine) antibodies as well as human antibodies. Such antibodies contain minimal sequence derived from non-human immunoglobulin. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non- human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. The prefix “hum”, “hu” or “h” may be added to antibody clone designations when necessary to distinguish humanized antibodies from parental rodent antibodies. The humanized forms of rodent antibodies will generally comprise the same CDR sequences of the parental rodent antibodies, although certain amino acid substitutions may be included to increase affinity, increase stability of the humanized antibody, or for other reasons. “Monoclonal antibody” or “mAb” or “Mab”, as used herein, refers to a population of substantially homogeneous antibodies, i.e., the antibody molecules comprising the population are identical in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts. In contrast, conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains, particularly their CDRs, which are often specific for different epitopes. The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present disclosure may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No.4,816,567). The “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352: 624-628 and Marks et al. (1991) J. Mol. Biol.222: 581- 597, for example. See also Presta (2005) J. Allergy Clin. Immunol.116:731. As used herein, unless otherwise indicated, “antibody fragment” or “antigen binding fragment” refers to a fragment of an antibody that retains the ability to bind specifically to the antigen, e.g., fragments that retain one or more CDR regions and the ability to bind specifically to the antigen. An antibody that “specifically binds to” TIGIT or PD-1 is an antibody that exhibits preferential binding to TIGIT or PD-1 (as appropriate) as compared to other proteins, but this specificity does not require absolute binding specificity. An antibody is considered “specific” for its intended target if its binding is determinative of the presence of the target protein in a sample, e.g., without producing undesired results such as false positives. Antibodies, or binding fragments thereof, will bind to the target protein with an affinity that is at least two-fold greater, preferably at least ten times greater, more preferably at least 20-times greater, and most preferably at least 100-times greater than the affinity with non-target proteins. Antigen binding portions include, for example, Fab, Fab’, F(ab’)2, Fd, Fv, fragments including CDRs, and single chain variable fragment antibodies (scFv), and polypeptides that contain at least a portion of an immunoglobulin that is sufficient to confer specific antigen binding to the antigen (e.g., TIGIT or PD-1). An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class. Depending on the antibody amino acid sequence of the constant region of its heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2. The heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three- dimensional configurations of different classes of immunoglobulins are well known. As used herein, the terms “at least one” item or “one or more” item each include a single item selected from the list as well as mixtures of two or more items selected from the list. As used herein, the term “immune response” relates to any one or more of the following: specific immune response, non-specific immune response, both specific and non- specific response, innate response, primary immune response, adaptive immunity, secondary immune response, memory immune response, immune cell activation, immune cell- proliferation, immune cell differentiation, and cytokine expression. The term “subject” (alternatively “patient”) as used herein refers to a mammal that has been the object of treatment, observation, or experiment. The mammal may be male or female. The mammal may be one or more selected from the group consisting of humans, bovine (e.g., cows), porcine (e.g., pigs), ovine (e.g., sheep), capra (e.g., goats), equine (e.g., horses), canine (e.g., domestic dogs), feline (e.g., house cats), lagomorph (e.g., rabbits), rodent (e.g., rats or mice), Procyon lotor (e.g., raccoons). In particular embodiments, the subject is human. The term “subject in need thereof” as used herein refers to a subject diagnosed with or suspected of having cancer or an infectious disease as defined herein. The therapeutic agents and compositions provided by the present disclosure can be administered via any suitable enteral route or parenteral route of administration. The term “enteral route” of administration refers to the administration via any part of the gastrointestinal tract. Examples of enteral routes include oral, mucosal, buccal, and rectal route, or intragastric route. “Parenteral route” of administration refers to a route of administration other than enteral route. Examples of parenteral routes of administration include intravenous, intramuscular, intradermal, intraperitoneal, intratumor, intravesical, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, transtracheal, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal, subcutaneous, or topical administration. The therapeutic agents and compositions of the disclosure can be administered using any suitable method, such as by oral ingestion, nasogastric tube, gastrostomy tube, injection, infusion, implantable infusion pump, and osmotic pump. The suitable route and method of administration may vary depending on a number of factors such as the specific therapeutic agent being used, the rate of absorption desired, specific formulation or dosage form used, type or severity of the disorder being treated, the specific site of action, and conditions of the patient, and can be readily selected by a person skilled in the art. The term “variant” when used in relation to an antibody (e.g., an anti-TIGIT antibody or an anti-PD-1 antibody) or an amino acid region within the antibody may refer to a peptide or polypeptide comprising one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) amino acid sequence substitutions, deletions, and / or additions as compared to a native or unmodified sequence. For example, a variant of an anti-PD-1 antibody may result from one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) changes to an amino acid sequence of a native or previously unmodified anti-PD-1 antibody. Variants may be naturally occurring or may be artificially constructed. Polypeptide variants may be prepared from the corresponding nucleic acid molecules encoding the variants. In specific embodiments, an antibody variant (e.g., an anti- TIGIT antibody variant or an anti-PD-1 antibody variant) at least retains the antibody functional activity. In specific embodiments, an anti-TIGIT antibody variant binds to TIGIT and / or is antagonistic to TIGIT activity. In some embodiments, an anti-PD-1 antibody variant binds to PD-1 and / or is antagonistic to PD-1 activity. “Conservatively modified variants” or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g., charge, side-chain size, hydrophobicity / hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity or other desired property of the protein, such as antigen affinity and / or specificity. Those of skill in this art recognize that, in general, single amino acid substitutions in non- essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene, The Benjamin / Cummings Pub. Co., p. 224 (4th Ed.)). In addition, substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth in Table 2 below. Table 2. Exemplary Conservative Amino Acid Substitutions Original residue Conservative substitution Al (A) Gl S r Original residue Conservative substitution “Homolog y re ers o sequence s m ar y e ween wo po ypep de sequences when they are optimally aligned. When a position in both of the two compared sequences is occupied by the same amino acid monomer subunit, e.g., if a position in a light chain CDR of two different Abs is occupied by alanine, then the two Abs are homologous at that position. The percent of homology is the number of homologous positions shared by the two sequences divided by the total number of positions compared × 100. For example, if 8 of 10 of the positions in two sequences are matched when the sequences are optimally aligned then the two sequences are 80% homologous. Generally, the comparison is made when two sequences are aligned to give maximum percent homology. For example, the comparison can be performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences. The following references relate to BLAST algorithms often used for sequence analysis: BLAST ALGORITHMS: Altschul, S.F., et al., (1990) J. Mol. Biol.215:403-410; Gish, W., et al., (1993) Nature Genet.3:266-272; Madden, T.L., et al., (1996) Meth. Enzymol.266:131-141; Altschul, S.F., et al., (1997) Nucleic Acids Res.25:3389-3402; Zhang, J., et al., (1997) Genome Res.7:649-656; Wootton, J.C., et al., (1993) Comput. Chem.17:149-163; Hancock, J.M. et al., (1994) Comput. Appl. Biosci.10:67-70; ALIGNMENT SCORING SYSTEMS: Dayhoff, M.O., et al., “A model of evolutionary change in proteins.” in Atlas of Protein Sequence and Structure, (1978) vol.5, suppl.3. M.O. Dayhoff (ed.), pp.345-352, Natl. Biomed. Res. Found., Washington, DC; Schwartz, R.M., et al., “Matrices for detecting distant relationships.” in Atlas of Protein Sequence and Structure, (1978) vol.5, suppl.3.” M.O. Dayhoff (ed.), pp.353-358, Natl. Biomed. Res. Found., Washington, DC; Altschul, S.F., (1991) J. Mol. Biol.219:555-565; States, D.J., et al., (1991) Methods 3:66-70; Henikoff, S., et al., (1992) Proc. Natl. Acad. Sci. USA 89:10915-10919; Altschul, S.F., et al., (1993) J. Mol. Evol.36:290-300; ALIGNMENT STATISTICS: Karlin, S., et al., (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268; Karlin, S., et al., (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877; Dembo, A., et al., (1994) Ann. Prob.22:2022-2039; and Altschul, S.F. “Evaluating the statistical significance of multiple distinct local alignments.” in Theoretical and Computational Methods in Genome Research (S. Suhai, ed.), (1997) pp.1- 14, Plenum, New York. “RECIST 1.1 Response Criteria” as used herein means the definitions set forth in Eisenhauer, E.A. et al., Eur. J. Cancer 45:228-247 (2009) for target lesions or nontarget lesions, as appropriate based on the context in which response is being measured. “Sustained response” means a sustained therapeutic effect after cessation of treatment as described herein. In some embodiments, the sustained response has a duration that is at least the same as the treatment duration, or at least 1.5, 2.0, 2.5 or 3 times longer than the treatment duration. As used herein, the term "treat" or "treating" means to administer a therapeutic combination of a PD-1 antagonist, a TIGIT antagonist, and one or more chemotherapeutic agents (e.g., an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof, an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof, and one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin) or pharmaceutically acceptable salts thereof) to a subject or patient having one or more disease symptoms as provided herein. Typically, the agents of the therapeutic combination are administered in an amount effective to alleviate one or more disease symptoms in the treated subject or population, whether by inducing the regression of or inhibiting the progression of such symptom(s) by any clinically measurable degree. The amount of the agents of the therapeutic combination that is effective to alleviate any particular disease symptom may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the therapeutic combination to elicit a desired response in the subject. Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom. “Treat” or “treating” cancer as used herein means to administer a therapeutic combination of a PD-1 antagonist, a TIGIT antagonist, and one or more chemotherapeutic agents or pharmaceutically acceptable salts thereof (e.g., an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof, an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof, and one or more chemotherapeutic agents (e.g., 5- fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin)) to a subject having cancer or diagnosed with cancer to achieve at least one positive therapeutic effect, such as, for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organs, or reduced rate of tumor metastasis or tumor growth, comprising administration by oral, mucosal, intradermal, intravenous, subcutaneous, intramuscular delivery, and / or any other methods of physical delivery described herein or known in the art. In specific embodiments, the therapeutic combination is a therapeutic combination of an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof, an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof, 5-fluorouracil, and cisplatin; a therapeutic combination of an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof, an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof, and paclitaxel or a pharmaceutically acceptable salt thereof; a therapeutic combination of an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof, an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof, gemcitabine or a pharmaceutically acceptable salt thereof, and cisplatin; or a therapeutic combination of an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof, an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof, capecitabine or a pharmaceutically acceptable salt thereof, and oxaliplatin. “Treatment” may include one or more of the following: inducing / increasing an antitumor immune response, decreasing the number of one or more tumor markers, halting or delaying the growth of a tumor or blood cancer or progression of disease such as cancer, stabilization of disease, inhibiting the growth or survival of tumor cells, eliminating or reducing the size of one or more cancerous lesions or tumors, decreasing the level of one or more tumor markers, ameliorating or abrogating the clinical manifestations of disease, reducing the severity or duration of the clinical symptoms, prolonging the survival or patient relative to the expected survival in a similar untreated patient, and inducing complete or partial remission of a cancerous condition, wherein the disease is cancer, and in certain embodiments wherein the cancer is selected from the group consisting of endometrial cancer cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, bladder cancer, breast cancer, triple negative breast cancer (TNBC), non-small cell lung cancer (NSCLC), colorectal cancer (CRC), renal cell carcinoma (RCC), hepatocellular carcinoma (HCC), and melanoma. The amount of a therapeutic agent that is effective to alleviate any particular disease symptom may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the drug to elicit a desired response in the subject. Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom. Positive therapeutic effects in cancer can be measured in a number of ways (See, W. A. Weber, J. Nucl. Med.50:1S-10S (2009)). For example, with respect to tumor growth inhibition, according to NCI standards, a T / C أ 42% is the minimum level of anti-tumor activity. A T / C < 10% is considered a high anti-tumor activity level, with T / C (%) = Median tumor volume of the treated / Median tumor volume of the control × 100. In some embodiments, the treatment achieved by a combination therapy of the disclosure is any of PR, CR, OR, PFS, DFS, and OS. PFS, also referred to as “Time to Tumor Progression” indicates the length of time during and after treatment that the cancer does not grow, and includes the amount of time patients have experienced a CR or PR, as well as the amount of time patients have experienced SD. DFS refers to the length of time during and after treatment that the patient remains free of disease. OS refers to a prolongation in life expectancy as compared to naive or untreated individuals or patients. In some embodiments, response to a combination therapy of the disclosure is any of PR, CR, PFS, DFS, or OR that is assessed using RECIST 1.1 response criteria. The treatment regimen for a combination therapy of the disclosure that is effective to treat a cancer patient may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the therapy to elicit an anti-cancer response in the subject. While an embodiment of any of the aspects of the disclosure may not be effective in achieving a positive therapeutic effect in every subject, it should do so in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student’s t-test, the chi2-test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon-test. “Treat” or “treating” an infectious disease or an infection as used herein means to administer a therapeutic combination of a PD-1 antagonist, a TIGIT antagonist, and one or more chemotherapeutic agents or pharmaceutically acceptable salts thereof (e.g., an anti- human PD-1 monoclonal antibody or antigen binding fragment thereof, an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof, and one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin) or pharmaceutically acceptable salts thereof), to a subject having an infectious disease or an infection (e.g., caused by many pathogens, including bacteria, viruses, fungi) to achieve at least one positive therapeutic effect. The term “co-formulation” refers to a formulation comprising two or more of therapeutic agents. In some embodiments, co-formulation comprises a TIGIT antagonist and a PD-1 antagonist. The term “pharmaceutically acceptable carrier” refers to any inactive substance that is suitable for use in a formulation for the delivery of a therapeutic agent. A carrier may be an anti-adherent, binder, coating, disintegrant, filler or diluent, preservative (such as antioxidant, antibacterial, or antifungal agent), sweetener, absorption delaying agent, wetting agent, emulsifying agent, buffer, and the like. Examples of suitable pharmaceutically acceptable carriers include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), dextrose, vegetable oils (such as olive oil), saline, buffer, buffered saline, and isotonic agents such as sugars, polyalcohols, sorbitol, and sodium chloride. As used herein, the terms “combination,” “combination therapy,” and “therapeutic combination” refer to treatments in which at least one PD-1 antagonist, at least one TIGIT antagonist, and one or more chemotherapeutic agents or pharmaceutically acceptable salts thereof, and optionally additional therapeutic agents, each are administered to a patient in a coordinated manner, either sequentially, simultaneously or separately, over an overlapping period of time. In specific embodiments, the treatments are a combination of at least one anti- human TIGIT monoclonal antibody or antigen-binding fragment thereof, at least one anti- human PD-1 monoclonal antibody or antigen-binding fragment thereof, 5-fluorouracil and cisplatin; a combination of at least one anti-human TIGIT monoclonal antibody or antigen- binding fragment thereof, at least one anti-human PD-1 monoclonal antibody or antigen- binding fragment thereof, and paclitaxel or a pharmaceutically acceptable salt thereof; a combination of at least one anti-human TIGIT monoclonal antibody or antigen-binding fragment thereof, at least one anti-human PD-1 monoclonal antibody or antigen-binding fragment thereof, gemcitabine or a pharmaceutically acceptable salt thereof and cisplatin; or a combination of at least one anti-human TIGIT monoclonal antibody or antigen-binding fragment thereof, at least one anti-human PD-1 monoclonal antibody or antigen-binding fragment thereof, capecitabine or a pharmaceutically acceptable salt thereof and oxaliplatin; each optionally having additional therapeutic agents. The period of treatment with the at least one TIGIT antagonist (the “anti-TIGIT treatment”) is the period of time that a patient undergoes treatment with the TIGIT antagonist, e.g., an anti-human TIGIT monoclonal antibody (or antigen-binding fragment thereof); that is, the period of time from the initial dosing with the TIGIT antagonist through the final day of a treatment cycle. Similarly, the period of treatment with the at least one PD-1 antagonist (the “anti- PD-1 treatment”) is the period of time that a patient undergoes treatment with the PD-1 antagonist, e.g., an anti- human PD-1 monoclonal antibody (or antigen-binding fragment thereof); that is, the period of time from the initial dosing with the PD-1 antagonist through the final day of a treatment cycle. The period of treatment with 5-fluorouracil and / or cisplatin (the “5-FU / cisplatin treatment”) is the period of time that a patient undergoes treatment with 5-fluorouracil and / or cisplatin; that is, the period of time from the initial dosing with 5-fluorouracil and / or cisplatin through the final day of a treatment cycle. In the methods, uses, and therapeutic combinations described herein, the anti-TIGIT treatment overlaps by at least one day with the anti-PD-1 treatment and overlaps by at least one day with the 5-FU / cisplatin treatment. In certain embodiments, the anti-TIGIT treatment, the anti-PD-1 treatment, and the 5-FU / cisplatin treatment are the same period of time. In some embodiments, the anti-TIGIT treatment begins prior to the anti-PD-1 and / or the 5-FU / cisplatin treatment. In other embodiments, the anti- TIGIT treatment begins after the anti-PD-1 and / or the 5-FU / cisplatin treatment. In yet other embodiments, the anti-PD-1 treatment begins prior to the anti-TIGIT and / or the 5- FU / cisplatin treatment. In still other embodiments, the anti- PD-1 treatment begins after the anti-TIGIT and / or the 5-FU / cisplatin treatment. In some embodiments, the 5-FU / cisplatin treatment begins prior to the anti-PD-1 and / or the anti-TIGIT treatment. In other embodiments, the 5-FU / cisplatin treatment begins after the anti-PD-1 and / or the anti-TIGIT treatment. In certain embodiments, the anti-TIGIT treatment is terminated prior to termination of the anti-PD-1 and / or the 5-FU / cisplatin treatment. In other embodiments, the anti-TIGIT treatment is terminated after termination of the anti-PD-1 and / or the 5- FU / cisplatin treatment. In yet other embodiments, the anti-PD-1 treatment is terminated prior to termination of the anti-TIGIT and / or the 5-FU / cisplatin treatment. In still other embodiments, the anti-PD-1 treatment is terminated after termination of the anti-TIGIT and / or the 5-FU / cisplatin treatment. In certain embodiments, the 5-FU / cisplatin treatment is terminated prior to termination of the anti-PD-1 and / or the anti-TIGIT treatment. In other embodiments, the 5-FU / cisplatin treatment is terminated after termination of the anti-PD-1 and / or the anti-TIGIT treatment. The period of treatment with paclitaxel or a pharmaceutically acceptable salt thereof (the “paclitaxel treatment”) is the period of time that a patient undergoes treatment with paclitaxel or a pharmaceutically acceptable salt thereof; that is, the period of time from the initial dosing with paclitaxel or a pharmaceutically acceptable salt thereof through the final day of a treatment cycle. In the methods, uses, and therapeutic combinations described herein, the anti-TIGIT treatment overlaps by at least one day with the anti-PD-1 treatment and overlaps by at least one day with the paclitaxel treatment. In certain embodiments, the anti-TIGIT treatment, the anti-PD-1 treatment, and the paclitaxel treatment are the same period of time. In some embodiments, the anti-TIGIT treatment begins prior to the anti-PD-1 and / or the paclitaxel treatment. In other embodiments, the anti-TIGIT treatment begins after the anti-PD-1 and / or the paclitaxel treatment. In yet other embodiments, the anti-PD-1 treatment begins prior to the anti-TIGIT and / or the paclitaxel treatment. In still other embodiments, the anti- PD-1 treatment begins after the anti-TIGIT and / or the paclitaxel treatment. In some embodiments, the paclitaxel treatment begins prior to the anti-PD-1 and / or the anti-TIGIT treatment. In other embodiments, the paclitaxel treatment begins after the anti- PD-1 and / or the anti-TIGIT treatment. In certain embodiments, the anti-TIGIT treatment is terminated prior to termination of the anti-PD-1 and / or the paclitaxel treatment. In other embodiments, the anti-TIGIT treatment is terminated after termination of the anti-PD-1 and / or the paclitaxel treatment. In yet other