Anti-tgfbeta receptor 1 antibodies and uses thereof
Patent Information
- Application Number
- EP2023833774
- Authority / Receiving Office
- EP · EP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2022-12-19
- Filing Date
- 2023-12-18
- Publication Date
- 2025-10-29
AI Technical Summary
Current TGFβ inhibitors face challenges such as non-specificity, leading to adverse effects like chronic inflammation and precancerous conditions, due to their broad blockade of TGFβ signaling pathways, and struggle to target the specific cleavage of TGFβR1 in malignant cells without affecting normal cells.
Development of antibodies or antigen-binding fragments that specifically bind to the region comprising amino acid residues 126 to 133 of TGFβR1, inhibiting proteolytic cleavage and nuclear translocation of the intracellular domain, thereby reducing dysregulated TGFβ signaling in cancer cells.
The antibodies effectively inhibit proteolytic cleavage and nuclear translocation of TGFβR1's intracellular domain in cancer cells, reducing tumor invasion and migration, while minimizing effects on normal cells, thus offering a targeted approach to cancer therapy with reduced adverse effects.
Smart Images

Figure 1.1
Abstract
Description
[0001] Antibodies and uses thereof The present invention relates to antibodies or antigen-binding fragments thereof that specifically bind to the region comprising amino acid residues 126 to 133 of transforming growth factor beta receptor I (TGFβR1), and to pharmaceutical compositions, kits, methods, uses and medical uses comprising the same. Transforming growth factor β (TGFβ) is a multifunctional cytokine with potent regulatory effects on cell fate during embryogenesis, in the normal adult organism, and in cancer cells. In adult healthy cells TGFβ normally has a growth inhibiting function via binding to the transmembrane serine-kinase receptors TβRI and TβRII (serine / threonine kinase receptors). This activates an intracellular cascade of events that activate genes required for normal cell homeostasis [1]. However, dysregulated TGFβ signaling has been implicated in many pathological processes such as tumor progression and fibrosis. The inventors have previously found that in several common forms of cancer, this pathway is instead regulated by polyubiquitination of TβRI by the E3 ubiquitin ligase TRAF6 [4]. The activation of TRAF6 promotes the proteolytic cleavage of transmembrane TGFβ type I receptor (TβRI), liberating its intracellular domain (TβRI-ICD). Nuclear TβRI-ICD promotes invasion by cancer cells and is recognized as acting distinctly and differently from the canonical TGFβ-Smad signaling pathway occurring in normal cells. It is thought that proteolytic enzymes present in cancer cells cleave TβRI, thereby initiating the above-described mechanism. It has been reported that TNFα-converting enzyme (TACE) induces the cleavage of TβRI. TACE is also known as ADAM Metallopeptidase Domain 17 (ADAM17). TGFβ has during recent years become recognized as a potent regulator of cellular plasticity, which is a central event during embryogenesis and tumor progression, and therefore an interesting new target for drug development. Inhibitors targeting TGFβ have been considered by pharmaceutical companies for cancer therapy, and some of them are in clinical trial now. For example, antibodies that prevent a TGF-β ligand from binding to the receptors are currently being tested. GC1008 (fresolimumab) is one such antibody which neutralizes all three isoforms of TGFβ. However, this lack of specificity means it is necessary to develop isoform- specific antagonists since TGFβ isoforms express differently in distinct cancers. Because of the pleiotropic effects of TGFβ on both normal physiological function and tumorigenesis, long-term blockade of TGFβ and the relative signaling pathways may develop adverse effects. In animal studies, several TβRI inhibitors led to an increased incidence of haemorrhagic, degenerative, and inflammatory lesions in heart valves (Herbertz et al., Drug Des Devel Ther. 2015; 9: 4479–4499). Moreover, blocking TGFβ signaling can cause chronic inflammation of the skin and gut, which in turn can lead to precancerous conditions. In skin, TGFβ inhibits normal keratinocyte proliferation and enhances differentiation. Thus, the development of keratoacanthoma (KA) and squamous cell carcinoma (SCC) have been reported following treatment with several different TGFβ inhibitors including TβRI kinase inhibitors and fresolimumab, a TGFβ- neutralizing antibody. Accordingly, the present invention seeks to provide new agents for use in inhibiting dysregulated TGFβ-signalling. Interestingly, the cleavage of TβRI occurs only in malignant prostate cancer