embodiments, the anti-PD-1 treatment is terminated prior to termination of the anti-TIGIT and / or the paclitaxel treatment. In still other embodiments, the anti-PD-1 treatment is terminated after termination of the anti-TIGIT and / or the paclitaxel treatment. In certain embodiments, the paclitaxel treatment is terminated prior to termination of the anti-PD-1 and / or the anti-TIGIT treatment. In other embodiments, the paclitaxel treatment is terminated after termination of the anti-PD-1 and / or the anti-TIGIT treatment. The period of treatment with gemcitabine or a pharmaceutically acceptable salt thereof and / or cisplatin (the “gemcitabine / cisplatin treatment”) is the period of time that a patient undergoes treatment with gemcitabine or a pharmaceutically acceptable salt thereof and / or cisplatin; that is, the period of time from the initial dosing with gemcitabine or a pharmaceutically acceptable salt thereof and / or cisplatin through the final day of a treatment cycle. In the methods, uses, and therapeutic combinations described herein, the anti-TIGIT treatment overlaps by at least one day with the anti-PD-1 treatment and overlaps by at least one day with the gemcitabine / cisplatin treatment. In certain embodiments, the anti-TIGIT treatment, the anti-PD-1 treatment, and the gemcitabine / cisplatin treatment are the same period of time. In some embodiments, the anti-TIGIT treatment begins prior to the anti-PD-1 and / or the gemcitabine / cisplatin treatment. In other embodiments, the anti-TIGIT treatment begins after the anti-PD-1 and / or the gemcitabine / cisplatin treatment. In yet other embodiments, the anti-PD-1 treatment begins prior to the anti-TIGIT and / or the gemcitabine / cisplatin treatment. In still other embodiments, the anti- PD-1 treatment begins after the anti-TIGIT and / or the gemcitabine / cisplatin treatment. In some embodiments, the gemcitabine / cisplatin treatment begins prior to the anti-PD-1 and / or the anti-TIGIT treatment. In other embodiments, the gemcitabine / cisplatin treatment begins after the anti-PD-1 and / or the anti-TIGIT treatment. In certain embodiments, the anti-TIGIT treatment is terminated prior to termination of the anti-PD-1 and / or the gemcitabine / cisplatin treatment. In other embodiments, the anti-TIGIT treatment is terminated after termination of the anti-PD-1 and / or the gemcitabine / cisplatin treatment. In yet other embodiments, the anti-PD-1 treatment is terminated prior to termination of the anti-TIGIT and / or the gemcitabine / cisplatin treatment. In still other embodiments, the anti-PD-1 treatment is terminated after termination of the anti-TIGIT and / or the gemcitabine / cisplatin treatment. In certain embodiments, the gemcitabine / cisplatin treatment is terminated prior to termination of the anti-PD-1 and / or the anti-TIGIT treatment. In other embodiments, the gemcitabine / cisplatin treatment is terminated after termination of the anti-PD-1 and / or the anti-TIGIT treatment. The period of treatment with capecitabine or a pharmaceutically acceptable salt thereof and / or oxaliplatin (the “capecitabine / oxaliplatin treatment”) is the period of time that a patient undergoes treatment with capecitabine or a pharmaceutically acceptable salt thereof and / or oxaliplatin; that is, the period of time from the initial dosing with capecitabine or a pharmaceutically acceptable salt thereof and / or oxaliplatin through the final day of a treatment cycle. In the methods, uses, and therapeutic combinations described herein, the anti-TIGIT treatment overlaps by at least one day with the anti-PD-1 treatment and overlaps by at least one day with the capecitabine / oxaliplatin treatment. In certain embodiments, the anti-TIGIT treatment, the anti-PD-1 treatment, and the capecitabine / oxaliplatin treatment are the same period of time. In some embodiments, the anti-TIGIT treatment begins prior to the anti-PD-1 and / or the capecitabine / oxaliplatin treatment. In other embodiments, the anti- TIGIT treatment begins after the anti-PD-1 and / or the capecitabine / oxaliplatin treatment. In yet other embodiments, the anti-PD-1 treatment begins prior to the anti-TIGIT and / or the capecitabine / oxaliplatin treatment. In still other embodiments, the anti- PD-1 treatment begins after the anti-TIGIT and / or the capecitabine / oxaliplatin treatment. In some embodiments, the capecitabine / oxaliplatin treatment begins prior to the anti-PD-1 and / or the anti-TIGIT treatment. In other embodiments, the capecitabine / oxaliplatin treatment begins after the anti-PD-1 and / or the anti-TIGIT treatment. In certain embodiments, the anti-TIGIT treatment is terminated prior to termination of the anti-PD-1 and / or the capecitabine / oxaliplatin treatment. In other embodiments, the anti-TIGIT treatment is terminated after termination of the anti-PD-1 and / or the capecitabine / oxaliplatin treatment. In yet other embodiments, the anti-PD-1 treatment is terminated prior to termination of the anti- TIGIT and / or the capecitabine / oxaliplatin treatment. In still other embodiments, the anti-PD- 1 treatment is terminated after termination of the anti-TIGIT and / or the capecitabine / oxaliplatin treatment. In certain embodiments, the capecitabine / oxaliplatin treatment is terminated prior to termination of the anti-PD-1 and / or the anti-TIGIT treatment. In other embodiments, the capecitabine / oxaliplatin treatment is terminated after termination of the anti-PD-1 and / or the anti-TIGIT treatment. The terms “treatment regimen,” “dosing protocol,” and “dosing regimen” are used interchangeably to refer to the dose and timing of administration of each therapeutic agent in a combination therapy of the disclosure. The terms “cancer”, “cancerous”, or “malignant” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancer include but are not limited to, carcinoma, lymphoma, leukemia, blastoma, and sarcoma. More particular examples of such cancers include, but are not limited to, squamous cell carcinoma, myeloma, small-cell lung cancer, non-small cell lung cancer, glioma, Hodgkin lymphoma, non-hodgkin's lymphoma, acute myeloid leukemia (AML), multiple myeloma, gastrointestinal (tract) cancer, renal cancer, ovarian cancer, liver cancer, lymphoblastic leukemia, lymphocytic leukemia, colorectal cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, melanoma, chondrosarcoma, neuroblastoma, pancreatic cancer, glioblastoma multiforme, cervical cancer, brain cancer, stomach cancer, bladder cancer, hepatoma, hepatocellular carcinoma, biliary cancer, esophageal cancer, breast cancer, triple negative breast cancer, colon carcinoma, and head and neck cancer. “Tumor” as it applies to a subject diagnosed with, or suspected of having, a cancer refers to a malignant or potentially malignant neoplasm or tissue mass of any size, and includes primary tumors and secondary neoplasms. Non-limiting examples of tumors include solid tumor (e.g., sarcoma (such as chondrosarcoma), carcinoma (such as colon carcinoma), blastoma (such as hepatoblastoma), etc.) and blood tumor (e.g., leukemia (such as acute myeloid leukemia (AML)), lymphoma (such as DLBCL), multiple myeloma (MM), etc.). “Tumor burden” also referred to as “tumor load”, refers to the total amount of tumor material distributed throughout the body. Tumor burden refers to the total number of cancer cells or the total size of tumor(s), throughout the body, including lymph nodes and bone narrow. Tumor burden can be determined by a variety of methods known in the art, such as, e.g., by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., ultrasound, bone scan, computed tomography (CT) or magnetic resonance imaging (MRI) scans. The term “tumor volume” or “tumor size” refers to the total size of the tumor which can be measured as the length and width of a tumor. Tumor size may be determined by a variety of methods known in the art, such as, e.g., by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., bone scan, ultrasound, CT or MRI scans. As used herein, the term "effective amount" refer to an amount of a PD-1 antagonist, a TIGIT antagonist, and one or more chemotherapeutic agents or pharmaceutically acceptable salts thereof (e.g., an anti-TIGIT antibody or antigen binding fragment, an anti-PD-1 antibody or antigen binding fragment of the invention, and one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin)) that, when administered alone or in combination with an additional therapeutic agent to a cell, tissue, or subject, is effective to cause a measurable improvement in one or more symptoms of an infection or a disease, for example cancer or the progression of cancer. An effective amount further refers to that amount of the antibody or fragment sufficient to result in at least partial amelioration of symptoms, e.g., tumor shrinkage or elimination, lack of tumor growth, increased survival time. When applied to an individual active ingredient administered alone, an effective amount refers to that ingredient alone. When applied to a combination, an effective amount refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously. An effective amount of a therapeutic may result in an improvement of a diagnostic measure or parameter by at least 10%; usually by at least 20%; preferably at least about 30%; more preferably at least 40%, and most preferably by at least 50%. An effective amount can also result in an improvement in a subjective measure in cases where subjective measures are used to assess disease severity. Toxicity and therapeutic efficacy of the antibodies or antigen binding fragments of the invention, administered alone or in combination with another therapeutic agent, can be determined by any number of systems or means. For example, the toxicity and therapeutic efficacy of the antibodies or antigen binding fragments or compounds of the invention can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index (LD50 / ED50). The data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration. It is understood that wherever embodiments are described herein with the language “comprising,” otherwise analogous embodiments described in terms of “consisting of” and / or “consisting essentially of” are also provided. “Consists essentially of,” and variations such as “consist essentially of” or “consisting essentially of,” as used throughout the specification and claims, indicate the inclusion of any recited elements or group of elements, and the optional inclusion of other elements, of similar or different nature than the recited elements, that do not materially change the basic or novel properties of the specified dosage regimen, method, or composition. Unless expressly stated to the contrary, all ranges cited herein are inclusive; i.e., the range includes the values for the upper and lower limits of the range as well as all values in between. As an example, temperature ranges, percentages, ranges of equivalents, and the like described herein include the upper and lower limits of the range and any value in the continuum there between. Numerical values provided herein, and the use of the term “about”, may include variations of ± 1%, ± 2%, ±3%, ± 4%, ± 5%, ± 10%, ± 15%, and ± 20% and their numerical equivalents. All ranges also are intended to include all included sub-ranges, although not necessarily explicitly set forth. For example, a range of 3 to 7 days is intended to include 3, 4, 5, 6, and 7 days. In addition, the term “or,” as used herein, denotes alternatives that may, where appropriate, be combined; that is, the term “or” includes each listed alternative separately as well as their combination. Where aspects or embodiments of the disclosure are described in terms of a Markush group or other grouping of alternatives, the present disclosure encompasses not only the entire group listed as a whole, but each member of the group individually and all possible subgroups of the main group, but also the main group absent one or more of the group members. The present disclosure also envisages the explicit exclusion of one or more of any of the group members in the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure relates. In case of conflict, the present specification, including definitions, will control. Throughout this specification and claims, the word “comprise,” or variations such as “comprises” or “comprising” will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers. Unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Any example(s) following the term “e.g.” or “for example” is not meant to be exhaustive or limiting. Exemplary methods and materials are described herein, although methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure. The materials, methods, and examples are illustrative only and not intended to be limiting. Abbreviations with expanded term Table 3: Abbreviations Abbreviation Expanded Term 1L Fi li DNA deoxyribonucleic acid i f mL Milliliter illi Q7D dose every 7 days g Provided herein are PD-1 antagonists or anti-human PD-1 monoclonal antibodies that can be used in any of the methods, compositions, kits, and uses disclosed herein, including any chemical compound or biological molecule that blocks binding of PD-L1 to PD-1 and preferably also blocks binding of PD-L2 to PD-1. Any monoclonal antibodies that bind to a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope and block the interaction between PD-1 and its ligand PD-L1 or PD-L2 can be used. In some embodiments, the anti-human PD-1 monoclonal antibody binds to a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope and blocks the interaction between PD-1 and PD-L1. In other embodiments, the anti-human PD-1 monoclonal antibody binds to a PD-1 polypeptide, a PD- 1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope and blocks the interaction between PD-1 and PD-L2. In yet other embodiments, the anti-human PD-1 monoclonal antibody binds to a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope and blocks the interaction between PD-1 and PD-L1 and the interaction between PD-1 and PD- L2. Any monoclonal antibodies that bind to a PD-L1 polypeptide, a PD-L1 polypeptide fragment, a PD-L1 peptide, or a PD-L1 epitope and block the interaction between PD-L1 and PD-1 can also be used. In certain embodiments, the anti-human PD-1 monoclonal antibody is selected from the group consisting of pembrolizumab, nivolumab, cemiplimab, pidilizumab (U.S. Pat. No. 7,332,582), AMP-514 (MedImmune LLC, Gaithersburg, MD), PDR001 (U.S. Pat. No. 9,683,048), BGB-A317 (U.S. Pat. No.8,735,553), and MGA012 (MacroGenics, Rockville, MD). In one embodiment, the anti-human PD-1 monoclonal antibody is pembrolizumab. In one embodiment, the anti-human PD-1 monoclonal antibody is pembrolizumab. In another embodiment, the anti-human PD-1 monoclonal antibody is nivolumab. In another embodiment, the anti-human PD-1 monoclonal antibody is cemiplimab. In yet another embodiment, the anti-human PD-1 monoclonal antibody is pidilizumab. In one embodiment, the anti-human PD-1 monoclonal antibody is AMP-514. In another embodiment, the anti- human PD-1 monoclonal antibody is PDR001. In yet another embodiment, the anti-human PD-1 monoclonal antibody is BGB-A317. In still another embodiment, the anti-human PD-1 monoclonal antibody is MGA012. In some embodiments, an anti-human PD-1 antibody or antigen binding fragment thereof for use in the methods, kits, uses and co-formulations of the invention comprises three light chain CDRs of CDRL1, CDRL2 and CDRL3 and / or three heavy chain CDRs of CDRH1, CDRH2 and CDRH3. In one embodiment of the invention, CDRL1 comprises the amino acid sequence as set forth in SEQ ID NO:1 or a variant of the amino acid sequence as set forth in SEQ ID NO:1, CDRL2 comprises the amino acid sequence as set forth in SEQ ID NO:2 or a variant of the amino acid sequence as set forth in SEQ ID NO:2, and CDRL3 comprises the amino acid sequence as set forth in SEQ ID NO:3 or a variant of the amino acid sequence as set forth in SEQ ID NO:3. In one embodiment, CDRH1 comprises the amino acid sequence as set forth in SEQ ID NO:6 or a variant of the amino acid sequence as set forth in SEQ ID NO:6, CDRH2 comprises the amino acid sequence as set forth in SEQ ID NO: 7 or a variant of the amino acid sequence as set forth in SEQ ID NO:7, and CDRH3 comprises the amino acid sequence as set forth in SEQ ID NO:8 or a variant of the amino acid sequence as set forth in SEQ ID NO:8. In one embodiment, the three light chain CDRs have the amino acid sequences as set forth in SEQ ID NO:1, SEQ ID NO:2, and SEQ ID NO:3 and the three heavy chain CDRs have the amino acid sequences as set forth in SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8. In an alternative embodiment of the invention, CDRL1 comprises the amino acid sequence as set forth in SEQ ID NO:11 or a variant of the amino acid sequence as set forth in SEQ ID NO:11, CDRL2 comprises the amino acid sequence as set forth in SEQ ID NO:12 or a variant of the amino acid sequence as set forth in SEQ ID NO:12, and CDRL3 comprises the amino acid sequence as set forth in SEQ ID NO:13 or a variant of the amino acid sequence as set forth in SEQ ID NO:13. In one embodiment, CDRH1 comprises the amino acid sequence as set forth in SEQ ID NO:16 or a variant of the amino acid sequence as set forth in SEQ ID NO:16, CDRH2 comprises the amino acid sequence as set forth in SEQ ID NO:17 or a variant of the amino acid sequence as set forth in SEQ ID NO:17, and CDRH3 comprises the amino acid sequence as set forth in SEQ ID NO:18 or a variant of the amino acid sequence as set forth in SEQ ID NO:18. In one embodiment, the three light chain CDRs have the amino acid sequences as set forth in SEQ ID NO:1, SEQ ID NO:2, and SEQ ID NO:3 and the three heavy chain CDRs have the amino acid sequences as set forth in SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8. In an alternative embodiment, the three light chain CDRs have the amino acid sequences as set forth in SEQ ID NO:11, SEQ ID NO:12, and SEQ ID NO:13 and the three heavy chain CDRs have the amino acid sequences as set forth in SEQ ID NO:16, SEQ ID NO:17 and SEQ ID NO:18. In a further embodiment of the invention, CDRL1 comprises the amino acid sequence as set forth in SEQ ID NO:21 or a variant of the amino acid sequence as set forth in SEQ ID NO:21, CDRL2 comprises the amino acid sequence as set forth in SEQ ID NO:22 or a variant of the amino acid sequence as set forth in SEQ ID NO:22, and CDRL3 comprises the amino acid sequence as set forth in SEQ ID NO:23 or a variant of the amino acid sequence as set forth in SEQ ID NO:23. In yet another embodiment, CDRH1 comprises the amino acid sequence as set forth in SEQ ID NO:24 or a variant of the amino acid sequence as set forth in SEQ ID NO:24, CDRH2 comprises the amino acid sequence as set forth in SEQ ID NO: 25 or a variant of the amino acid sequence as set forth in SEQ ID NO:25, and CDRH3 comprises the amino acid sequence as set forth in SEQ ID NO:26 or a variant of the amino acid sequence as set forth in SEQ ID NO:26. In another embodiment, the three light chain CDRs have the amino acid sequences as set forth in SEQ ID NO:21, SEQ ID NO:22, and SEQ ID NO:23 and the three heavy chain CDRs have the amino acid sequences as set forth in SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26. Some anti-human PD-1 antibody and antigen binding fragments of the invention comprise a light chain variable region and a heavy chain variable region. In some embodiments, the light chain variable region comprises the amino acid sequence as set forth in SEQ ID NO:4 or a variant of the amino acid sequence as set forth in SEQ ID NO:4, and the heavy chain variable region comprises the amino acid sequence as set forth in SEQ ID NO:9 or a variant of the amino acid sequence as set forth in SEQ ID NO:9. In further embodiments, the light chain variable region comprises the amino acid sequence as set forth in SEQ ID NO:14 or a variant of the amino acid sequence as set forth in SEQ ID NO:14, and the heavy chain variable region comprises the amino acid sequence as set forth in SEQ ID NO:19 or a variant of the amino acid sequence as set forth in SEQ ID NO:19. In further embodiments, the heavy chain variable region comprises the amino acid sequence as set forth in SEQ ID NO:27 or a variant of the amino acid sequence as set forth in SEQ ID NO:27 and the light chain variable region comprises the amino acid sequence as set forth in SEQ ID NO:28 or a variant of the amino acid sequence as set forth in SEQ ID NO:28, SEQ ID NO:29 or a variant of the amino acid sequence as set forth in SEQ ID NO:29, or SEQ ID NO:30 or a variant of the amino acid sequence as set forth in SEQ ID NO:30. In such embodiments, a light chain variable region or heavy chain variable region sequence is identical to the reference sequence except having one, two, three, four or five amino acid substitutions. In some embodiments, the substitutions are in the framework region (i.e., outside of the CDRs). In some embodiments, one, two, three, four or five of the amino acid substitutions are conservative substitutions. In one embodiment of the co-formulations, methods, kits or uses of the invention, the anti-human PD-1 antibody or antigen binding fragment comprises a light chain variable region comprising or consisting of the amino acid sequence as set forth in SEQ ID NO:4 and a heavy chain variable region comprising or consisting of the amino acid sequence as set forth in SEQ ID NO:9. In a further embodiment, the anti-human PD-1 antibody or antigen binding fragment comprises a light chain variable region comprising or consisting of the amino acid sequence as set forth in SEQ ID NO:14 and a heavy chain variable region comprising or consisting of the amino acid sequence as set forth in SEQ ID NO:19. In one embodiment of the formulations of the invention, the anti-human PD-1 antibody or antigen binding fragment comprises a light chain variable region comprising or consisting of the amino acid sequence as set forth in SEQ ID NO:28 and a heavy chain variable region comprising or consisting of the amino acid sequence as set forth in SEQ ID NO:27. In a further embodiment, the anti-human PD-1 antibody or antigen binding fragment comprises a light chain variable region comprising or consisting of the amino acid sequence as set forth in SEQ ID NO:29 and a heavy chain variable region comprising or consisting of the amino acid sequence as set forth in SEQ ID NO:27. In another embodiment, the antibody or antigen binding fragment comprises a light chain variable region comprising or consisting of the amino acid sequence as set forth in SEQ ID NO:30 and a heavy chain variable region comprising or consisting the the amino acid sequence as set forth in SEQ ID NO:27. In another embodiment, the co-formulations, methods, kits or uses of the invention comprise an anti-human PD-1 antibody or antigen binding protein that has a VLdomain and / or a VHdomain with at least 95%, 90%, 85%, 80%, 75% or 50% sequence homology to one of the VLdomains or VHdomains described above, and exhibits specific binding to PD-1. In another embodiment, the anti-human PD-1 antibody or antigen binding protein of the co- formulations of the invention comprises VLand VHdomains having up to 1, 2, 3, 4, or 5 or more amino acid substitutions, and exhibits specific binding to PD-1. In any of the embodiments above, the PD-1 antagonist may be a full-length anti-PD-1 antibody or an antigen binding fragment thereof that specifically binds human PD-1. In certain embodiments, the PD-1 antagonist is a full-length anti-PD-1 antibody selected from any class of immunoglobulins, including IgM, IgG, IgD, IgA, and IgE. Preferably, the antibody is an IgG antibody. Any isotype of IgG can be used, including IgG1, IgG2, IgG3, and IgG4. Different constant domains may be appended to the VLand VHregions provided herein. For example, if a particular intended use of an antibody (or fragment) of the present invention were to call for altered effector functions, a heavy chain constant domain other than IgG1 may be used. Although IgG1 antibodies provide for long half-life and for effector functions, such as complement activation and antibody-dependent cellular cytotoxicity, such activities may not be desirable for all uses of the antibody. In such instances an IgG4 constant domain, for example, may be used. In embodiments of the invention, the PD-1 antagonist is an anti-PD-1 antibody comprising a light chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:5 and a heavy chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:10. In alternative embodiments, the PD-1 antagonist is an anti-PD-1 antibody comprising a light chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:15 and a heavy chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:20. In further embodiments, the PD-1 antagonist is an anti-PD-1 antibody comprising a light chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:32 and a heavy chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:31. In additional embodiments, the PD-1 antagonist is an anti-PD-1 antibody comprising a light chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:33 and a heavy chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:31. In yet additional embodiments, the PD-1 antagonist is an anti-PD-1 antibody comprising a light chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:34 and a heavy chain comprising or consisting of a sequence of amino acid residues as set forth in SEQ ID NO:31. In some co-formulations, methods, kits or uses of the invention, the PD-1 antagonist is pembrolizumab or a pembrolizumab biosimilar. In some co-formulations, methods, kits or uses of the invention, the PD-1 antagonist is nivolumab or a nivolumab biosimilar. Ordinarily, amino acid sequence variants of the anti-PD-1 antibodies and antigen binding fragments of the invention and the anti-TIGIT antibodies and antigen binding fragments will have an amino acid sequence having at least 75% amino acid sequence identity with the amino acid sequence of a reference antibody or antigen binding fragment (e.g. heavy chain, light chain, VH, VL, or humanized sequence), more preferably at least 80%, more preferably at least 85%, more preferably at least 90%, and most preferably at least 95, 98, or 99%. Identity or homology with respect to a sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the reference antibody or antigen binding fragment residues, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. None of N- terminal, C-terminal, or internal extensions, deletions, or insertions into the antibody sequence shall be construed as affecting sequence identity or homology. Sequence identity refers to the degree to which the amino acids of two polypeptides are the same at equivalent positions when the two sequences are optimally aligned. Sequence identity can be determined using a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences. The following references relate to BLAST algorithms often used for sequence analysis: BLAST ALGORITHMS: Altschul, S.F., et al., (1990) J. Mol. Biol.215:403-410; Gish, W., et al., (1993) Nature Genet.3:266-272; Madden, T.L., et al., (1996) Meth. Enzymol.266:131-141; Altschul, S.F., et al., (1997) Nucleic Acids Res. 25:3389-3402; Zhang, J., et al., (1997) Genome Res.7:649-656; Wootton, J.C., et al., (1993) Comput. Chem.17:149-163; Hancock, J.M. et al., (1994) Comput. Appl. Biosci.10:67-70; ALIGNMENT SCORING SYSTEMS: Dayhoff, M.O., et al., "A model of evolutionary change in proteins." in Atlas of Protein Sequence and Structure, (1978) vol.5, suppl.3. M.O. Dayhoff (ed.), pp.345-352, Natl. Biomed. Res. Found., Washington, DC; Schwartz, R.M., et al., "Matrices for detecting distant relationships." in Atlas of Protein Sequence and Structure, (1978) vol.5, suppl.3." M.O. Dayhoff (ed.), pp.353-358, Natl. Biomed. Res. Found., Washington, DC; Altschul, S.F., (1991) J. Mol. Biol.219:555-565; States, D.J., et al., (1991) Methods 3:66-70; Henikoff, S., et al., (1992) Proc. Natl. Acad. Sci. USA 89:10915-10919; Altschul, S.F., et al., (1993) J. Mol. Evol.36:290-300; ALIGNMENT STATISTICS: Karlin, S., et al., (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268; Karlin, S., et al., (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877; Dembo, A., et al., (1994) Ann. Prob.22:2022-2039; and Altschul, S.F. "Evaluating the statistical significance of multiple distinct local alignments." in Theoretical and Computational Methods in Genome Research (S. Suhai, ed.), (1997) pp.1- 14, Plenum, New York. Likewise, either class of light chain can be used in the compositions and methods herein. Specifically, kappa, lambda, or variants thereof are useful in the present compositions and methods. Table 4. Exemplary PD-1 Antibody Sequences Antibody Amino Acid Sequence SEQ ID Feature NO. Antibody Amino Acid Sequence SEQ ID Feature NO. Formulations, Compositions, Methods, Kits and Uses of the Invention. A. Antibodies and antigen binding fragments comprising light and heavy chain CDRs of hPD- 1.08A in WO2008 / 156712 eavy c a Q : Light chain VRSEQ ID NO:28 or SEQ ID NO:29 or SEQ ID NO:30 Light chain SEQ ID NO:32 or SEQ ID NO:33 or SEQ ID NO:34 TIGIT Antagonists Provided herein are anti-human TIGIT monoclonal antibodies or antigen binding fragments thereof that can be used in the methods, pharmaceutical compositions, kits, and uses disclosed herein. Any monoclonal antibodies that bind to a TIGIT polypeptide, a TIGIT polypeptide fragment, a TIGIT peptide, or a TIGIT epitope and block the interaction between TIGIT and its ligand CD155 and / or CD112 can be used. In some embodiments, the anti- human TIGIT monoclonal antibody binds to a TIGIT polypeptide, a TIGIT polypeptide fragment, a TIGIT peptide, or a TIGIT epitope and blocks the interaction between TIGIT and CD155. In other embodiments, the anti-human TIGIT monoclonal antibody binds to a TIGIT polypeptide, a TIGIT polypeptide fragment, a TIGIT peptide, or a TIGIT epitope and blocks the interaction between TIGIT and CD112. In yet other embodiments, the anti-human TIGIT monoclonal antibody binds to a TIGIT polypeptide, a TIGIT polypeptide fragment, a TIGIT peptide, or a TIGIT epitope and blocks the interaction between TIGIT and CD155 and the interaction between TIGIT and CD112. In some embodiments the human constant region is selected from the group consisting of IgG1, IgG2, IgG3 and IgG4 constant regions, and in preferred embodiments, the human constant region is an IgG1 or IgG4 constant region. Exemplary anti-TIGIT antibody sequences are set forth below in Tables 6 and 7. Table 6. Exemplary anti-TIGIT antibodies Description SEQ SEQUENCE ID QPPGKGLEWIGFITYSGSTSYNPSLKSRITISRDTSKNQ FSLKLSSVTAADTAVYYCARMPSFITLASLSTWEGYF QKPGKAPKFLIYYANSLQTGIPSRFSGSGSGTDFTLTIS SLQPEDFATYYCQQYYSGWTFGGGTKVEIK QKPGKAPKLLIYYANSLQTGVPSRFSGSGSGTDFTLTI LB155.14A6.G2.A8_VL3 SSLQPEDFATYFCQQYYSGWTFGGGTKVEIK 31C6 H – CDR2 VARIANT (D56Y) 121 YIDPYNyGAKYNEKFG LQPEDFATYYCQHHFGSPLTFGQGTRLEIK 31C6_Humz_L2 151 DIQMTQSPSSLSASVGDRVTITCRASEHIYSYLSWYQQ X24= D or A X25= T or V X6= A or V X7 = F or V X15= W, A, D, E, F, G, I, K, N, Q, R, S, T, V or Y 31C6 VL 171 DIQMTQSPX1SLSASVGX2X3VTITCRASEHIYSYLSWY Vibostolimab, heavy chain 295 EVQLVQSGAEVKKPGSSVKVSCKASGYTFSSYVMHW VRQAPGQGLEWIGYIDPYNDGAKYAQKFQGRVTLTS , y g g g comprises three light chain CDRs of CDRL1, CDRL2, and CDRL3 and / or three heavy chain CDRs of CDRH1, CDRH2, and CDRH3. In one embodiment, the anti- TIGIT antibody or antigen binding fragment thereof comprises a CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO:35, a CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO:36, a CDRH3 comprising any of the amino acid sequences as set forth in SEQ ID NOs:37, 103, 104, 105, 106, 107, or 160, a CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO:38, a CDRL2 comprising any of the amino acid sequences as set forth in SEQ ID NOs:39, 89, 90, 91, 92, 93, 94, 95, 96, 97, or 161, and a CDRL3 comprising any of the amino acid sequences as set forth in SEQ ID NOs:40, 98, 99, 100, 101, 102, or 162. In another embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO:81, a CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO:82, a CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO:83, a CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO:84, a CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO:85, and a CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO:86. In another embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO:108, a CDRH2 comprising any of the amino acid sequences as set forth in SEQ ID NOs:109, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 154, 155 or 167, a CDRH3 comprising any of the amino acid sequences as set forth in SEQ ID NOs:110, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186 or 187, a CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO:111, a CDRL2 comprising any of the amino acid sequences as set forth in SEQ ID NOs:112, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142 or 168, and a CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO:113. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO:35, a CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO:36, a CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO:37, a CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO:38, a CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO:39, and a CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO:40. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO:108, a CDRH2 comprising any one of the amino acid sequences as set forth in SEQ ID NO:109, 154 or 145, a CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO:110, a CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO:111, a CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO:112, and a CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO:113. In another embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO:108, a CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, a CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO:110, a CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO:111, a CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO:112, and a CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO:113. In some embodiments, the anti- TIGIT antibody or antigen binding fragment thereof comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:295. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region and a variable light chain variable region. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:41 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:42. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:87 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:88. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO: 114 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:115. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising any of the amino acid sequences as set forth in SEQ ID NOs: 43-58, 65-75 and 87 and a variable light chain region comprising any one of the amino acid sequences as set forth in SEQ ID NOs: 59-64, 76-80 and 88. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising any of the amino acid sequences as set forth in SEQ ID NOs: 144-149 and a variable light chain region comprising any of the amino acid sequences as set forth in SEQ ID NOs: 150-153. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:148 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:152. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:147 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:150. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:148 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:153. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:163 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:165. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:169 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:171. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:164 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:166. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:170 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:172. Table 7. Exemplary sequences of anti-TIGIT antibodies Description SEQ ID SEQUENCE NO X8= V, I Hu14D7V L1 201 EIVLTQSPATLSLSPGERATLSCSASSSVSSGYLYWYQQKPGQAPKLWIYGTS chain) IK 14D7 H – CDR3 220 ALYEGFYFDY Hu14D7V L1 242 EIVLTQSPATLSLSPGERATLSCSASSSVSSGYLYWYQQKPGQAPKLWIYGTS (Humanized VL TLASGVPARFSGSGSGTDYTLTISSLEPEDFAVYYCHQGSSFPYTFGQGTKLE Hu26B10 VH1 265 EVQLVQSGAEVKKPGASVKISCKTSGYTFTEFTMHWVKQAPGKGLEWIGG (Humanized VH LKPDDGGISYNQKFKGRATLTVDKSTNTAYMELSSLRSEDTAVYYCARGAY chain)(N55G) YRYDADYWGQGTLVTVSS Hu26B10 VH3 286 EVQLVQSGAEVKKPGASVKISCKVSGYTFTEFTMHWVRQAPGKGLEWIGG n one em o ment, t e ant - ant o y or ant gen n ng ragment compr ses a CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO:188, a CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO:189, a CDRH3 comprising any of the amino acid sequences as set forth in SEQ ID NOs:190, 220, 221, or 222, a CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO:191, a CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO:192, and a CDRL3 comprising any of the amino acid sequences as set forth in SEQ ID NOs:193, 232, 233, 234, 235, 236, or 237. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO:204, a CDRH2 comprising any of the amino acid sequences as set forth in SEQ ID NOs: 205, 256, 257, 258, 259, 260, 261, 262, or 263, a CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO:206, a CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO:207, a CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO:208, and a CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO:209. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region and a variable light chain variable region. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:194 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:195. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO:196 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:200. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO: 210 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:211. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising the amino acid sequence as set forth in SEQ ID NO: 212 and a variable light chain region comprising the amino acid sequence as set forth in SEQ ID NO:216. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising any of the amino acid sequences as set forth in SEQ ID NOs: 197, 198, 199, 223, 224, 225, 226, 227, 228, 229, 230, and 231 and a variable light chain region comprising any of the amino acid sequences as set forth in SEQ ID NOs: 201, 202, 203, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, and 255. In one embodiment, the anti-TIGIT antibody or antigen binding fragment thereof comprises a variable heavy chain region comprising any of the amino acid sequences as set forth in SEQ ID NOs: 213, 214, 215, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, and 286 and a variable light chain region comprising any of the amino acid sequences as set forth in SEQ ID NOs: 217, 218, and 219. Additional anti-TIGIT antibodies which may be used in the formulations described herein include those disclosed, for example, in PCT International Application No. WO 2016 / 106302; WO 2016 / 011264; and WO 2009 / 126688. Table 8. Exemplary Heavy Chain Sequences Heavy chain 291 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT constant domain– FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD I 1 KTHT PP PAPELL P FLFPPKPKDTLMI RTPE T D HEDPE K In any of the above mentioned embodiments, the anti-TIGIT antibody or antigen binding fragment thereof is an antibody comprising any of the variable heavy chains described above and any human heavy chain constant domain. In one embodiment, the antibody or antigen binding fragment thereof of the invention is of the IgG isotype, and comprises a human IgG1, IgG2, IgG3 or IgG4 human heavy chain constant domain. In one embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG1 constant domain (SEQ ID NO: 291) or a variant thereof, wherein the variant comprises up to 20 modified amino acid substitutions. In one embodiment, the antibody or antigen binding fragment thereof of the invention is an antibody comprising a human heavy chain IgG1 constant domain comprising the amino acid sequence as set forth in SEQ ID NO: 291. In one embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG1 constant domain wherein the IgG1 constant domain is afucosylated. In one embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG4 constant domain or a variant thereof, wherein the variant comprises up to 20 modified amino acid substitutions. In another embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG4 constant domain, wherein the amino acid at position 228 (using EU numbering scheme) has been substituted from Ser to Pro. In one embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG4 constant domain comprising the amino acid sequence as set forth in SEQ ID NO: 292. In any of the above mentioned embodiments, the anti-TIGIT antibody or antigen binding fragment thereof can comprise any of the variable light chains described above and human light chain constant domain. In one embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human kappa light chain constant domain or a variant thereof, wherein the variant comprises up to 20 modified amino acid substitutions. In another embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human lambda light chain constant domain or a variant thereof, wherein the variant comprises up to 20 modified amino acid substitutions. In one embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human kappa light chain constant domain comprising the amino acid sequence as set forth in SEQ ID NO: 293. Methods of Treating Cancer Using a Combination of a PD-1 Antagonist, a TIGIT Antagonist, 5-fluorouracil, and Cisplatin In another aspect, provided herein are methods of treating cancer (e.g., esophageal cancer) using a combination of a TIGIT antagonist, a PD-1 antagonist, 5-fluorouracil and cisplatin. In certain embodiments, the TIGIT antagonist is an anti-TIGIT antibody or antigen binding fragment thereof. In some embodiments, the PD-1 antagonist is an anti-PD-1 antibody or antigen binding fragment thereof. In certain embodiments, the method of treating cancer comprises administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) 5-fluorouracil represented by Formula (I); and I) sented by Formula (II). I) ments, the cancer is selected from the group consisting of: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumors, vipoma), small bowel (adenocarcinoma, lymphoma, carcinoid tumors, Karposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large bowel (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma) colorectal; Genitourinary tract: kidney (adenocarcinoma, Wilm's tumor [nephroblastoma], lymphoma, leukemia), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma), testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, lipoma); Liver: hepatoma (hepatocellular carcinoma), cholangiocarcinoma, hepatoblastoma, angiosarcoma, hepatocellular adenoma, hemangioma; Bone: osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing's sarcoma, malignant lymphoma (reticulum cell sarcoma), multiple myeloma, malignant giant cell tumor chordoma, osteochronfroma (osteocartilaginous exostoses), benign chondroma, chondroblastoma, chondromyxofibroma, osteoid osteoma and giant cell tumors; nervous system: skull (osteoma, hemangioma, granuloma, xanthoma, osteitis deformans), meninges (meningioma, meningiosarcoma, gliomatosis), brain (astrocytoma, medulloblastoma, glioma, ependymoma, germinoma [pinealoma], glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, congenital tumors), spinal cord neurofibroma, meningioma, glioma, sarcoma); Gynecological: uterus (endometrial carcinoma), cervix (cervical carcinoma, pre-tumor cervical dysplasia), ovaries (ovarian carcinoma [serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma], granulosa-thecal cell tumors, Sertoli-Leydig cell tumors, dysgerminoma, malignant teratoma), vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonal rhabdomyosarcoma), fallopian tubes (carcinoma), breast; Hematologic: blood (myeloid leukemia [acute and chronic], acute lymphoblastic leukemia, chronic lymphocytic leukemia, myeloproliferative diseases, multiple myeloma, myelodysplastic syndrome); hematopoietic tumors of the lymphoid lineage, include leukemia, acute lymphocytic leukemia, chronic lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Hodgkins lymphoma, non-Hodgkins lymphoma, hairy cell lymphoma, mantle cell lymphoma, myeloma, and Burkett’s lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias, myelodysplastic syndrome and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyosarcoma; tumors of the central and peripheral nervous system, including astrocytoma, neuroblastoma, glioma, and schwannomas; and other tumors, including melanoma, skin (non- melanomal) cancer, mesothelioma (cells), seminoma, teratocarcinoma, osteosarcoma, xenoderoma pigmentosum, keratoctanthoma, thyroid follicular cancer and Kaposi’s sarcoma. In some embodiments, the cancer is selected from the group consisting of anal cancer, biliary tract cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, colorectal cancer (CRC), esophageal cancer, gastrointestinal cancer, glioblastoma, glioma, head and neck cancer (HNSCC), hepatocellular carcinoma (HCC), lung cancer, liver cancer, lymphoma, melanoma, mesothelioma, multiple myeloma, non-small cell lung cancer (NSCLC), ovarian cancer, pancreatic cancer, prostate cancer (e.g. hormone refractory prostate adenocarcinoma), renal cell carcinoma (RCC), salivary cancer, thyroid cancer, and other neoplastic malignancies. In some embodiments, the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, and triple negative breast cancer (TNBC). In some embodiments, the cancer is esophageal cancer. In some embodiments, the esophageal cancer is locally advanced unresectable. In some embodiments, the esophageal cancer is metastatic adenocarcinoma. In some embodiments, the esophageal cancer is squamous cell carcinoma of the esophagus (ESCC). In some embodiments, the esophageal cancer is advanced Siewert type 1 adenocarcinoma of the gastroesophageal junction (GEJ). In some embodiments, the esophageal cancer is metastatic Siewert type 1 adenocarcinoma of the gastroesophageal junction (GEJ). In some embodiments, a combination of a TIGIT antagonist, a PD-1 antagonist, 5- fluorouracil and cisplatin may provide enhanced efficacy as compared with existing treatments. For example, TIGIT and PD-L1 are tightly co-expressed in adenocarcinoma and ESCC. A combination of a TIGIT antagonist, a PD-1 antagonist may provide added benefit over single-agent checkpoint blockade. Without wishing to be bound by any particular theory, chemotherapeutic agents may augment antitumor immune responses by (i) inducing immunogenic cell death, (ii) enhancing the maturation and activation of dendritic cells, (iii) increasing T-cell penetrance and function in the tumor, (iv) improving the presentation of tumor antigens, and (v) eliminating immunosuppressive cells. In certain embodiments, the tolerability of vibostolimab (an anti-TIGIT antibody) is a potential added benefit for combination with one or more chemotherapeutic agents and a PD-1 antagonist. In certain embodiments, the cancer is metastatic. In some embodiments, the cancer is relapsed. In other embodiments, the cancer is refractory. In yet other embodiments, the cancer is relapsed and refractory. In certain embodiments, provided herein is a method of treating esophageal cancer (e.g., locally advanced unresectable, metastatic adenocarcinoma, ESCC, advanced Siewert type 1 adenocarcinoma of GEJ, or metastatic Siewert type 1 adenocarcinoma of GEJ), comprising administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In certain embodiments, the method of treating cancer comprises administering to a human patient in need thereof: (a) a TIGIT antagonist as disclosed in Section titled TIGIT Antagonists; (b) a PD-1 antagonist as disclosed in Section titled PD-1 Antagonists; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In certain embodiments, the PD-1 antagonist is an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human PD-1 monoclonal antibody is a human antibody. In other embodiments, the anti-human PD-1 monoclonal antibody is a humanized antibody. In certain embodiments, the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human PD-L1 monoclonal antibody is a human antibody. In other embodiments, the anti-human PD-L1 monoclonal antibody is a humanized antibody. In certain embodiments, the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human TIGIT monoclonal antibody is a human antibody. In other