cells (PC-3U), but not in normal primary human prostate epithelial cells [4]. Nuclear accumulation of TβRI-ICD is observed in many types of cancer including prostate cancer, breast cancer, lung cancer and bladder cancer. Against this background, the inventors have developed antibodies that prevent nuclear translocation of TβRI-ICD. TGFβR1 comprises four portions, an N-terminal leader sequence that is cleaved upon secretion (1-33), a mature extracellular domain; amino acids (34-126), a transmembrane portion (amino acids 127-147) and an intracellular C-terminal portion (amino acids 148-503). Thus it is surprising that the inventors have been able to develop a functional antibody that binds a region comprising amino acids 126-133 of TβRI where 126 is preceding the transmembrane region and 127-133 is in the transmembrane region. Transmembrane regions of proteins are most often avoided in the selection of antigen due to the low accessibility for the antibodies to bind to this region of the target protein. As these regions are also hydrophobic and highly conserved it makes antibody generation through immunization more difficult due to tolerance. In a first aspect the invention provides an antibody or antigen-binding fragment thereof that specifically binds to transforming growth factor beta receptor I (TGFβR1), wherein the antibody or fragment binds to a region comprising amino acid residues 126 to 133 of TGFβR1. The term "antibody" herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, synthetic antibodies, polyclonal antibodies, monospecific and multispecific antibodies (e.g., bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, and antibody fragments so long as they exhibit the desired antigen-binding activity. The term "antibody," as used herein, also includes antigen-binding fragments of the above antibody molecules. The terms "antigen-binding portion" of an antibody, "antigen-binding fragment" of an antibody, and the like, as used herein, include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex. Antigen-binding fragments of an antibody may be derived, e.g., from full antibody molecules using any suitable standard techniques such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and optionally constant domains. Such DNA is known and / or is readily available from, e.g., commercial sources, DNA libraries (including, e.g., phage-antibody libraries), or can be synthesized. The DNA may be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more variable and / or constant domains into a suitable configuration, or to introduce codons, create cysteine residues, modify, add or delete amino acids, etc. Non-limiting examples of antigen-binding fragments include: Fab fragments; Fab′ (an antibody fragment containing a single anti-binding domain comprising a Fab and an additional portion of the heavy chain through the hinge region); F(ab′)2 (two Fab′ molecules joined by interchain disulfide bonds in the hinge regions of the heavy chains; the Fab′ molecules may be directed toward the same or different epitopes); a bispecific Fab (a Fab molecule having two antigen binding domains, each of which may be directed to a different epitope); a single chain Fab chain comprising a variable region, also known as a sFv; a disulfide-linked Fv, or dsFv; a camelized VH (the variable, antigen-binding determinative region of a single heavy chain of an antibody in which some amino acids at the VH interface are those found in the heavy chain of naturally occurring camel antibodies); minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated complementarity determining region (CDR) such as a CDR3 peptide), a bispecific sFv (a sFv or a dsFv molecule having two antigen-binding domains, each of which may be directed to a different epitope); a diabody (a dimerized sFv formed when the VH domain of a first sFv assembles with the VL domain of a second sFv and the VL domain of the first sFv assembles with the VH domain of the second sFv; the two antigen- binding regions of the diabody may be directed towards the same or different epitopes); and a triabody (a trimerized sFv, formed in a manner similar to a diabody, but in which three antigen-binding domains are created in a single complex; the three antigen binding domains may be directed towards the same or different epitopes), tetrabodies and minibodies. ScFvs are antibody fragments comprising the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain. Generally, a scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding. For a review of scFvs see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269- 315 (1994). Typical immunoglobulin molecules comprise four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as multimers thereof (e.g., IgM). Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region. The heavy chain constant region comprises four domains, CH1, Hinge, CH2 and CH3. Each light chain comprises a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region. The light chain constant region comprises one domain (CL1). The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The present invention also provides antibodies comprising variants of antibodies disclosed in the examples, wherein said antibodies specifically bind to TGFβR1. By “variant” we include antibodies or fragments that comprise one or more additions, deletions, or substitutions of amino acids when compared to a parent CDR, framework, VH and / or VL sequence, but exhibit biological activity that is essentially equivalent to that of the described antibody or fragment. Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding an antibody or fragment of the invention, including, for example, site-directed mutagenesis and PCR-mediated mutagenesis which results in amino acid substitutions. Preferably, the variants include less than 25 amino acid substitutions, less than 20 amino acid substitutions, less than 15 amino acid substitutions, less than 10 amino acid substitutions, less than 5 amino acid substitutions, less than 4 amino acid substitutions, less than 3 amino acid substitutions, or less than 2 amino acid substitutions relative to the original molecule. In another embodiment, the variants have conservative amino acid substitutions. The variants may have conservative amino acid substitutions that are made at one or more predicted non-essential amino acid residues. Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity. Following mutagenesis, the encoded protein can be expressed and the activity of the protein can be determined. Variants of the antibodies or fragments of the invention may be constructed by, for example, making one or more substitutions of residues or sequences or deleting terminal or internal residues or sequences not needed for biological activity. For example, cysteine residues not essential for biological activity can be deleted or replaced with other amino acids to prevent formation of unnecessary or incorrect intramolecular disulphide bridges upon renaturation. Variants and derivatives of antibodies include antibody fragments that retain the ability to specifically bind to the target. The antibodies provided herein can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass of immunoglobulin molecule. The antibodies of the invention may be from any animal origin including birds and mammals (e.g., human, murine, donkey, sheep, rabbit, goat, guinea pig, camel, horse, or chicken). In certain embodiments, the antibodies of the invention are human or humanized monoclonal antibodies. As used herein, “human” antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from mice that express antibodies from human genes. The antibodies and fragments of the invention include antibodies and fragments that are chemically modified, i.e., by the covalent attachment of any type of molecule to the antibody. For example, but not by way of limitation, the antibody derivatives include antibodies that have been chemically modified, e.g., by one or more of glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting / blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formulation, metabolic synthesis of tunicamycin, etc. Additionally, the antibody may contain one or more non-classical amino acids, such as β-amino acids and non- proteinogenic amino acids. By “transforming growth factor beta receptor I” we include the meaning of receptor I of transforming growth factor beta (TGFβ). The terms “transforming growth factor beta receptor I”, “TGFβ receptor 1” may be abbreviated as “TGFbRI”, “TGFβR1”, “TβRI” and “TβR1”. TGFbRI is also known as activin A receptor type II-like kinase (ALK5). Three types of cell surface proteins mediate TGF-β signaling: TGF-β receptor I (TβRI), II (TβRII) and III (TβRIII). TβRI and TβRII mediate signal transduction. Both receptors are transmembrane serine / threonine kinases, which associate in a homo- or heteromeric complex and act as tetramers. They are organized sequentially into an N- terminal extracellular ligand-binding domain, a transmembrane region, and a C- terminal serine / threonine kinase domain. The type II receptors range from 85 to 110 kDa, while the type I receptors are smaller and their size ranges around 55 to 56 kDa. A TGFβR1 described herein may be a human TGFβR1, for example one comprising the amino acid sequence of human TGFβR1 disclosed herein (SEQ ID NO: 1), or a naturally occurring variant thereof, and / or TGFβR1 orthologous found in other species, such