embodiments, the anti-human TIGIT monoclonal antibody is a humanized antibody. Thus, in certain embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a human or humanized anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a human or humanized anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In some embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a human anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a human anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In other embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a humanized anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a humanized anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In one embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is pembrolizumab. In another embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is nivolumab. In another embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is cemiplimab. In certain embodiments of the methods, compositions, kits and uses provided herein, the anti-TIGIT antibody or antigen binding fragment thereof comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 of comprising the amino acid sequence as set forth in SEQ ID NO: 110. In some embodiments of the methods, compositions, kits and uses provided herein, the anti-TIGIT antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152. In certain embodiments, the anti- TIGIT antibody or antigen binding fragment thereof comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:295. In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) pembrolizumab; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) nivolumab; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) cemiplimab; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating esophageal cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) pembrolizumab; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating esophageal cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) nivolumab; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating esophageal cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) cemiplimab; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II). Methods of Treating Cancer Using a Combination of a PD-1 Antagonist, a TIGIT Antagonist, and Paclitaxel or a Pharmaceutically Acceptable Salt Thereof In another aspect, provided herein are methods of treating cancer (e.g., TNBC) using a combination of a TIGIT antagonist, a PD-1 antagonist, and (c) paclitaxel represented by Formula (III) or a pharmaceutically acceptable salt thereof. In certain embodiments, the TIGIT antagonist is an anti-TIGIT antibody or antigen binding fragment thereof. In some embodiments, the PD-1 antagonist is an anti-PD-1 antibody or antigen binding fragment thereof. In certain embodiments, the method of treating cancer comprises administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; and (c) paclitaxel represented by Formula (III) or a pharmaceutically acceptable salt thereof. In some embodiments, the cancer is selected from the group consisting of: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumors, vipoma), small bowel (adenocarcinoma, lymphoma, carcinoid tumors, Karposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large bowel (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma) colorectal; Genitourinary tract: kidney (adenocarcinoma, Wilm's tumor [nephroblastoma], lymphoma, leukemia), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma), testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, lipoma); Liver: hepatoma (hepatocellular carcinoma), cholangiocarcinoma, hepatoblastoma, angiosarcoma, hepatocellular adenoma, hemangioma; Bone: osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing's sarcoma, malignant lymphoma (reticulum cell sarcoma), multiple myeloma, malignant giant cell tumor chordoma, osteochronfroma (osteocartilaginous exostoses), benign chondroma, chondroblastoma, chondromyxofibroma, osteoid osteoma and giant cell tumors; nervous system: skull (osteoma, hemangioma, granuloma, xanthoma, osteitis deformans), meninges (meningioma, meningiosarcoma, gliomatosis), brain (astrocytoma, medulloblastoma, glioma, ependymoma, germinoma [pinealoma], glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, congenital tumors), spinal cord neurofibroma, meningioma, glioma, sarcoma); Gynecological: uterus (endometrial carcinoma), cervix (cervical carcinoma, pre-tumor cervical dysplasia), ovaries (ovarian carcinoma [serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma], granulosa-thecal cell tumors, Sertoli-Leydig cell tumors, dysgerminoma, malignant teratoma), vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonal rhabdomyosarcoma), fallopian tubes (carcinoma), breast; Hematologic: blood (myeloid leukemia [acute and chronic], acute lymphoblastic leukemia, chronic lymphocytic leukemia, myeloproliferative diseases, multiple myeloma, myelodysplastic syndrome); hematopoietic tumors of the lymphoid lineage, include leukemia, acute lymphocytic leukemia, chronic lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Hodgkins lymphoma, non-Hodgkins lymphoma, hairy cell lymphoma, mantle cell lymphoma, myeloma, and Burkett’s lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias, myelodysplastic syndrome and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyosarcoma; tumors of the central and peripheral nervous system, including astrocytoma, neuroblastoma, glioma, and schwannomas; and other tumors, including melanoma, skin (non- melanomal) cancer, mesothelioma (cells), seminoma, teratocarcinoma, osteosarcoma, xenoderoma pigmentosum, keratoctanthoma, thyroid follicular cancer and Kaposi’s sarcoma. In some embodiments, the cancer is selected from the group consisting of anal cancer, biliary tract cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, colorectal cancer (CRC), esophageal cancer, gastrointestinal cancer, glioblastoma, glioma, head and neck cancer (HNSCC), hepatocellular carcinoma (HCC), lung cancer, liver cancer, lymphoma, melanoma, mesothelioma, multiple myeloma, non-small cell lung cancer (NSCLC), ovarian cancer, pancreatic cancer, prostate cancer (e.g. hormone refractory prostate adenocarcinoma), renal cell carcinoma (RCC), salivary cancer, thyroid cancer, and other neoplastic malignancies. In some embodiments, the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, and triple negative breast cancer (TNBC). In some embodiments, the cancer is TNBC. In some embodiments, the TNBC is recurrent unresectable. In some embodiments, the TNBC is metastatic. In some embodiments, a combination of a TIGIT antagonist, a PD-1 antagonist, and paclitaxel, or a pharmaceutically acceptable salt thereof may provide enhanced efficacy as compared with existing treatments. For example, TNBC may be an immune-reactive disease amenable to immune modulation of the tumor microenvironment, and expresses TIGIT and PD-L1 highly. Without wishing to be bound by any particular theory, chemotherapeutic agents may augment antitumor immune responses by (i) inducing immunogenic cell death, (ii) enhancing the maturation and activation of dendritic cells, (iii) increasing T-cell penetrance and function in the tumor, (iv) improving the presentation of tumor antigens, and (v) eliminating immunosuppressive cells. In certain embodiments, the tolerability of vibostolimab is a potential added benefit for combination with chemotherapy and a PD-1 antagonist. In certain embodiments, the cancer is metastatic. In some embodiments, the cancer is relapsed. In other embodiments, the cancer is refractory. In yet other embodiments, the cancer is relapsed and refractory. In certain embodiments, provided herein is a method of treating TNBC, comprising administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; and (c) paclitaxel represented by Formula (III) or a pharmaceutically acceptable salt thereof. In some embodiments, provided herein is a method of treating hepatocellular carcinoma, comprising administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; and (c) paclitaxel represented by Formula (III) or a pharmaceutically acceptable salt thereof. In certain embodiments, the method of treating cancer comprises administering to a human patient in need thereof: (a) a TIGIT antagonist as disclosed in Section titled TIGIT Antagonists; (b) a PD-1 antagonist as disclosed in Section titled PD-1 Antagonists; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In certain embodiments, the PD-1 antagonist is an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human PD-1 monoclonal antibody is a human antibody. In other embodiments, the anti-human PD-1 monoclonal antibody is a humanized antibody. In certain embodiments, the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human PD-L1 monoclonal antibody is a human antibody. In other embodiments, the anti-human PD-L1 monoclonal antibody is a humanized antibody. In certain embodiments, the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human TIGIT monoclonal antibody is a human antibody. In other embodiments, the anti-human TIGIT monoclonal antibody is a humanized antibody. Thus, in certain embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a human or humanized anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a human or humanized anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In some embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a human anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a human anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In other embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a humanized anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a humanized anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In one embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is pembrolizumab. In another embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is nivolumab. In another embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is cemiplimab. In certain embodiments of the methods, compositions, kits and uses provided herein, the anti-TIGIT antibody or antigen binding fragment thereof comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110. In some embodiments of the methods, compositions, kits and uses provided herein, the anti-TIGIT antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152. In certain embodiments, the anti- TIGIT antibody or antigen binding fragment thereof comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:295. In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) pembrolizumab; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) nivolumab; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) cemiplimab; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In one specific embodiment of the methods provided herein, the method for treating TNBC comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) pembrolizumab; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In one specific embodiment of the methods provided herein, the method for treating TNBC comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) nivolumab; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. In one specific embodiment of the methods provided herein, the method for treating TNBC comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) cemiplimab; and (c) paclitaxel or a pharmaceutically acceptable salt thereof. Methods of Treating Cancer Using a Combination of a PD-1 Antagonist, a TIGIT Antagonist, Gemcitabine, and Cisplatin In another aspect, provided herein are methods of treating cancer (e.g., biliary cancer) using a combination of a TIGIT antagonist, a PD-1 antagonist, gemcitabine and cisplatin. In certain embodiments, the TIGIT antagonist is an anti-TIGIT antibody or antigen binding fragment thereof. In some embodiments, the PD-1 antagonist is an anti-PD-1 antibody or antigen binding fragment thereof. In certain embodiments, the method of treating cancer comprises administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In some embodiments, the cancer is selected from the group consisting of: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumors, vipoma), small bowel (adenocarcinoma, lymphoma, carcinoid tumors, Karposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large bowel (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma) colorectal; Genitourinary tract: kidney (adenocarcinoma, Wilm's tumor [nephroblastoma], lymphoma, leukemia), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma), testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, lipoma); Liver: hepatoma (hepatocellular carcinoma), cholangiocarcinoma, hepatoblastoma, angiosarcoma, hepatocellular adenoma, hemangioma; Bone: osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing's sarcoma, malignant lymphoma (reticulum cell sarcoma), multiple myeloma, malignant giant cell tumor chordoma, osteochronfroma (osteocartilaginous exostoses), benign chondroma, chondroblastoma, chondromyxofibroma, osteoid osteoma and giant cell tumors; nervous system: skull (osteoma, hemangioma, granuloma, xanthoma, osteitis deformans), meninges (meningioma, meningiosarcoma, gliomatosis), brain (astrocytoma, medulloblastoma, glioma, ependymoma, germinoma [pinealoma], glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, congenital tumors), spinal cord neurofibroma, meningioma, glioma, sarcoma); Gynecological: uterus (endometrial carcinoma), cervix (cervical carcinoma, pre-tumor cervical dysplasia), ovaries (ovarian carcinoma [serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma], granulosa-thecal cell tumors, Sertoli-Leydig cell tumors, dysgerminoma, malignant teratoma), vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonal rhabdomyosarcoma), fallopian tubes (carcinoma), breast; Hematologic: blood (myeloid leukemia [acute and chronic], acute lymphoblastic leukemia, chronic lymphocytic leukemia, myeloproliferative diseases, multiple myeloma, myelodysplastic syndrome); hematopoietic tumors of the lymphoid lineage, include leukemia, acute lymphocytic leukemia, chronic lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Hodgkins lymphoma, non-Hodgkins lymphoma, hairy cell lymphoma, mantle cell lymphoma, myeloma, and Burkett’s lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias, myelodysplastic syndrome and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyosarcoma; tumors of the central and peripheral nervous system, including astrocytoma, neuroblastoma, glioma, and schwannomas; and other tumors, including melanoma, skin (non- melanomal) cancer, mesothelioma (cells), seminoma, teratocarcinoma, osteosarcoma, xenoderoma pigmentosum, keratoctanthoma, thyroid follicular cancer and Kaposi’s sarcoma. In some embodiments, the cancer is selected from the group consisting of anal cancer, biliary tract cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, colorectal cancer (CRC), esophageal cancer, gastrointestinal cancer, glioblastoma, glioma, head and neck cancer (HNSCC), hepatocellular carcinoma (HCC), lung cancer, liver cancer, lymphoma, melanoma, mesothelioma, multiple myeloma, non-small cell lung cancer (NSCLC), ovarian cancer, pancreatic cancer, prostate cancer (e.g. hormone refractory prostate adenocarcinoma), renal cell carcinoma (RCC), salivary cancer, thyroid cancer, and other neoplastic malignancies. In some embodiments, the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, and triple negative breast cancer (TNBC). In some embodiments, the cancer is biliary cancer. In some embodiments, the biliary cancer is locally recurrent unresectable. In some embodiments, the biliary cancer is metastatic. In some embodiments, a combination of a TIGIT antagonist, a PD-1 antagonist, gemcitabine and cisplatin may provide enhanced efficacy as compared with existing treatments. For example, TIGIT and PD-L1 are tightly co-expressed in adenocarcinoma and ESCC. A combination of a TIGIT antagonist, a PD-1 antagonist may provide added benefit over single-agent checkpoint blockade. Without wishing to be bound by any particular theory, chemotherapeutic agents may augment antitumor immune responses by (i) inducing immunogenic cell death, (ii) enhancing the maturation and activation of dendritic cells, (iii) increasing T-cell penetrance and function in the tumor, (iv) improving the presentation of tumor antigens, and (v) eliminating immunosuppressive cells. In certain embodiments, the tolerability of vibostolimab is a potential added benefit for combination with one or more chemotherapeutic agents and a PD-1 antagonist. In certain embodiments, the cancer is metastatic. In some embodiments, the cancer is relapsed. In other embodiments, the cancer is refractory. In yet other embodiments, the cancer is relapsed and refractory. In certain embodiments, provided herein is a method of treating biliary cancer (e.g., locally recurrent unresectable, or metastatic), comprising administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In certain embodiments, the method of treating cancer comprises administering to a human patient in need thereof: (a) a TIGIT antagonist as disclosed in Section titled TIGIT Antagonists; (b) a PD-1 antagonist as disclosed in Section titled PD-1 Antagonists; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In certain embodiments, the PD-1 antagonist is an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human PD-1 monoclonal antibody is a human antibody. In other embodiments, the anti-human PD-1 monoclonal antibody is a humanized antibody. In certain embodiments, the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human PD-L1 monoclonal antibody is a human antibody. In other embodiments, the anti-human PD-L1 monoclonal antibody is a humanized antibody. In certain embodiments, the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human TIGIT monoclonal antibody is a human antibody. In other embodiments, the anti-human TIGIT monoclonal antibody is a humanized antibody. Thus, in certain embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a human or humanized anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a human or humanized anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In some embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a human anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a human anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In other embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a humanized anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a humanized anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In one embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is pembrolizumab. In another embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is nivolumab. In another embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is cemiplimab. In certain embodiments of the methods, compositions, kits and uses provided herein, the anti-TIGIT antibody or antigen binding fragment thereof comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110. In some embodiments of the methods, compositions, kits and uses provided herein, the anti-TIGIT antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152. In certain embodiments, the anti- TIGIT antibody or antigen binding fragment thereof comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:295. In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) pembrolizumab; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) nivolumab; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) cemiplimab; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating biliary cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) pembrolizumab; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating biliary cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) nivolumab; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). In one specific embodiment of the methods provided herein, the method for treating biliary cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) cemiplimab; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II). Methods of Treating Cancer Using a Combination of a PD-1 Antagonist, a TIGIT Antagonist, Capecitabine, and Oxaliplatin In another aspect, provided herein are methods of treating cancer (e.g., gastric cancer) using a combination of a TIGIT antagonist, a PD-1 antagonist, capecitabine or a pharmaceutically acceptable salt thereof and oxaliplatin. In certain embodiments, the TIGIT antagonist is an anti-TIGIT antibody or antigen binding fragment thereof. In some embodiments, the PD-1 antagonist is an anti-PD-1 antibody or antigen binding fragment thereof. In certain embodiments, the method of treating cancer comprises administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In some embodiments, the cancer is selected from the group consisting of: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumors, vipoma), small bowel (adenocarcinoma, lymphoma, carcinoid tumors, Karposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large bowel (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma) colorectal; Genitourinary tract: kidney (adenocarcinoma, Wilm's tumor [nephroblastoma], lymphoma, leukemia), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma), testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, lipoma); Liver: hepatoma (hepatocellular carcinoma), cholangiocarcinoma, hepatoblastoma, angiosarcoma, hepatocellular adenoma, hemangioma; Bone: osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing's sarcoma, malignant lymphoma (reticulum cell sarcoma), multiple myeloma, malignant giant cell tumor chordoma, osteochronfroma (osteocartilaginous exostoses), benign chondroma, chondroblastoma, chondromyxofibroma, osteoid osteoma and giant cell tumors; nervous system: skull (osteoma, hemangioma, granuloma, xanthoma, osteitis deformans), meninges (meningioma, meningiosarcoma, gliomatosis), brain (astrocytoma, medulloblastoma, glioma, ependymoma, germinoma [pinealoma], glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, congenital tumors), spinal cord neurofibroma, meningioma, glioma, sarcoma); Gynecological: uterus (endometrial carcinoma), cervix (cervical carcinoma, pre-tumor cervical dysplasia), ovaries (ovarian carcinoma [serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma], granulosa-thecal cell tumors, Sertoli-Leydig cell tumors, dysgerminoma, malignant teratoma), vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonal rhabdomyosarcoma), fallopian tubes (carcinoma), breast; Hematologic: blood (myeloid leukemia [acute and chronic], acute lymphoblastic leukemia, chronic lymphocytic leukemia, myeloproliferative diseases, multiple myeloma, myelodysplastic syndrome); hematopoietic tumors of the lymphoid lineage, include leukemia, acute lymphocytic leukemia, chronic lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Hodgkins lymphoma, non-Hodgkins lymphoma, hairy cell lymphoma, mantle cell lymphoma, myeloma, and Burkett’s lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias, myelodysplastic syndrome and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyosarcoma; tumors of the central and peripheral nervous system, including astrocytoma, neuroblastoma, glioma, and schwannomas; and other tumors, including melanoma, skin (non- melanomal) cancer, mesothelioma (cells), seminoma, teratocarcinoma, osteosarcoma, xenoderoma pigmentosum, keratoctanthoma, thyroid follicular cancer and Kaposi’s sarcoma. In some embodiments, the cancer is selected from the group consisting of anal cancer, biliary tract cancer, bladder cancer, breast cancer, cervical cancer, colon cancer, colorectal cancer (CRC), esophageal cancer, gastrointestinal cancer, glioblastoma, glioma, head and neck cancer (HNSCC), hepatocellular carcinoma (HCC), lung cancer, liver cancer, lymphoma, melanoma, mesothelioma, multiple myeloma, non-small cell lung cancer (NSCLC), ovarian cancer, pancreatic cancer, prostate cancer (e.g. hormone refractory prostate adenocarcinoma), renal cell carcinoma (RCC), salivary cancer, thyroid cancer, and other neoplastic malignancies. In some embodiments, the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, triple negative breast cancer (TNBC) and gastric cancer. In some embodiments, the cancer is gastric cancer. In some embodiments, the gastric cancer is advanced or GEJ adenocarcinoma. In some embodiments, the gastric cancer is HER2 negative. In some embodiments, the gastric cancer is previously untreated. In some embodiments, a combination of a TIGIT antagonist, a PD-1 antagonist, gemcitabine and cisplatin may provide enhanced efficacy as compared with existing treatments. For example, TIGIT and PD-L1 are tightly co-expressed in adenocarcinoma and ESCC. A combination of a TIGIT antagonist, a PD-1 antagonist may provide added benefit over single-agent checkpoint blockade. Without wishing to be bound by any particular theory, chemotherapeutic agents may augment antitumor immune responses by (i) inducing immunogenic cell death, (ii) enhancing the maturation and activation of dendritic cells, (iii) increasing T-cell penetrance and function in the tumor, (iv) improving the presentation of tumor antigens, and (v) eliminating immunosuppressive cells. In certain embodiments, the tolerability of vibostolimab is a potential added benefit for combination with one or more chemotherapeutic agents and a PD-1 antagonist. In certain embodiments, the cancer is metastatic. In some embodiments, the cancer is relapsed. In other embodiments, the cancer is refractory. In yet other embodiments, the cancer is relapsed and refractory. In certain embodiments, provided herein is a method of treating gastric cancer, comprising administering to a human patient in need thereof: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In certain embodiments, the method of treating cancer comprises administering to a human patient in need thereof: (a) a TIGIT antagonist as disclosed in Section titled TIGIT Antagonists; (b) a PD-1 antagonist as disclosed in Section titled PD-1 Antagonists; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In certain embodiments, the PD-1 antagonist is an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human PD-1 monoclonal antibody is a human antibody. In other embodiments, the anti-human PD-1 monoclonal antibody is a humanized antibody. In certain embodiments, the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human PD-L1 monoclonal antibody is a human antibody. In other embodiments, the anti-human PD-L1 monoclonal antibody is a humanized antibody. In certain embodiments, the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof. In some embodiments, the anti-human TIGIT monoclonal antibody is a human antibody. In other embodiments, the anti-human TIGIT monoclonal antibody is a humanized antibody. Thus, in certain embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a human or humanized anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a human or humanized anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In some embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a human anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a human anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In other embodiments, provided herein is a method for treating cancer, comprising administering to a human patient in need thereof: (a) a humanized anti-human TIGIT monoclonal antibody or antigen binding fragment thereof; (b) a humanized anti-human PD-1 monoclonal antibody or antigen binding fragment thereof; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In one embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is pembrolizumab. In another embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is nivolumab. In another embodiment of the methods, compositions, kits and uses provided herein, the anti-human PD-1 monoclonal antibody or antigen binding fragment thereof is cemiplimab. In certain embodiments of the methods, compositions, kits and uses provided herein, the anti-TIGIT antibody or antigen binding fragment thereof comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110. In some embodiments of the methods, compositions, kits and uses provided herein, the anti-TIGIT antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152. In certain embodiments, the anti- TIGIT antibody or antigen binding fragment thereof comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:295. In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) pembrolizumab; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) nivolumab; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In one specific embodiment of the methods provided herein, the method for treating cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) cemiplimab; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In one specific embodiment of the methods provided herein, the method for treating gastric cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) pembrolizumab; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In one specific embodiment of the methods provided herein, the method for treating gastric cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) nivolumab; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). In one specific embodiment of the methods provided herein, the method for treating gastric cancer comprises administering to a human patient in need thereof: (a) an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) cemiplimab; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI). Dosing and Administration Further provided herein are dosing regimens and routes of administration for treating cancer (e.g., esophageal cancer, TNBC, biliary cancer, gastric cancer) using a combination of a TIGIT antagonist (e.g., an anti-TIGIT monoclonal antibody or antigen binding fragment thereof), a PD-1 antagonist (e.g., an anti-PD-1 monoclonal antibody or antigen binding fragment thereof), and one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin). The TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof), the PD-1 antagonist (e.g., anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof), or one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin) disclosed herein may be administered by doses administered, e.g., daily, 1-7 times per week, weekly, bi-weekly, tri-weekly, every four weeks, every five weeks, every 6 weeks, monthly, bimonthly, quarterly, semiannually, annually, etc. Doses may be administered, e.g., intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, intraspinally, or by inhalation. In certain embodiments, the doses are administered intravenously. In certain embodiments, the doses are administered subcutaneously. In certain embodiments, the doses are administered orally. In some embodiments, the TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti- TIGIT monoclonal antibody) or antigen binding fragment thereof) is administered subcutaneously or intravenously, on a weekly, biweekly, triweekly, every 4 weeks, every 5 weeks, every 6 weeks, every 8 weeks, every 9 weeks, every 10 weeks, every 12 weeks, monthly, bimonthly, or quarterly basis at about 10, about 20, about 50, about 80, about 100, about 200, about 300, about 400, about 500, about 1000 or about 2500 mg / subject. In some specific methods, the dose of the TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) is from about 0.01 mg / kg to about 50 mg / kg, from about 0.05 mg / kg to about 25 mg / kg, from about 0.1 mg / kg to about 10 mg / kg, from about 0.2 mg / kg to about 9 mg / kg, from about 0.3 mg / kg to about 8 mg / kg, from about 0.4 mg / kg to about 7 mg / kg, from about 0.5 mg / kg to about 6 mg / kg, from about 0.6 mg / kg to about 5 mg / kg, from about 0.7 mg / kg to about 4 mg / kg, from about 0.8 mg / kg to about 3 mg / kg, from about 0.9 mg / kg to about 2 mg / kg, from about 1.0 mg / kg to about 1.5 mg / kg, from about 1.0 mg / kg to about 2.0 mg / kg, from about 1.0 mg / kg to about 3.0 mg / kg, or from about 2.0 mg / kg to about 4.0 mg / kg. In some specific methods, the dose of the PD-1 antagonist (e.g., anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof) is from about 10 mg to about 500 mg, from about 25 mg to about 500 mg, from about 50 mg to about 500 mg, from about 100 mg to about 500 mg, from about 200 mg to about 500 mg, from about 150 mg to about 250 mg, from about 175 mg to about 250 mg, from about 200 mg to about 250 mg, from about 150 mg to about 240 mg, from about 175 mg to about 240 mg, or from about 200 mg to about 240 mg. In some embodiments, the dose of the PD-1 antagonist (e.g., anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof) is about 50 mg, about 75 mg, about 100 mg, about 125 mg, about 150 mg, about 175 mg, about 200 mg, about 225 mg, about 240 mg, about 250 mg, about 300 mg, about 400 mg, or about 500 mg. In some embodiments, the PD-1 antagonist (e.g., anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof) is administered subcutaneously or intravenously, on a weekly, biweekly, triweekly, every 4 weeks, every 5 weeks, every 6 weeks, every 8 weeks, every 9 weeks, every 10 weeks, every 12 weeks, monthly, bimonthly, or quarterly basis at about 10, about 20, about 50, about 80, about 100, about 200, about 300, about 400, about 500, about 1000 or about 2500 mg / subject. In some specific methods, the dose of the PD-1 antagonist (e.g., anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof) is from about 0.01 mg / kg to about 50 mg / kg, from about 0.05 mg / kg to about 25 mg / kg, from about 0.1 mg / kg to about 10 mg / kg, from about 0.2 mg / kg to about 9 mg / kg, from about 0.3 mg / kg to about 8 mg / kg, from about 0.4 mg / kg to about 7 mg / kg, from about 0.5 mg / kg to about 6 mg / kg, from about 0.6 mg / kg to about 5 mg / kg, from about 0.7 mg / kg to about 4 mg / kg, from about 0.8 mg / kg to about 3 mg / kg, from about 0.9 mg / kg to about 2 mg / kg, from about 1.0 mg / kg to about 1.5 mg / kg, from about 1.0 mg / kg to about 2.0 mg / kg, from about 1.0 mg / kg to about 3.0 mg / kg, or from about 2.0 mg / kg to about 4.0 mg / kg. In some specific methods, the dose of the PD-1 antagonist (e.g., anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof) is from about 10 mg to about 500 mg, from about 25 mg to about 500 mg, from about 50 mg to about 500 mg, from about 100 mg to about 500 mg, from about 200 mg to about 500 mg, from about 150 mg to about 250 mg, from about 175 mg to about 250 mg, from about 200 mg to about 250 mg, from about 150 mg to about 240 mg, from about 175 mg to about 240 mg, or from about 200 mg to about 240 mg. In some embodiments, the dose of the PD-1 antagonist (e.g., anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof) is about 50 mg, about 75 mg, about 100 mg, about 125 mg, about 150 mg, about 175 mg, about 200 mg, about 225 mg, about 240 mg, about 250 mg, about 300 mg, about 400 mg, or about 500 mg. In some embodiments of the methods described herein, the TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110, and the human patient is administered about 100 mg, about 150 mg, about 200 mg, about 240 mg, about 400 mg, about 480 mg, or about 720 mg, or about 2 mg / kg of the TIGIT antagonist, wherein the TIGIT antagonist is administered once every three or six weeks. In one embodiment, the human patient is administered about 200 mg TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every three weeks. In one embodiment, the human patient is administered 240 mg TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every three weeks. In one embodiment, the human patient is administered 2 mg / kg TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every three weeks. In one embodiment, the human patient is administered 400 mg a TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every three weeks. In certain embodiments of the methods described herein, the TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110, the human patient is administered 400 mg anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody), and the anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) is administered once every six weeks. In some embodiments of the methods described herein, the TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110, and the human patient is administered 200 mg, 240 mg, 400 mg, 480 mg, 720 mg, or 2 mg / kg of the TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof), wherein the TIGIT antagonist is administered once every six weeks. In one embodiment, the human patient is administered 200 mg TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every six weeks. In one embodiment, the human patient is administered 240 mg TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every six weeks. In one embodiment, the human patient is administered 400 mg TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every six weeks. In one embodiment, the human patient is administered about 480 mg TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every six weeks. In one embodiment, the human patient is administered 720 mg TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every six weeks. In one embodiment, the human patient is administered 2 mg / kg TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof) once every six weeks. In some embodiments of the methods described herein, the PD-1 antagonist, anti-PD- 1 antibody or anti-PD-1 monoclonal antibody is pembrolizumab, the human patient is administered about 200 mg, about 240 mg, about 400 mg, about 480 mg, about 720 mg, or about 2 mg / kg pembrolizumab, and pembrolizumab is administered once every three or six weeks. In one embodiment, the human patient is administered about 200 mg pembrolizumab once every three weeks. In one embodiment, the human patient is administered about 240 mg pembrolizumab once every three weeks. In one embodiment, the human patient is administered 2 mg / kg pembrolizumab once every three weeks. In one embodiment, the human patient is administered 400 mg pembrolizumab once every three weeks. In certain embodiments of the methods described herein, the PD-1 antagonist, anti- PD-1 antibody or anti-PD-1 monoclonal antibody is pembrolizumab, the human patient is administered 400 mg pembrolizumab, and pembrolizumab is administered once every six weeks. In some embodiments of the methods described herein, the PD-1 antagonist, anti-PD- 1 antibody or anti-PD-1 monoclonal antibody is pembrolizumab, the human patient is administered about 200 mg, about 240 mg, about 400 mg, about 480 mg, about 720 mg, or about 2 mg / kg pembrolizumab, and pembrolizumab is administered once every six weeks. In one embodiment, the human patient is administered about 200 mg pembrolizumab once every six weeks. In one embodiment, the human patient is administered about 240 mg pembrolizumab once every six weeks. In one embodiment, the human patient is administered about 400 mg pembrolizumab once every six weeks. In one embodiment, the human patient is administered 480 mg pembrolizumab once every six weeks. In one embodiment, the human patient is administered 720 mg pembrolizumab once every six weeks. In one embodiment, the human patient is administered 2 mg / kg pembrolizumab once every six weeks. In some embodiments of the invention, the TIGIT antagonist (e.g., anti-TIGIT antibody, or antigen binding fragment thereof), and the PD-1 antagonist (e.g., anti-PD-1 antibody, or antigen binding fragment thereof), are administered to the patient once every approximately six weeks for 12 weeks or more. In other embodiments, the TIGIT antagonist (e.g., anti-TIGIT antibody, or antigen binding fragment) and the PD-1 antagonist (e.g., anti- PD-1 antibody, or antigen binding fragment thereof), are administered to the patient once every six weeks for 18 weeks or more, 24 weeks or more, 30 weeks or more, 36 weeks or more, 42 weeks or more, 48 weeks or more, 54 weeks or more, 60 weeks or more, 66 weeks or more, 72 weeks or more, 78 weeks or more, 84 weeks or more, or 90 weeks or more. In one embodiment, the administration occurs on the same day. In a sub-embodiment, the TIGIT antagonist (e.g., anti-TIGIT antibody, or antigen binding fragment thereof), and the PD-1 antagonist (e.g., anti-PD-1 antibody, or antigen binding fragment thereof), are administered on the same day sequentially, simultaneously or separately (e.g., in a single formulation, a co-formulation, or concurrently as separate formulations). In an alternative embodiment, the anti-TIGIT antibody or antigen binding fragment thereof and the anti-PD-1 antibody or antigen binding fragment thereof are administered sequentially on the same day (e.g., as separate formulations), in either order. In one embodiment of same day sequential administration, the anti-TIGIT antibody or antigen binding fragment thereof is administered first. In another embodiment of same day sequential administration, the anti-PD-1 antibody or antigen binding fragment thereof is administered first. In certain embodiments of the methods compositions, kits and uses described herein, the TIGIT antagonist (e.g., anti- human TIGIT antibody or antigen binding fragment thereof) comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110, the human patient is administered 200 mg of the TIGIT antagonist, and the TIGIT antagonist is administered once every three weeks. In certain embodiments of the methods compositions, kits and uses described herein, the TIGIT antagonist (e.g., anti- human TIGIT antibody or antigen binding fragment thereof) comprises three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110, and the human patient is administered about 400 mg of the TIGIT antagonist, and the TIGIT antagonist is administered once every six weeks. In certain embodiments of the methods compositions, kits and uses described herein, the PD-1 antagonist or anti-human PD-1 monoclonal antibody is pembrolizumab, the human patient is administered about 200 mg pembrolizumab, and pembrolizumab is administered once every three weeks. In certain embodiments of the methods compositions, kits and uses described herein, the PD-1 antagonist or anti-human PD-1 monoclonal antibody is pembrolizumab, the human patient is administered about 400 mg pembrolizumab, and pembrolizumab is administered once every six weeks. In other embodiments of the methods compositions, kits and uses described herein, the PD-antagonist or anti-human PD-1 monoclonal antibody is nivolumab, the human patient is administered about 240 mg or about 3 mg / kg nivolumab, and nivolumab is administered once every two weeks. In one specific embodiment, the human patient is administered about 240 mg nivolumab once every two weeks. In one specific embodiment, the human patient is administered about 3 mg / kg nivolumab once every two weeks. In other embodiments of the methods described herein, the PD-1 antagonist or anti-human PD-1 monoclonal antibody is nivolumab, the human patient is administered about 480 mg nivolumab, and nivolumab is administered once every four weeks. In yet other embodiments of the methods compositions, kits and uses described herein, the PD-1 antagonist (e.g, anti-human PD-1 monoclonal antibody or antigen binding fragment thereof) is cemiplimab, the human patient is administered about 350 mg cemiplimab, and cemiplimab is administered once every three weeks. In some embodiments, the TIGIT antagonist (e.g., an anti-TIGIT antibody) and the PD-1 antagonist (e.g, anti-PD-1 antibody) are co-formulated. In one embodiment, a co- formulated product with about 200 mg pembrolizumab or a pembrolizumab variant and 200 mg of an antibody comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 is used for intravenous infusion. In one embodiment, a co-formulated product with 200 mg pembrolizumab or a pembrolizumab variant and 300 mg of antibody comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 is used for intravenous infusion. In one embodiment, a co-formulated product with about 200 mg pembrolizumab or a pembrolizumab variant and about 400 mg of antibody comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 is used for intravenous infusion. In another embodiment, a co-formulated product with about 200 mg of pembrolizumab or a pembrolizumab variant and about 500 mg of antibody comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 is used for intravenous infusion. In another embodiment, a co-formulated product with of about 200 mg pembrolizumab or a pembrolizumab variant and about 600 mg of antibody comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 is used for intravenous infusion. In another embodiment, a co-formulated product with about 200 mg of pembrolizumab or a pembrolizumab variant and about 700 mg of antibody comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 is used for intravenous infusion. In certain embodiments, 5-fluorouracil is administered intravenously (e.g., as a continuous IV infusion). In certain embodiments, 5-fluorouracil is administered five times every three weeks. In some embodiments, a human patient is administered a total of about 3000 mg / m2or about 4000 mg / m25-fluorouracil per cycle. In some embodiments, a human patient is administered about 500 mg / m2, about 600 mg / m2, about 650 mg / m2, about 700 mg / m2, about 750 mg / m2, about 800 mg / m2, or about 900 mg / m25-fluorouracil per day wherein the 5-fluorouracil is administered five times every three weeks. In some embodiments, 5-fluorouracil is administered on the first five days of a 3-week cycle. In certain embodiments, cisplatin is administered intravenously (e.g., a 60 minutes to 120 minutes IV infusion). In certain embodiments, cisplatin is administered once every three weeks. In some embodiments, a human patient is administered about 40 mg / m2to about 100 mg / m2cisplatin once every three weeks. In some embodiments, a human patient is administered about 60 mg / m2to about 80 mg / m2cisplatin once every three weeks. Thus, in some embodiments of the methods compositions, kits and uses provided herein, the human patient is administered: (a) about 100 mg, about 150 mg, about 200 mg, about 250 mg, or about 400 mg, or about 2 mg / kg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 100 mg, about 150 mg, about 200 mg, about 250 mg, or about 400 mg, or about 2 mg / kg pembrolizumab; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 60 mg / m2or 80 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three or six weeks, and wherein (c) is administered five times every three or six week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg, about 240 mg, about 2 mg / kg or about 22 mg / mL of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg, about 240 mg, about 2 mg / kg or about 22 mg / mL pembrolizumab; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 60 mg / m2or 80 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three weeks, and wherein (c) is administered five times every three week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 60 mg / m2or 80 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three weeks, and wherein (c) is administered five times every three week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; (c) a total of about 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 80 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three weeks, and wherein (c) is administered five times every three week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; (c) a total of about 3000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 60 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three weeks, and wherein (c) is administered five times every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152; (b) about 200 mg pembrolizumab; (c) a total of about 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 80 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three weeks, and wherein (c) is administered five times every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152; (b) about 200 mg pembrolizumab; (c) a total of about 3000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 60 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three weeks, and wherein (c) is administered five times every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295; (b) about 200 mg pembrolizumab; (c) a total of about 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 80 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three weeks, and wherein (c) is administered five times every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295; (b) about 200 mg pembrolizumab; (c) a total of about 3000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 60 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three weeks, and wherein (c) is administered five times every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 240 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 240 mg pembrolizumab; (c) a total of about 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 80 