as in horse, dog, pig, cow, sheep, rat, mouse, guinea pig or a primate. TGFβR1 comprises four portions, an N-terminal leader sequence that is cleaved upon secretion (1-33), a mature extracellular domain: amino acids (34-126), a transmembrane portion (amino acids 127-147) and an intracellular C-terminal portion (amino acids 148-503). Thus it is surprising that the inventors have been able to develop a functional antibody that binds a region comprising amino acids 126-133 of TβRI (SEQ ID NO: 1) wherein residue L126 is preceding the transmembrane region and residues 127-133 are in the transmembrane region (see Figure 7 in which the transmembrane region in shown in a box). Transmembrane regions of proteins are most often avoided in the selection of antigen due to the low accessibility for the antibodies to bind to this region of the target protein. As these regions are also hydrophobic and highly conserved it makes antibody generation through immunization more difficult due to tolerance. By “specifically binds to TGFβR1” we include the meaning of the selective recognition of the antibody or fragment for TGFβR1, which may be used to determine the presence of TGFβR1 in a heterogeneous population of molecules, such as biological molecules. For example, an antibody that specifically binds a target (which can be an epitope) is an antibody that binds that target with greater affinity, avidity, more readily, and / or with greater duration than it binds other, unrelated targets or molecules. We include that the antibodies or fragments will not substantially cross-react with another unrelated polypeptide. By "not substantially cross-react" we include that the antibody or fragment has a binding affinity for a non-homologous protein which is less than 10%, more preferably less than 5%, and even more preferably less than 1%, of the binding affinity for TGFβR1. The specificity of an antibody can be determined based on affinity measurements. Affinity (KD), expressed by the equilibrium constant for association and dissociation between antigen and antigen binding protein, is a measure of the strength of binding between the epitope and the antigen binding site on the antigen binding protein: a smaller KD value indicates that the binding strength between antigen binding molecules is stronger (alternatively, affinity can also be expressed as an affinity constant (KA), which is 1 / KD). As will be apparent to those skilled in the art, affinity can be determined by any method known in the art and described herein. Any KD value greater than 1x10-6M is generally considered to indicate non-specific binding. Preferably, the antibody or fragment binds TGFβR1 with at least 5, or at least 10 or at least 50 times higher affinity than for another, irrelevant receptor, such as epidermal growth factor receptor (EGFR). More preferably, the antibody binds TGFβR1 with at least 100, or at least 500, or at least 1,000, or at least 5,000, or at least 10,000 times higher affinity than for the other, irrelevant receptor, such as (EGFR). The term "higher affinity" refers to a binding affinity to TGFβR1, expressed as KD, in the low nanomolar range, i.e. of at least 1x10-7M; such as 1x10-8M, 1x10-9M; or 1x10-10M, as measured by techniques known in the art and described herein, such as Bio-layer interferometry (BLI), spectral shift technology (Nanotemper), surface plasmon resonance (SPR) or ELISA. By "surface plasmon resonance", we include the meaning of an optical phenomenon that allows for the analysis of real-time interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcore™ system (Biacore Life Sciences division of GE Healthcare, Piscataway, NJ) or kinetic exclusion assays. By “Bio-layer interferometry (BLI)” we include the meaning of an optical technique that measures macromolecular interactions by analyzing interference patterns of white light reflected from the surface of a biosensor tip. BLI can be carried out, for example, using a BLItz instrument (ForteBio)). In an embodiment, the antibody or fragment specifically binds to human TGFβR1, including naturally occurring variants thereof, and / or TGFβR1 orthologues found in other species, such as in horse, dog, pig, cow, sheep, rat, mouse, guinea pig or a primate. By “binds to a region comprising” we include that the antibody or antigen binding fragment binds a region of the antigen that contains the defined amino acids. The antibody or antigen binding fragment thereof may or may not bind all of the amino acid residues of that part of the sequence. However, the antibody or antigen binding fragment may also bind other amino acids in the antigen. For example, the antibody or antigen binding fragment thereof may bind amino acids upstream of the