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is are administered once every three weeks, and wherein (c) is administered five times every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 2 mg / kg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 2 mg / kg pembrolizumab; (c) a total of about 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 80 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), and (d) is administered once every three weeks, and wherein (c) is administered five times every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 400 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; (c) a total of about 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 80 mg / m2cisplatin represented by Formula (II), wherein each of (a) and (b) is administered once every six weeks, wherein (c) is administered five times every three weeks, and wherein (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; (c) a total of about 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 80 mg / m2cisplatin represented by Formula (II), wherein each of (a) and (b) is administered once every six weeks, wherein (c) is administered five times every three weeks, and wherein (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; (c) a total of about 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 80 mg / m2cisplatin represented by Formula (II), wherein each of (a), (d) is administered once every three weeks, wherein (b) is administered once every six weeks, and wherein (c) is administered five times every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; (c) a total of about 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 80 mg / m2cisplatin represented by Formula (II), wherein each of (a) and(d) is administered once every three weeks, wherein (b) is administered once every six weeks, and wherein (c) is administered five times every three weeks. In certain embodiments of the methods, compositions, kits and uses described herein, a co-formulation of pembrolizumab and of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113 and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 are administered by IV infusion. In some embodiments, the co-formulation is administered for about 30 minutes every three weeks. In some embodiments, the co- formulation is administered for from about 25 to about 40 minutes every three weeks. In certain embodiments, paclitaxel or a pharmaceutically acceptable salt thereof is administered intravenously. In certain embodiments, paclitaxel or a pharmaceutically acceptable salt thereof is administered once every week. In some embodiments, a human patient is administered about 70 mg / m2to about 100 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof once every week. In some embodiments, a human patient is administered about 80 mg / m2to about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof once every week. In some embodiments, a human patient is administered about 70 mg / m2, about 80 mg / m2, about 90 mg / m2, or about 100 mg / m2, paclitaxel or a pharmaceutically acceptable salt thereof once every week. In some embodiments, a human patient is administered about 80 mg / m2, or about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof once every week. Thus, in some embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 100 mg, about 150 mg, about 200 mg, about 250 mg, or about 400 mg, or about 2 mg / kg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 100 mg, about 150 mg, about 200 mg, about 250 mg, or about 400 mg, or about 2 mg / kg pembrolizumab; and (c) about 80 mg / m2or about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three or six weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg, about 240 mg, about 2 mg / kg or about 22 mg / mL of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; and (b) about 200 mg, about 240 mg, about 2 mg / kg or about 22 mg / mL pembrolizumab; and (c) about 80 mg / m2to about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; and (c) about 80 mg / m2or about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; and (c) about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; and (c) about 80 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQcomprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQcomprising the amino acid sequence as set forth in SEQ ID NO: 152; (b) about 200 mg pembrolizumab; and (c) about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152; (b) about 200 mg pembrolizumab; and (c) about 80 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295; (b) about 200 mg pembrolizumab; and (c) about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295; (b) about 200 mg pembrolizumab; and (c) about 80 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 240 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 240 mg pembrolizumab; and (c) about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 2 mg / kg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 2 mg / kg pembrolizumab; and (c) about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every three weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 400 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; and (c) about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every six weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; and (c) about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein each of (a) and (b) is administered once every six weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; and (c) about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein (a) is administered once every three weeks, wherein (b) is administered once every six weeks, and wherein (c) is administered once a week. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; and (c) about 90 mg / m2paclitaxel or a pharmaceutically acceptable salt thereof, wherein (a) is administered once every three weeks, wherein (b) is administered once every six weeks, and wherein (c) is administered once a week. In certain embodiments, gemcitabine or a pharmaceutically acceptable salt thereof is administered intravenously (e.g., as a continuous IV infusion). In certain embodiments, gemcitabine or a pharmaceutically acceptable salt thereof is administered once every three weeks. In some embodiments, a human patient is administered about 500 mg / m2to about 1500 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three week. In some embodiments, a human patient is administered about 800 mg / m2to about 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three week. In some embodiments, a human patient is administered about 500 mg / m2, about 600 mg / m2, about 700 mg / m2, about 800 mg / m2, about 900 mg / m2, about 1000 mg / m2, about 1100 mg / m2, about 1200 mg / m2, about 1300 mg / m2, about 1400 mg / m2, or about 1500 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three week. In some embodiments, a human patient is administered about 800 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three week. In some embodiments, a human patient is administered about 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three week. In certain embodiments, cisplatin is administered intravenously (e.g., a 60 minutes to 120 minutes IV infusion). In certain embodiments, cisplatin is administered once every three weeks. In some embodiments, a human patient is administered about 10 mg / m2to about 50 mg / m2cisplatin once every three weeks. In some embodiments, a human patient is administered about 20 mg / m2to about 25 mg / m2cisplatin once every three weeks. In some embodiments, a human patient is administered about 10 mg / m2, about 15 mg / m2, about 20 mg / m2, about 25 mg / m2, about 30 mg / m2, about 35 mg / m2, about 40 mg / m2, about 45 mg / m2, or about 50 mg / m2cisplatin once every three weeks. Thus, in some embodiments of the methods compositions, kits and uses provided herein, the human patient is administered: (a) about 100 mg, about 150 mg, about 200 mg, about 250 mg, or about 400 mg, or about 2 mg / kg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 100 mg, about 150 mg, about 200 mg, about 250 mg, or about 400 mg, or about 2 mg / kg pembrolizumab; (c) about 800 mg / m2or 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 20 mg / m2or 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three or six weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg, about 240 mg, about 2 mg / kg or about 22 mg / mL of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg, about 240 mg, about 2 mg / kg or about 22 mg / mL pembrolizumab; (c) about 800 mg / m2or 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 20 mg / m2or 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; (c) about 800 mg / m2or 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 20 mg / m2or 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; (c) about 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; (c) about 800 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 20 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152; (b) about 200 mg pembrolizumab; (c) about 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152; (b) about 200 mg pembrolizumab; (c) about 800 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 20 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295; (b) about 200 mg pembrolizumab; (c) about 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks.. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295; (b) about 200 mg pembrolizumab; (c) about 800 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 20 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 240 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 240 mg pembrolizumab; (c) about 800 mg / m2or about 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 200 mg / m2or about 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 2 mg / kg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 2 mg / kg pembrolizumab; (c) about 800 mg / m2or about 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 200 mg / m2or about 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 400 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; (c) about 800 mg / m2or about 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 200 mg / m2or about 25 mg / m2cisplatin represented by Formula (II), wherein each of (a) and (b) is administered once every six weeks, and each of (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; (c) about 800 mg / m2or about 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 200 mg / m2or about 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (b), (c) and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; (c) about 800 mg / m2or about 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 200 mg / m2or about 25 mg / m2cisplatin represented by Formula (II), wherein each of (a), (c) and (d) is administered once every three weeks, and (b) is administered once every six weeks. In certain embodiments, capecitabine or a pharmaceutically acceptable salt thereof is administered orally. In certain embodiments, capecitabine or a pharmaceutically acceptable salt thereof is administered twice a day. In some embodiments, a human patient is administered about 500 mg / m2to about 1500 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day. In some embodiments, a human patient is administered about 750 mg / m2to about 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day. In some embodiments, a human patient is administered about 750 mg / m2, about 800 mg / m2, about 850 mg / m2, about 900 mg / m2, about 950 mg / m2, or about 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day. In some embodiments, a human patient is administered about 750 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day. In some embodiments, a human patient is administered about 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day. In certain embodiments, oxaliplatin is administered intravenously (e.g., a 60 minutes to 120 minutes IV infusion). In certain embodiments, oxaliplatin is administered once every three weeks. In some embodiments, a human patient is administered about 80 mg / m2to about 150 mg / m2oxaliplatin once every three weeks. In some embodiments, a human patient is administered about 100 mg / m2to about 130 mg / m2cisplatin once every three weeks. In some embodiments, a human patient is administered about 100 mg / m2, about 120 mg / m2, or about 130 mg / m2oxaliplatin once every three weeks. Thus, in some embodiments of the methods compositions, kits and uses provided herein, the human patient is administered: (a) about 100 mg, about 150 mg, about 200 mg, about 250 mg, or about 400 mg, or about 2 mg / kg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 100 mg, about 150 mg, about 200 mg, about 250 mg, or about 400 mg, or about 2 mg / kg pembrolizumab; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI), wherein each of (a), and (b) is administered once every three or six weeks, (c) is administered twice a day, and (d) is administered once every three weeks. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg, about 240 mg, about 2 mg / kg or about 22 mg / mL of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg, about 240 mg, about 2 mg / kg or about 22 mg / mL pembrolizumab; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI), wherein each of (a), (b), and (d) is administered once every three weeks, and (c) is administered twice a day. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 200 mg pembrolizumab; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI), wherein each of (a), (b), and (d) is administered once every three weeks, and (c) is administered twice a day. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 152; (b) about 200 mg pembrolizumab; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI), wherein each of (a), (b), and (d) is administered once every three weeks, and (c) is administered twice a day. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295; (b) about 200 mg pembrolizumab; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI), wherein each of (a), (b), and (d) is administered once every three weeks, and (c) is administered twice a day. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 240 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 240 mg pembrolizumab; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI), wherein each of (a), (b), and (d) is administered once every three weeks, and (c) is administered twice a day. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 2 mg / kg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 2 mg / kg pembrolizumab; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI), wherein each of (a), (b), and (d) is administered once every three weeks, and (c) is administered twice a day. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 400 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI), wherein each of (a), (b), and (d) is administered once every three weeks, and (c) is administered twice a day. In certain embodiments of the methods, compositions, kits and uses provided herein, the human patient is administered: (a) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110; (b) about 400 mg pembrolizumab; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI), wherein each of (a) and (d) is administered once every three weeks, (b) is administered once every six weeks, and (c) is administered twice a day. In certain embodiments of the methods, compositions, kits and uses described herein, a co-formulation of pembrolizumab and of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising the amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising the amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising the amino acid sequence as set forth in SEQ ID NO: 113 and three heavy chain CDRs: CDRH1 comprising the amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising the amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising the amino acid sequence as set forth in SEQ ID NO: 110 are administered by IV infusion. In some embodiments, the co-formulation is administered for about 30 minutes every three weeks. In some embodiments, the co- formulation is administered for from about 25 to about 40 minutes every three weeks. In some embodiments, at least one of the therapeutic agents (e.g., the anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or binding fragment thereof, the anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or binding fragment thereof, 5-fluorouracil, cisplatin, or paclitaxel) in the combination therapy is administered using the same dosage regimen (dose, frequency, and duration of treatment) that is typically employed when the agent is used as monotherapy for treating the same condition. In other embodiments, the patient receives a lower total amount of at least one of the therapeutic agents (e.g., the anti- TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or binding fragment thereof, the anti- PD-1monoclonal antibody or binding fragment thereof, 5-fluorouracil, cisplatin, or paclitaxel) in the combination therapy than when the agent is used as monotherapy, e.g., smaller doses, less frequent doses, and / or shorter treatment duration. A combination therapy disclosed herein may be used prior to or following surgery to remove a tumor and may be used prior to, during, or after radiation treatment. In some embodiments, a combination therapy disclosed herein is administered to a patient who has not previously been treated with a biotherapeutic or chemotherapeutic agent, i.e., is treatment-naïve. In other embodiments, the combination therapy is administered to a patient who failed to achieve a sustained response after prior therapy with the biotherapeutic or chemotherapeutic agent, i.e., is treatment-experienced. The therapeutic combination disclosed herein may be used in combination with one or more other active agents, including but not limited to, other anti-cancer agents that are used in the prevention, treatment, control, amelioration, or reduction of risk of a particular disease or condition (e.g., cancer). Such other active agents may be administered, by a route and in an amount commonly used therefor, contemporaneously or sequentially with one or more of the therapeutic agents in the combinations disclosed herein. The one or more additional active agents may be co-administered with the TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof), the PD-1 antagonist (e.g., anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof), or one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, or paclitaxel). The additional active agent(s) can be administered in a single dosage form with one or more co-administered agent selected from the TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof), the PD-1 antagonist, e.g., anti-PD-1 antibody (e.g., anti- PD-1 monoclonal antibody) or antigen binding fragment thereof), and one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, or paclitaxel). The additional active agent(s) can also be administered in separate dosage form(s) from the dosage forms containing the TIGIT antagonist (e.g., anti-TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof), the PD-1 antagonist (e.g., anti-PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof), or one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin). Administration of a PD-1 antagonist and / or a TIGIT antagonist can be by any suitable route, and can be facilitated by agents such as hyaluronan degrading enzymes, including hyaluronidases, including soluble PH20 polypeptides, and variants thereof. For systemic administration, the facilitating agents can be modified to increase pharmacological properties, such as serum half-life, by modifying the agents, such as with polymers. See, e.g., U.S. Patent Nos.7,767,429, 8,431,380, 7,871,607, International Publication No. WO 2020 / 022791, U.S. Patent Publication No. US2006 / 0104968 and European Patent 1858926, and in numerous other patents and publications. Exemplary of such agents is the known agent PEGPH20 or rHuPH20. Accordingly, specific embodiments cover pharmaceutical compositions comprising a PD-1 antagonist and / or a TIGIT antagonist and any one of a hyaluronan degrading enzyme, hyaluronidase, soluble hyaluronidase, soluble PH20 polypeptide, or a variant of any of the foregoing enzymes. In particular embodiments, the pharmaceutical composition comprises a PD-1 antagonist and a soluble PH20 polypeptide or a variant thereof. In another particular embodiments, the pharmaceutical composition comprises a TIGIT antagonist and a soluble PH20 polypeptide or a variant thereof. In some embodiments, the pharmaceutical composition comprises a PD-1 antagonist, a TIGIT antagonist and a soluble PH20 polypeptide or a variant thereof. In some embodiments, the pharmaceutical composition comprises a PD-1 antagonist, a TIGIT antagonist, 5-fluorouracil, cisplatin, and a soluble PH20 polypeptide or a variant thereof. In some embodiments, the pharmaceutical composition comprises a PD-1 antagonist, a TIGIT antagonist, paclitaxel or a pharmaceutically acceptable salt thereof, and a soluble PH20 polypeptide or a variant thereof. In some embodiments, the pharmaceutical composition comprises a PD-1 antagonist, a TIGIT antagonist, gemcitabine or a pharmaceutically acceptable salt thereof, cisplatin and a soluble PH20 polypeptide or a variant thereof. In some embodiments, the pharmaceutical composition comprises a PD-1 antagonist, a TIGIT antagonist, capecitabine or a pharmaceutically acceptable salt thereof, oxaliplatin and a soluble PH20 polypeptide or a variant thereof. Pharmaceutical Compositions In yet another aspect, provided herein are pharmaceutical compositions comprising the therapeutic agents disclosed herein (e.g., a TIGIT antagonist, a PD-1 antagonist, and one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin)). In certain embodiments, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier. The pharmaceutical compositions comprising an anti-human TIGIT antibody (e.g., anti-TIGIT monoclonal antibody) or antigen binding fragment thereof, an anti-human PD-1 antibody (e.g., anti-PD-1 monoclonal antibody) or antigen binding fragment thereof, and one or more chemotherapeutic agents (e.g., 5-fluorouracil, cisplatin, paclitaxel or a pharmaceutically acceptable salt thereof, gemcitabine or a pharmaceutically acceptable salt thereof, capecitabine or a pharmaceutically acceptable salt thereof, and / or oxaliplatin), can be prepared for storage by mixing the antibodies or compounds having the desired degree of purity with optionally physiologically acceptable carriers, excipients, or stabilizers (see, e.g., Remington, Remington’s Pharmaceutical Sciences (18thed.1980)) in the form of aqueous solutions or lyophilized or other dried forms. The pharmaceutically acceptable carriers, excipients, or stabilizers are non-toxic to the cell or mammalian being exposed thereto at the dosage and concentrations employed. Often the pharmaceutically acceptable carrier is an aqueous pH buffered solution. Examples of pharmaceutically acceptable carriers include buffers, such as phosphate, citrate, acetate, and other organic acids; antioxidants, such as ascorbic acid; low molecular weight (e.g., fewer than about 10 amino acid residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulin; hydrophilic polymers, such as polyvinylpyrrolidone; amino acids, such as glycine, glutamine, asparagine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates, including glucose, mannose, or dextrins; chelating agents, such as EDTA; sugar alcohols, such as mannitol or sorbitol; salt-forming counterions, such as sodium; and / or nonionic surfactants, such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM. The pharmaceutically acceptable carriers can also refer to a diluent, adjuvate (e.g., Freund’s adjuvate (complete or incomplete)), excipient, or vehicle. Such carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, and the like. Water is an exemplary carrier when a composition (e.g., a pharmaceutical composition) is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable excipients (e.g., pharmaceutical excipients) include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol, and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. Compositions can take the form of solutions, suspensions, emulsions, tablets, pills, capsules, powders, sus...

Claims

WHAT IS CLAIMED IS:

1. A method of treating cancer, comprising administering to a human patient in need thereof a therapeutic combination comprising an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) 5-fluorouracil represented by Formula (I) and I); sented by Formula (II)(II).

2. The method of claim 1, wherein the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, and triple negative breast cancer (TNBC).

3. The method of claim 2, wherein the cancer is esophageal cancer.

4. The method of claim 3, wherein the esophageal cancer is advanced esophageal cancer.

5. The method of claim 3, wherein the esophageal cancer is metastatic esophageal cancer.

6. The method of claim 3, wherein the esophageal cancer is locally advanced unresectable.

7. The method of claim 3, wherein the esophageal cancer is metastatic adenocarcinoma.

8. The method of claim 3, wherein the esophageal cancer is squamous cell carcinoma of the esophagus (ESCC).

9. The method of claim 3, wherein the esophageal cancer is advanced Siewert type 1 adenocarcinoma of gastroesophageal junction (GEJ).

10. The method of claim 3, wherein the esophageal cancer is metastatic Siewert type 1 adenocarcinoma of GEJ.

11. A kit comprising an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II).

12. The kit of claim 11, further comprising instructions for administering to a human patient in need thereof the TIGIT antagonist, the PD-1 antagonist, 5-fluorouracil, and cisplatin.

13. Use of a therapeutic combination for treating cancer in a human patient in need thereof, wherein the therapeutic combination comprises an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) 5-fluorouracil represented by Formula (I); and (d) cisplatin represented by Formula (II).

14. The use of claim 13, wherein the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, and triple negative breast cancer (TNBC).

15. The use of claim 14, wherein the cancer is esophageal cancer.

16. The use of claim 15, wherein the esophageal cancer is advanced esophageal cancer.

17. The use of claim 15, wherein the esophageal cancer is metastatic esophageal cancer.

18. The use of claim 15, wherein the esophageal cancer is locally advanced unresectable.

19. The use of claim 15, wherein the esophageal cancer is metastatic adenocarcinoma.

20. The use of claim 15, wherein the esophageal cancer is squamous cell carcinoma of the esophagus (ESCC).

21. The use of claim 15, wherein the esophageal cancer is advanced Siewert type 1 adenocarcinoma of gastroesophageal junction (GEJ).

22. The use of claim 15, wherein the esophageal cancer is metastatic Siewert type 1 adenocarcinoma of GEJ.

23. The method, kit, or use of any one of claims 1-22, wherein the PD-1 antagonist and the TIGIT antagonist are formulated separately.

24. The method, kit, or use of any one of claims 1-22, wherein the PD-1 antagonist and the TIGIT antagonist are in a fixed dose combination.

25. The method, kit, or use of any one of claims 1-22, wherein the PD-1 antagonist and the TIGIT antagonist are co-formulated.

26. The method, kit, or use of any one of claims 1-25, wherein the PD-1 antagonist is an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof.

27. The method, kit, or use of any one of claims 1-25, wherein the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof.

28. The method, kit, or use of claim 26, wherein the anti-human PD-1 monoclonal antibody is a humanized antibody.

29. The method, kit, or use of claim 26, wherein the anti-human PD-1 monoclonal antibody is a human antibody.

30. The method, kit, or use of any one of claims 1-29, wherein the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof.

31. The method, kit, or use of claim 30, wherein the anti-human TIGIT monoclonal antibody is a humanized antibody.

32. The method, kit, or use of claim 30, wherein the anti-human TIGIT monoclonal antibody is a human antibody.

33. The method, kit, or use of claim 26, wherein the anti-human PD-1 monoclonal antibody is pembrolizumab.

34. The method, kit, or use of claim 26, wherein the anti-human PD-1 monoclonal antibody is nivolumab.

35. The method, kit, or use of claim 26, wherein the anti-human PD-1 monoclonal antibody is cemiplimab.

36. The method, kit, or use of claim 30, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

37. The method, kit, or use of claim 36, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:

152.

38. The method, kit, or use of claim 37, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a light chain comprising orconsisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:

295.

39. The method, kit, or use of any one of claims 1-25, wherein: (a) the PD-1 antagonist is pembrolizumab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

40. The method, kit, or use of any one of claims 1-25, wherein: (a) the PD-1 antagonist is nivolumab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

41. The method, kit, or use of any one of claims 1-25, wherein: (a) the PD-1 antagonist is cemiplimab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

42. The method, kit or use of claims 39-41, wherein the TIGIT antagonist comprises aheavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:

152.

43. The method, kit or use of claim 42, wherein the TIGIT antagonist comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:

295.

44. The method of claims 39, 42, or 43, wherein the human patient is administered about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks.

45. The method of claim 44, wherein the human patient is administered about 200 mg pembrolizumab once every three weeks.

46. The method of claim 40, wherein the human patient is administered about 240 mg or about 3 mg / kg nivolumab once every two weeks, or about 480 mg nivolumab once every four weeks.

47. The method of claim 41, wherein the human patient is administered about 350 mg cemiplimab once every three weeks.

48. The method of any one of claims 39-43, wherein the human patient is administered from about 100 mg to about 500 mg of the TIGIT antagonist once every three weeks.

49. The method of claim 48, wherein the human patient is administered about 50, about 75, about 100, about 125, about 150, about 175, about 200, about 225, about 250, about 275, or about 300 mg of the TIGIT antagonist once every three weeks.

50. The method of claim 49, wherein the human patient is administered about 200 mg of the TIGIT antagonist once every three weeks.

51. The method of claims 39-43, wherein the human patient is administered from about 400 mg of the TIGIT antagonist once every six weeks.

52. The method of any one of claims 1-5 and 25-51, wherein the human patient is administered a total of about 3000 mg / m2to about 4000 mg / m25-fluorouracil per 3 week cycle.

53. The method of claim 52, wherein the human patient is administered about 4000 mg / m25-fluorouracil per 3 week cycle.

54. The method of claim 53, wherein the human patient is administered about 800 or about 1000 mg / m25-fluorouracil a day.

55. The method of claim 52, wherein the human patient is administered a total of about 3000 mg / m25-fluorouracil per 3 week cycle.

56. The method of claim 55, wherein the human patient is administered about 600 mg / m25-fluorouracil a day.

57. The method of claims 1-5 and 25-55, wherein the human patient is administered about 40 mg / m2to about 100 mg / m2cisplatin once every three weeks.

58. The method of claim 57, wherein the human patient is administered about 80 mg / m2cisplatin once every three weeks.

59. The method of claim 57, wherein the human patient is administered about 60 mg / m2cisplatin once every three weeks.

60. A method of treating esophageal cancer, comprising administering to a human patient in need thereof a therapeutic combination comprising: (a) about 200 mg pembrolizumab; (b) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acidsequence as set forth in SEQ ID NO: 110; (c) a total of about 3000 mg / m2or 4000 mg / m25-fluorouracil represented by Formula (I) per cycle; and (d) about 60 mg / m2or 80 mg / m2cisplatin represented by Formula (II).

61. The method of claim 60, wherein each of (a), (b), and (d) is administered once every three weeks.

62. The method of claims 60-61, wherein 5-fluorouracil is administered five times every three weeks.

63. The method of claims 60-62, wherein (a) and (b) are administered on the same day, and wherein (a) and (b) are administered sequentially or concurrently.

64. The method of claim 63, wherein (a) and (b) are co-formulated.

65. The method of claim 63, wherein (a) and (b) are in a fixed dose combination.

66. The method of claims 60-65, wherein the esophageal cancer is advanced esophageal cancer.

67. The method of claims 60-65, wherein the esophageal cancer is metastatic esophageal cancer.

68. The method of claims 60-65, wherein the esophageal cancer is locally advanced unresectable.

69. The method of claims 60-65, wherein the esophageal cancer is metastatic adenocarcinoma.

70. The method of claims 60-65, wherein the esophageal cancer is squamous cell carcinoma of the esophagus (ESCC).

71. A method of treating cancer, comprising administering to a human patient in need thereof a therapeutic combination comprising an effective amount of:(a) a TIGIT antagonist; (b) a PD-1 antagonist; and (c) paclitaxel represented by Formula (III) or a pharmaceutically acceptable salt thereof. I)72. The method of claim 71, wherein the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, and triple negative breast cancer (TNBC).

73. The method of claim 72, wherein the cancer is TNBC.

74. The method of claim 73, wherein the TNBC is recurrent unresectable.

75. The method of claim 73, wherein the TNBC is metastatic TNBC.

76. A kit comprising an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; and (c) paclitaxel represented by Formula (III) or a pharmaceutically acceptable salt thereof.

77. The kit of claim 76, further comprising instructions for administering to a human patient in need thereof the TIGIT antagonist, the PD-1 antagonist, and paclitaxel.

78. Use of a therapeutic combination for treating cancer in a human patient in need thereof, wherein the therapeutic combination comprises an effective amount of: (a) a TIGIT antagonist;(b) a PD-1 antagonist; and (c) paclitaxel represented by Formula (III) or a pharmaceutically acceptable salt thereof.

79. The use of claim 78, wherein the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, and triple negative breast cancer (TNBC).

80. The use of claim 79, wherein the cancer is TNBC.

81. The use of claim 80, wherein the TNBC is recurrent unresectable.

82. The use of claim 80, wherein the TNBC is metastatic TNBC.

83. The method, kit, or use of any one of claims 71-82, wherein the PD-1 antagonist and the TIGIT antagonist are in a fixed dose combination.

84. The method, kit, or use of any one of claims 71-82, wherein the PD-1 antagonist and the TIGIT antagonist are formulated separately.

85. The method, kit, or use of any one of claims 71-82, wherein the PD-1 antagonist and the TIGIT antagonist are co-formulated.

86. The method, kit, or use of any one of claims 71-83, wherein the PD-1 antagonist is an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof.

87. The method, kit, or use of any one of claims 71-83, wherein the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof.

88. The method, kit, or use of claim 86, wherein the anti-human PD-1 monoclonal antibody is a humanized antibody.

89. The method, kit, or use of claim 86, wherein the anti-human PD-1 monoclonal antibody is a human antibody.

90. The method, kit, or use of any one of claims 71-89, wherein the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof.

91. The method, kit, or use of claim 90, wherein the anti-human TIGIT monoclonal antibody is a humanized antibody.

92. The method, kit, or use of claim 90, wherein the anti-human TIGIT monoclonal antibody is a human antibody.

93. The method, kit, or use of claim 86, wherein the anti-human PD-1 monoclonal antibody is pembrolizumab.

94. The method, kit, or use of claim 86, wherein the anti-human PD-1 monoclonal antibody is nivolumab.

95. The method, kit, or use of claim 86, wherein the anti-human PD-1 monoclonal antibody is cemiplimab.

96. The method, kit, or use of claim 90, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

97. The method, kit, or use of claim 96, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:

152.

98. The method, kit, or use of claim 97, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a light chain comprising orconsisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:

295.

99. The method, kit, or use of any one of claims 71-83, wherein: (a) the PD-1 antagonist is pembrolizumab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

100. The method, kit, or use of any one of claims 71-83, wherein: (a) the PD-1 antagonist is nivolumab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

101. The method, kit, or use of any one of claims 71-83, wherein: (a) the PD-1 antagonist is cemiplimab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

102. The method, kit or use of claims 99-101, wherein the TIGIT antagonist comprises aheavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:

152.

103. The method, kit or use of claim 103, wherein the TIGIT antagonist comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:

295.

104. The method of claims 99, 102, or 103, wherein the human patient is administered about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks.

105. The method of claim 104, wherein the human patient is administered about 200 mg pembrolizumab once every three weeks.

106. The method of claim 100, wherein the human patient is administered about 240 mg or about 3 mg / kg nivolumab once every two weeks, or about 480 mg nivolumab once every four weeks.

107. The method of claim 101, wherein the human patient is administered about 350 mg cemiplimab once every three weeks.

108. The method of any one of claims 99-103, wherein the human patient is administered from about 100 mg to about 500 mg of the TIGIT antagonist once every three weeks.

109. The method of claim 108, wherein the human patient is administered about 50, about 75, about 100, about 125, about 150, about 175, about 200, about 225, about 250, about 275, or about 300 mg of the TIGIT antagonist once every three weeks.

110. The method of claim 109, wherein the human patient is administered about 200 mg of the TIGIT antagonist once every three weeks.

111. The method of any one of claims 71-75 and 83-110, wherein the human patient is administered about 70 mg / m2to about 100 mg / m2paclitaxel once every week.