defined sequence. As shown in Fig. 1, the antibody or fragment binds to a region comprising amino acid residues 126 to 133 of TGFβR1, such as a region which corresponds to amino acid residues 126 to 133 of human TGFβR1 (SEQ ID NO: 1). In an embodiment, the antibody or fragment binds to a region comprising amino acid residues 126 to 133 of TGFβR1 of human TGFβR1 (SEQ ID NO: 1). Amino acid residues 126 to 133 of TGFβR1 of human TGFβR1 are LAAVIAGP (SEQ ID NO: 230). As shown in Fig. 8D, the following residues of human TGFβR1 (SEQ ID NO: 1) L126, V129, I130, G132 and P133 are involved in mAb#19 binding. In some embodiments, the antibody or fragment binds to a region consisting of amino acid residues 126 to 133 of TGFβR1 of human TGFβR1 (SEQ ID NO: 1). In some preferred embodiments, the antibody or fragment binds to a region comprising amino acid residues 118 to 133 of TGFβR1 of human TGFβR1 (SEQ ID NO: 1). As shown in Example 17, the antibody or fragment binds to a region comprising amino acid residues 118 to 133 of TGFβR1, such as a region which corresponds to amino acid residues 118 to 133 of human TGFβR1 (SEQ ID NO: 1). Amino acid residues 118 to 133 of TGFβR1 of human TGFβR1 are SPGLGPVELAAVIAGP (SEQ ID NO: 229). As shown in Example 17, the following residues of human TGFβR1 (SEQ ID NO: 1) P119, L121, G122, V129, I130, and G132 are involved in mAb#19 binding. In some embodiments, the antibody or fragment binds to a region comprising amino acid residues 71 to 82 of TGFβR1 of human TGFβR1 (SEQ ID NO: 1). As shown in Example 17, the antibody or fragment binds to a region comprising amino acid residues 71 to 82 of TGFβR1, such as a region which corresponds to amino acid residues 71 to 82 of human TGFβR1 (SEQ ID NO: 1). Amino acid residues 71 to 82 of TGFβR1 of human TGFβR1 are CIAEIDLIPRDR (SEQ ID NO: 228). As shown in Example 17, the following residues of human TGFβR1 (SEQ ID NO: 1) L77 and I78 are involved in mAb#19 binding. In some embodiments, the antibody or fragment binds to a region comprising amino acid residues 71 to 82 and 126 to 133 of TGFβR1 of human TGFβR1 (SEQ ID NO: 1). In some embodiments, the antibody or fragment binds to a region comprising amino acid residues 71 to 82 and 118 to 133 of TGFβR1 of human TGFβR1 (SEQ ID NO: 1). In an embodiment, the antibody or fragment binds to one or more of L77, I78, P119, L121, G122, V129, I130 and G132 of TGFβR1 (SEQ ID NO: 1). In an embodiment, the antibody or fragment binds to one or more of L126, V129, I130, G132 and P133 of TGFβR1 (SEQ ID NO: 1). In an embodiment, the epitope to which the antibody or fragment binds to comprises one or more of L77, I78, P119, L121, G122, V129, I130 and G132 of TGFβR1 (SEQ ID NO: 1). In an embodiment, the epitope to which the antibody or fragment binds to comprises one or more of L126, V129, I130, G132 and P133 of TGFβR1 (SEQ ID NO: 1). In an embodiment, the antibody or fragment binds to one or more of L77, I78, P119, L121, G122, L126, V129, I130, G132, and P133 of TGFβR1 (SEQ ID NO: 1). In an embodiment, the epitope to which the antibody or fragment binds to comprises one or more of L77, I78, P119, L121, G122, L126, V129, I130, G132, and P133 of TGFβR1 (SEQ ID NO: 1). In an embodiment, the antibody or antigen-binding fragment thereof reduces and / or inhibits proteolytic cleavage of TGFβR1. By “reduces and / or inhibits proteolytic cleavage of TGFβR1” we include the meaning that the antibody or fragment reduces the level of proteolytic cleavage of TGFβR1, as compared to the level of proteolytic cleavage of TGFβR1 in the absence of the antibody or fragment. In an embodiment, the antibody or fragment is one that reduces the level of proteolytic cleavage of TGFβR1 by at least 10%, 20%, 30%, 40% or 50% as compared to the level of proteolytic cleavage of TGFβR1 in the absence of the antibody or fragment, or reduces the level of proteolytic cleavage of TGFβR1 by at least 70%, 80%, 90%, 95% or 99% as compared to the level of proteolytic cleavage of TGFβR1 in the absence of the antibody or fragment. In an embodiment, the antibody or fragment is one that reduces the level of proteolytic cleavage of TGFβR1 to an undetectable level, or eliminates proteolytic cleavage of TGFβR1 as compared to the level of proteolytic cleavage of TGFβR1 in the absence of the antibody or fragment. Suitable methods for detecting and / or measuring (quantifying) proteolytic cleavage of TGFβR1 are well known to those skilled in the art. Examples of appropriate methods are disclosed herein and include observing reduced formation of cleaved TGFβR1; observing reduced formation of nuclear TERI-ICD as determined by, for example, immunohistochemistry, or immunoblotting. The reduction may be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%. By “proteolytic cleavage” we include the meaning of the enzymatic hydrolysis of a peptide bond in a peptide or protein substrate by a family of specialized enzymes termed proteases. The proteolytic cleavage of TGFβR1 may be mediated by one or more proteolytic enzymes selected from the group comprising: TACE, presenilin-1 (PS1), ADAM10, MMP2 and / or MMP9. In an embodiment, the proteolytic cleavage of TGFβR1 is mediated by TACE and / or presenilin-1 (PS1). PS1 either functions as gamma-secretase itself or as a required cofactor within the gamma-secretase protein complex. In an embodiment, the antibody or antigen-binding fragment thereof reduces and / or inhibits TACE-mediated proteolytic cleavage of TGFβR1. In an embodiment, the antibody or fragment blocks cleavage of TβRI by TACE between A127 / A128 and / or A128 / V129 (as numbered in SEQ ID NO: 1). As shown in the accompanying examples, the inventors surprisingly found that TACE cleaved TβRI in a region of amino acids found in the transmembrane region of TβRI (see Fig. 7, the transmembrane domain is indicated in a box). In an embodiment, the antibody or antigen-binding fragment thereof reduces and / or inhibits the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell. By “reduces and / or inhibits the translocation of the intracellular domain (ICD)” we include the meaning that the antibody or fragment reduces the level of the TGFβR1- ICD in the nucleus, as compared to the level of TGFβR1-ICD in the nucleus in the absence of the antibody or fragment. In an embodiment, the antibody or fragment is one that reduces the level of TGFβR1-ICD in the nucleus by at least 10%, 20%, 30%, 40% or 50% as compared to the level of TGFβR1-ICD in the nucleus in the absence of the antibody or fragment, or reduces the level of TGFβR1-ICD in the nucleus by at least 70%, 80%, 90%, 95% or 99% as compared to the level of TGFβR1-ICD in the nucleus in the absence of the antibody or fragment. In an embodiment, the antibody or fragment is one that reduces the level of TGFβR1-ICD in the nucleus to an undetectable level, or eliminates TGFβR1-ICD from the nucleus. In the nucleus, TβRI-ICD interacts with p300 and promotes tumor invasion indirectly or directly by inducing the transcription of target genes, such as SNAI1, MMP2, and TβRI. Accordingly, immunofluorescence and / or co-immunoprecipitation can be used to determine whether TβRI-ICD interacts with p300, and thus whether TβRI-ICD has translocated to the nucleus. As shown in the accompanying examples, an in situ PLA was performed to determine whether TβRI-ICD interacts with p300 using an anti-HA antibody and an anti-p300 antibody (R&D. Cat. AF3789). A negative control in situ PLA assay was performed using a human PC3U cell line (A9) in which the TGFβRI / ALK5 expression had been silenced by CRISPR-Cas9. In addition, it was shown that co- localisation of p300 and TβRI-ICD re-occurred when expression had been reconstituted by transfection with a plasmid encoding for TGFβRI (C-terminal HA-tagged). In an embodiment, the antibody or fragment reduces and / or inhibits the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell with an IC50 of 100 nM or less. In an embodiment, the antibody or fragment reduces and / or inhibits the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell with an IC50 of 100 nM or less, such as 90 nM, 80 nM, 70 nM 60 nM or less. In an embodiment, the antibody or fragment reduces and / or inhibits the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell with an IC50of 50 nM or less, such as 40 nM, 30 nM, 20 nM 10 nM or less. As shown in Example 6 and Figure 6, antibody 19 (mAb#19) prevents TGFβ-induced translocation of TβRI-ICD to the nucleus and exhibits an IC50of 39 nM. As shown in Example 15 and Figure 22A, the lead affinity matured antibody, F11, reduces and / or inhibits the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell with an IC50 of 26 nM. As shown in the accompanying Examples, the extent of translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell this was determined by measuring the interaction between TERI-ICD and p300 in a Proximity ligation assay (PLA). In an embodiment, the antibody or antigen-binding fragment thereof reduces and / or inhibits cell migration. In an embodiment, the antibody or antigen-binding fragment thereof designated F11 reduces and / or inhibits cell migration. As can be seen from the accompanying Examples the mAb F11 inhibited cell migration of human colorectal cancer cells). By “reduces and / or inhibits cell migration” we include the meaning that the ability of the cell to migrate within a tissue and / or organ and / or organism is reduced. Cell migration can be assessed