112. The method of claim 111, wherein the human patient is administered about 90 mg / m2paclitaxel once every week.

113. The method of claim 111, wherein the human patient is administered about 80 mg / m2paclitaxel once every week.

114. A method of treating TNBC, comprising administering to a human patient in need thereof a therapeutic combination comprising: (a) about 200 mg pembrolizumab; (b) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO: 110; and (c) about 80 mg / m2or 90 mg / m2paclitaxel represented by Formula (III).

115. The method of claim 114, wherein each of (a), and (b) is administered once every three weeks.

116. The method of claims 114-115, wherein (c) is administered once every week.

117. The method of claim 114-116, wherein (a) and (b) are administered on the same day, and wherein (a) and (b) are administered sequentially or concurrently.

118. The method of claim 114-117, wherein the TNBC is recurrent unresectable.

119. The method of claim 114-117, wherein the TNBC is metastatic.

120. The method of claim 114-116, wherein (a) and (b) are co-formulated.

121. The method of claim 114-116, wherein (a) and (b) are in a fixed dose combination.

122. A method of treating cancer, comprising administering to a human patient in need thereof a therapeutic combination comprising an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and ); by Formula (II)(II).

123. The method of claim 122, wherein the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, and triple negative breast cancer (TNBC).

124. The method of claim 123, wherein the cancer is biliary cancer.

125. The method of claim 124, wherein the biliary cancer is metastatic biliary cancer.

126. The method of claim 124, wherein the esophageal cancer is locally recurrent unresectable.

127. A kit comprising an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable saltthereof; and (d) cisplatin represented by Formula (II).

128. The kit of claim 127, further comprising instructions for administering to a human patient in need thereof the TIGIT antagonist, the PD-1 antagonist, gemcitabine, and cisplatin.

129. Use of a therapeutic combination of for treating cancer in a human patient in need thereof, wherein the therapeutic combination comprises an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) cisplatin represented by Formula (II).

130. The use of claim 129, wherein the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, and triple negative breast cancer (TNBC).

131. The use of claim 130, wherein the cancer is biliary cancer.

132. The use of claim 131, wherein the biliary cancer is metastatic biliary cancer.

133. The use of claim 131, wherein the biliary cancer is locally advanced unresectable.

134. The method, kit, or use of any one of claims 122-133, wherein the PD-1 antagonist and the TIGIT antagonist are formulated separately.

135. The method, kit, or use of any one of claims 122-133, wherein the PD-1 antagonist and the TIGIT antagonist are in a fixed dose combination.

136. The method, kit, or use of any one of claims 122-133, wherein the PD-1 antagonist and the TIGIT antagonist are co-formulated.

137. The method, kit, or use of any one of claims 122-136, wherein the PD-1 antagonist is an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof.

138. The method, kit, or use of any one of claims 122-136, wherein the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof.

139. The method, kit, or use of claim 137, wherein the anti-human PD-1 monoclonal antibody is a humanized antibody.

140. The method, kit, or use of claim 137, wherein the anti-human PD-1 monoclonal antibody is a human antibody.

141. The method, kit, or use of any one of claims 122-140, wherein the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof.

142. The method, kit, or use of claim 141, wherein the anti-human TIGIT monoclonal antibody is a humanized antibody.

143. The method, kit, or use of claim 141, wherein the anti-human TIGIT monoclonal antibody is a human antibody.

144. The method, kit, or use of claim 137, wherein the anti-human PD-1 monoclonal antibody is pembrolizumab.

145. The method, kit, or use of claim 137, wherein the anti-human PD-1 monoclonal antibody is nivolumab.

146. The method, kit, or use of claim 137, wherein the anti-human PD-1 monoclonal antibody is cemiplimab.

147. The method, kit, or use of claim 137, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavychain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

148. The method, kit, or use of claim 137, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:

152.

149. The method, kit, or use of claim 137, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:

295.

150. The method, kit, or use of any one of claims 122-143, wherein: (a) the PD-1 antagonist is pembrolizumab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

151. The method, kit, or use of any one of claims 122-143, wherein: (a) the PD-1 antagonist is nivolumab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO: 110.

152. The method, kit, or use of any one of claims 122-143, wherein: (a) the PD-1 antagonist is cemiplimab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

153. The method, kit or use of claims 150-152, wherein the TIGIT antagonist comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:

152.

154. The method, kit or use of claim 153, wherein the TIGIT antagonist comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:

295.

155. The method of claims 150, 153, or 154, wherein the human patient is administered about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks.

156. The method of claim 150, wherein the human patient is administered about 200 mg pembrolizumab once every three weeks.

157. The method of claim 151, wherein the human patient is administered about 240 mg or about 3 mg / kg nivolumab once every two weeks, or about 480 mg nivolumab once every four weeks.

158. The method of claim 152, wherein the human patient is administered about 350 mg cemiplimab once every three weeks.

159. The method of any one of claims 150-158, wherein the human patient is administeredfrom about 100 mg to about 500 mg of the TIGIT antagonist once every three weeks.

160. The method of claim 159, wherein the human patient is administered about 50, about 75, about 100, about 125, about 150, about 175, about 200, about 225, about 250, about 275, or about 300 mg of the TIGIT antagonist once every three weeks.

161. The method of claim 160, wherein the human patient is administered about 200 mg of the TIGIT antagonist once every three weeks.

162. The method of claims 150-158, wherein the human patient is administered from about 400 mg of the TIGIT antagonist once every six weeks.

163. The method of any one of claims 122-126 and 134-162, wherein the human patient is administered about 800 mg / m2to about 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks.

164. The method of claim 163, wherein the human patient is administered about 1000 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks.

165. The method of claim 163, wherein the human patient is administered about 800 mg / m2gemcitabine or a pharmaceutically acceptable salt thereof once every three weeks.

166. The method of claims 122-126 and 134-165, wherein the human patient is administered about 20 mg / m2to about 25 mg / m2cisplatin once every three weeks.

167. The method of claim 166, wherein the human patient is administered about 25 mg / m2cisplatin once every three weeks.

168. The method of claim 166, wherein the human patient is administered about 20 mg / m2cisplatin once every three weeks.

169. A method of treating biliary cancer, comprising administering to a human patient in need thereof a therapeutic combination comprising:(a) about 200 mg pembrolizumab; (b) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO: 110; (c) about 800 mg / m2or 1000 mg / m2gemcitabine represented by Formula (IV) or a pharmaceutically acceptable salt thereof; and (d) about 60 mg / m2or 80 mg / m2cisplatin represented by Formula (II).

170. The method of claim 169, wherein each of (a), (b), (c) and (d) is administered once every three weeks.

171. The method of claims 169-170, wherein (a) and (b) are administered on the same day, and wherein (a) and (b) are administered sequentially or concurrently.

172. The method of claim 171, wherein (a) and (b) are co-formulated.

173. The method of claim 171, wherein (a) and (b) are in a fixed dose combination.

174. The method of claims 169-173, wherein the biliary cancer is metastatic biliary cancer.

175. The method of claims 169-173, wherein the biliary cancer is locally recurrent unresectable.

176. A method of treating cancer, comprising administering to a human patient in need thereof a therapeutic combination comprising an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and); ula (VI)I).

177. The method of claim 176, wherein the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, triple negative breast cancer (TNBC), and gastric cancer.

178. The method of claim 177, wherein the cancer is gastric cancer.

179. The method of claim 178, wherein the gastric cancer is advanced or GEJ adenocarcinoma.

180. The method of claim 178, wherein the gastric cancer is HER2 negative.

181. The method of claim 178, wherein the gastric cancer is previously untreated.

182. A kit comprising an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI).

183. The kit of claim 183, further comprising instructions for administering to a humanpatient in need thereof the TIGIT antagonist, the PD-1 antagonist, capecitabine, and oxaliplatin.

184. Use of a therapeutic combination of for treating cancer in a human patient in need thereof, wherein the therapeutic combination comprises an effective amount of: (a) a TIGIT antagonist; (b) a PD-1 antagonist; (c) capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) oxaliplatin represented by Formula (VI).

185. The use of claim 184, wherein the cancer is selected from the group consisting of endometrial cancer, hepatocellular carcinoma (HCC), cervical cancer, head and neck cancer (HNSCC), biliary cancer, esophageal cancer, triple negative breast cancer (TNBC), and gastric cancer.

186. The use of claim 185, wherein the cancer is gastric cancer.

187. The use of claim 186, wherein the gastric cancer is advanced or GEJ adenocarcinoma.

188. The use of claim 186, wherein the gastric cancer is HER2 negative.

189. The use of claim 186, wherein the gastric cancer is previously untreated.

190. The method, kit, or use of any one of claims 176-189, wherein the PD-1 antagonist and the TIGIT antagonist are formulated separately.

191. The method, kit, or use of any one of claims 176-189, wherein the PD-1 antagonist and the TIGIT antagonist are in a fixed dose combination.

192. The method, kit, or use of any one of claims 176-189, wherein the PD-1 antagonist and the TIGIT antagonist are co-formulated.

193. The method, kit, or use of any one of claims 176-192, wherein the PD-1 antagonist isan anti-human PD-1 monoclonal antibody or antigen binding fragment thereof.

194. The method, kit, or use of any one of claims 176-192, wherein the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof.

195. The method, kit, or use of claim 193, wherein the anti-human PD-1 monoclonal antibody is a humanized antibody.

196. The method, kit, or use of claim 193, wherein the anti-human PD-1 monoclonal antibody is a human antibody.

197. The method, kit, or use of any one of claims 176-196, wherein the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof.

198. The method, kit, or use of claim 197, wherein the anti-human TIGIT monoclonal antibody is a humanized antibody.

199. The method, kit, or use of claim 197, wherein the anti-human TIGIT monoclonal antibody is a human antibody.

200. The method, kit, or use of claim 196, wherein the anti-human PD-1 monoclonal antibody is pembrolizumab.

201. The method, kit, or use of claim 196, wherein the anti-human PD-1 monoclonal antibody is nivolumab.

202. The method, kit, or use of claim 196, wherein the anti-human PD-1 monoclonal antibody is cemiplimab.

203. The method, kit, or use of claim 193, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO:108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

204. The method, kit, or use of claim 193, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:

152.

205. The method, kit, or use of claim 193, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:

295.

206. The method, kit, or use of any one of claims 176-192, wherein: (a) the PD-1 antagonist is pembrolizumab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

207. The method, kit, or use of any one of claims 176-192, wherein: (a) the PD-1 antagonist is nivolumab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

208. The method, kit, or use of any one of claims 176-192, wherein:(a) the PD-1 antagonist is cemiplimab; and (b) the TIGIT antagonist comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

209. The method, kit or use of claims 206-208, wherein the TIGIT antagonist comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:

152.

210. The method, kit or use of claim 209, wherein the TIGIT antagonist comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO:

295.

211. The method of claims 206, 209, or 210, wherein the human patient is administered about 200 mg, about 240 mg, or about 2 mg / kg pembrolizumab once every three weeks.

212. The method of claim 211, wherein the human patient is administered about 200 mg pembrolizumab once every three weeks.

213. The method of claim 207, wherein the human patient is administered about 240 mg or about 3 mg / kg nivolumab once every two weeks, or about 480 mg nivolumab once every four weeks.

214. The method of claim 208, wherein the human patient is administered about 350 mg cemiplimab once every three weeks.

215. The method of any one of claims 176-214, wherein the human patient is administered from about 100 mg to about 500 mg of the TIGIT antagonist once every three weeks.

216. The method of claim 215, wherein the human patient is administered about 50, about 75, about 100, about 125, about 150, about 175, about 200, about 225, about 250, about 275, or about 300 mg of the TIGIT antagonist once every three weeks.

217. The method of claim 216, wherein the human patient is administered about 200 mg of the TIGIT antagonist once every three weeks.

218. The method of claims 176-214, wherein the human patient is administered from about 400 mg of the TIGIT antagonist once every six weeks.

219. The method of any one of claims 176-181 and 190-218, wherein the human patient is administered about 500 mg / m2to about 1500 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day.

220. The method of claim 163, wherein the human patient is administered about 750 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day.

221. The method of claim 163, wherein the human patient is administered about 1000 mg / m2capecitabine or a pharmaceutically acceptable salt thereof twice a day.

222. The method of claims 176-181 and 190-221, wherein the human patient is administered about 80 mg / m2to about 150 mg / m2oxaliplatin once every three weeks.

223. The method of claim 166, wherein the human patient is administered about 100 mg / m2oxaliplatin once every three weeks.

224. The method of claim 166, wherein the human patient is administered about 130 mg / m2oxaliplatin once every three weeks.

225. A method of treating gastric cancer, comprising administering to a human patient in need thereof a therapeutic combination comprising an effective amount of : (a) about 200 mg pembrolizumab; (b) about 200 mg of an anti-TIGIT antibody or antigen binding fragment thereof comprising three light chain CDRs: CDRL1 comprising an amino acid sequence as setforth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO: 110; (c) about 750 mg / m2or 1000 mg / m2capecitabine represented by Formula (V) or a pharmaceutically acceptable salt thereof; and (d) about 100 mg / m2or 130 mg / m2oxaliplatin represented by Formula (VI).

226. The method of claim 226, wherein each of (a), (b) and (d) is administered once every three weeks and (c) is administered twice a day.

227. The method of claims 225-226, wherein (a) and (b) are administered on the same day, and wherein (a) and (b) are administered sequentially or concurrently.

228. The method of claim 227, wherein (a) and (b) are co-formulated.

229. The method of claim 227, wherein (a) and (b) are in a fixed dose combination.

230. The method of claims 225-229, wherein the gastric cancer is advanced or GEJ adenocarcinoma.

231. The method of claims 225-229, wherein the gastric cancer is HER2 negative.

232. The method of claims 225-229, wherein the gastric cancer is previously untreated.

233. A composition or kit comprising a PD-1 antagonist and / or TIGIT antagonist and a hyaluronan degrading enzyme.

234. The composition or kit of claim 233, comprising a PD-1 antagonist and a TIGIT antagonist, and further comprising 5-fluorouracil and cisplatin.

235. The composition or kit of claim 233, comprising a PD-1 antagonist and a TIGIT antagonist, and further comprising paclitaxel or a pharmaceutically acceptable saltthereof.

236. The composition or kit of claim 233, comprising a PD-1 antagonist and a TIGIT antagonist, and further comprising gemcitabine or a pharmaceutically acceptable salt thereof and cisplatin.

237. The composition or kit of claim 233, comprising a PD-1 antagonist and a TIGIT antagonist, and further comprising capecitabine or a pharmaceutically acceptable salt thereof and oxaliplatin.

238. A method comprising administering a PD-1 antagonist and / or a TIGIT antagonist and a hyaluronan degrading enzyme.

239. The method of claim 238, comprising administering a PD-1 antagonist and a TIGIT antagonist, and further comprising administering 5-fluorouracil and cisplatin.

240. The method of claim 238, comprising administering a PD-1 antagonist and a TIGIT antagonist, and further comprising administering paclitaxel or a pharmaceutically acceptable salt thereof.

241. The method of claim 238, comprising administering a PD-1 antagonist and a TIGIT antagonist, and further comprising administering gemcitabine or a pharmaceutically acceptable salt thereof and cisplatin.

242. The method of claim 238, comprising administering a PD-1 antagonist and a TIGIT antagonist, and further comprising administering capecitabine or a pharmaceutically acceptable salt there and oxaliplatin 243. The composition or kit of any one of claims 233-237 comprising a PD-1 antagonist and a TIGIT antagonist, or the method of any one of claims 238-242 comprising administering a PD-1 antagonist and a TIGIT antagonist; wherein the PD-1 antagonist and the TIGIT antagonist are formulated separately.

244. The composition or kit of any one of claims 233-237 comprising a PD-1 antagonist and a TIGIT antagonist, or the method of any one of claims 238-242 comprisingadministering a PD-1 antagonist and a TIGIT antagonist; wherein the PD-1 antagonist and the TIGIT antagonist are in a fixed dose combination.

245. The composition, or kit of any one of claims 233-237 comprising a PD-1 antagonist and a TIGIT antagonist, or the method of any one of claims 238-242 comprising administering a PD-1 antagonist and a TIGIT antagonist; wherein the PD-1 antagonist and the TIGIT antagonist are co-formulated.

246. The composition or kit of any one of claims 233-237 comprising a PD-1 antagonist and a TIGIT antagonist, or the method of any one of claims 238-245 comprising administering a PD-1 antagonist and a TIGIT antagonist; wherein the PD-1 antagonist is an anti-human PD-1 monoclonal antibody or antigen binding fragment thereof.

247. The composition or kit of any one of claims 233-237 comprising a PD-1 antagonist and a TIGIT antagonist, or the method of any one of claims 238-245 comprising administering a PD-1 antagonist and a TIGIT antagonist; wherein the PD-1 antagonist is an anti-human PD-L1 monoclonal antibody or antigen binding fragment thereof.

248. The composition, kit, or method of claim 246, wherein the anti-human PD-1 monoclonal antibody is a humanized antibody.

249. The composition, kit, or method of claim 246, wherein the anti-human PD-1 monoclonal antibody is a human antibody.

250. The composition or kit of any one of claims 233-237 comprising a PD-1 antagonist and a TIGIT antagonist, or the method of any one of claims 238-249 comprising administering a PD-1 antagonist and a TIGIT antagonist; wherein the TIGIT antagonist is an anti-human TIGIT monoclonal antibody or antigen binding fragment thereof.

251. The composition, kit, or method of claim 250, wherein the anti-human TIGIT monoclonal antibody is a humanized antibody.

252. The composition, kit, or method of claim 250, wherein the anti-human TIGIT monoclonal antibody is a human antibody.

253. The composition, kit, or method of claim 246, wherein the anti-human PD-1 monoclonal antibody is pembrolizumab.

254. The composition, kit, or method of claim 246, wherein the anti-human PD-1 monoclonal antibody is nivolumab.

255. The composition, kit, or method of claim 246, wherein the anti-human PD-1 monoclonal antibody is cemiplimab.

256. The composition, kit, or method of claim 250, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises three light chain CDRs: CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 111, CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 112, and CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 113, and three heavy chain CDRs: CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 108, CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 154, and CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO:

110.

257. The composition, kit, or method of claim 250, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 148 and a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:

152.

258. The composition, kit, or method of claim 250, wherein the anti-human TIGIT monoclonal antibody or antigen binding fragment thereof comprises a light chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 294 and a heavy chain comprising or consisting of an amino acid sequence as set forth in SEQ ID NO: 295.

Images