by any known method know in the art, such as those described in Front. Cell Dev. Biol., 14 June 2019 Sec. Cell Adhesion and Migration Volume 7, including a wound healing assay as described in the accompanying Examples. This wound healing method is based on the observation that, upon creation of a new artificial gap, so called “scratch”, on a confluent cell monolayer, the cells on the edge of the newly created gap will move toward the opening to close the “scratch” until new cell–cell contacts are established again. The basic steps involve creation of a “scratch” on monolayer cells, capture of images at the beginning and regular intervals during cell migration to close the scratch, and comparison of the images to determine the rate of cell migration. In an embodiment, the antibody or antigen-binding fragment thereof reduces and / or inhibits cell migration by at least 50%, such as at least 60%, 70%, 80% or 90% compared to an isotype control antibody. In an embodiment, the antibody or antigen- binding fragment thereof reduces and / or inhibits cell migration by at least 80% such as 90% compared to an isotype control antibody. In an embodiment, the equilibrium dissociation constant (Kd) between the antibody or antigen-binding fragment thereof and TGFβR1 is less than or equal to 1 x 10-8(M). In some embodiments, the antibody or fragment has a dissociation constant (KD) of less than 1x10-7mol / liter (M), preferably less than 1x10-8, more preferably less than 1x10-9. In some embodiments, the antibody or fragment has a dissociation constant (KD) of less than 9x10-8, such as 8x10-8, 7x10-8, 6x10-8, 5x10-8, 4x10-8, 3x10-8, 2x10-8, such as 1x10-8. In some embodiments, the antibody or fragment has a dissociation constant (KD) of less than 9x10-9, such as 8x10-9, 7x10-9, 6x10-9, 5x10-9, 4x10-9, 3x10-9, 2x10-9, such as 1x10-9. Binding specificity can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Biophysical Biolayer interferometry (BLI), isothermal titration calorimetry (ITC), Western blots, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), electrochemiluminescence (ECL), immunoradiometric assay (IRMA), Enzyme immunoassay (EIA), and using surface plasmon resonance (SPR), such as by using BiacoreTM. In an embodiment, KD is determined by Biophysical Biolayer interferometry (BLI). In an embodiment, KD is determined by SPR. In an embodiment, the concentration of antibody that gives half-maximal binding (EC50) between the antibody or antigen-binding fragment thereof and TGFβR1 is less than or equal to 150 ng / ml. In some embodiments, the antibody or fragment has an EC50 of less than 150 ng / ml, such as less than 100 ng / ml, 90 ng / ml, 80 ng / ml, 70 ng / ml, 60 ng / ml, 50 ng / ml, 40 ng / ml, 30 ng / ml, 20 ng / ml, such as less than 20 ng / ml. In some embodiments, the antibody or fragment has an EC50 of less than 40 ng / ml, such as less than 39 ng / ml, 38 ng / ml, 37 ng / ml, 36 ng / ml, 35 ng / ml, 34 ng / ml, 33 ng / ml, 32 ng / ml, 31 ng / ml, such as less than 30 ng / ml. In some embodiments, the antibody or fragment has an EC50 of less than 30 ng / ml, such as less than 29 ng / ml, 28 ng / ml, 27 ng / ml, 26 ng / ml, 25 ng / ml, 24 ng / ml, 23 ng / ml, 22 ng / ml, 21 ng / ml, such as less than 20 ng / ml. In an embodiment, EC50is determined by ELISA. The affinity measurements and EC50 values of antibody 19 and its variants are shown in Table 1. The antibody affinity was measured using huECD 133 myc(His) and EC50 determination was performed on the positive antigen containing a human Fc tag. Antibody EC50 KD (M) [ng / ml] YU772-G12 21,27 8,7E-09 YU771-A01 21,97 1,1E-08 YU772-D10 22,48 7,8E-09 YU771-E01 23,09 8,9E-09 YU771-B12 24,4 1,6E-08 YU772-F11 24,91 7,6E-09 YU772-G04_VH-YU771-A09-VL 25,73 8,8E-09 YU772-H05 30,01 1,2E-08 YU772-D10_VH-YU772-C01_VL 30,29 7,3E-09 YU772-A11 31,45 7,9E-09 Antibody 19 139,2 2,2E-08 Table 1: Affinity measurements and EC50of lead antibodies. The antibody format did not influence the binding affinity of the parental antibody (antibody 19). The chimeric murine IgG1 mAb #19 demonstrated an equivalent affinity as the fully human IgG1 version carrying the silencing amino acid mutations of PavilizumAb. The EC50 value of the variants was decreased more than six times compared to the parental antibody, whereas the affinity was increased three times compared to the parental antibody, antibody 19. The present invention includes antibodies or fragments having FW and / or CDR amino acid sequences of the VH domain (SEQ ID NO: 4) and / or VL domain (SEQ ID NO: 12) of antibody 19 with, e.g., 20 or fewer 15 or fewer, 10 or fewer, 8 or fewer, 6 or fewer, 4 or fewer amino acid substitutions relative to any of the FW and / or CDR amino acid sequences disclosed herein. The present invention includes antibodies or fragments having the HCDR amino acid sequences of the VH domain of antibody 19 [SEQ ID NO: 4] with 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, 1 or fewer (i.e. zero), amino acid substitutions relative to any of the HCDR amino acid sequences disclosed herein. In an embodiment, the antibody or fragment comprises: a) a heavy chain complementarity determining region 1 (HCDR1) sequence of the VH domain of SEQ ID NO: 4, or a variant of the HCDR1 sequence comprising up to 2 amino acid substitutions; and / or b) a heavy chain complementarity determining region 2 (HCDR2) sequence of the VH domain of SEQ ID NO: 4, or a variant of the HCDR2 sequence comprising up to 3 amino acid substitutions; and / or c) a heavy chain complementarity determining region 3 (HCDR3) sequence of the VH domain of SEQ ID NO: 4, or a variant of the HCDR3 sequence comprising up to 5 amino acid substitutions. The inventors’ development of “antibody 19” allows the development of further advantageous antibodies or fragments by directed substitution of one or more CDR and / or framework (FW) regions or residues thereof. Antibody 19, also termed "mAb#19", consists of a fully human Variable region fused to the constant part of a human IgG1. Chimeric murine antibody 19, comprises a fully human variable region fused to the constant part of a murine IgG1. Antibodies or fragments that contain one or more mutations relative to the CDRs described herein can be easily tested for one or more desired property such as those described herein, for example, improved binding specificity, increased binding affinity, improved or enhanced biological properties, etc. Antibodies or fragments obtained in this general manner are encompassed within the present invention. Accordingly, a person of ordinary skill in the art, starting with the exemplary sequences disclosed herein, can produce numerous antibodies or fragments which share the same function as the exemplary antibodies or fragments, and which comprise one or more individual mutations or combinations thereof. Accordingly, the present invention encompasses antibodies or fragments having amino acid sequences that vary from those of the described antibodies or fragments, but that reduce and / or inhibit proteolytic cleavage of TGFβR1; and / or reduce and / or inhibit the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell to a similar extent to the exemplified antibodies or fragments. Methods and techniques for identifying CDRs within variable region amino acid sequences are well known in the art and can be used to identify CDRs within the specified antibodies or fragments amino acid sequences disclosed herein. Exemplary conventions that can be used to identify the boundaries of CDRs include, e.g., the Kabat definition, the Chothia definition, the IMGT definition, and the AbM definition. Generally, the Kabat definition is based on sequence variability, the Chothia definition is based on the location of the structural loop regions, and the AbM definition is a hybrid of the Kabat and Chothia approaches (Kabat, "Sequences of Proteins of Immunological Interest," National Institutes of Health, Bethesda, Md. (1991); Chothia C, Lesk a M. “Canonical structures for the hypervariable regions of immunoglobulins”. J Mol Biol. (1987) 196:901–17; Al-Lazikani et al., J. Mol. Biol. 273:927-948 (1997); and Martin et al., Proc. Natl. Acad. Sci. USA 86:9268-9272 (1989). Public databases are also available to the skilled person for identifying CDR sequences within an antibody. CDR sequences may be defined using any one of the AbM, IMGT, Chothia, and KABAT numbering schemes, or a combination of the numbering schemes. In an embodiment, the CDRs are defined using the IMGT numbering system. In an embodiment, the CDRs are defined using the Kabat numbering system. Preferably, the CDR sequences are defined using the Kabat numbering system. In an embodiment, the antibody or fragment comprises: i. a HCDR1 comprising the sequence of SEQ ID No: 6 or a variant thereof comprising up to 2 amino acid substitutions; and / or ii. a HCDR2 comprising the sequence of SEQ ID No: 8 or a variant thereof comprising up to 3 amino acid substitutions; and / or iii. a HCDR3 comprising the sequence of SEQ ID No: 10 or a variant thereof comprising up to 5 amino acid substitutions. In an embodiment, the antibody or fragment comprises: i. the HCDR1 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772- D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20; and / or ii. the HCDR2 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772- D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20; and / or iii. the HCDR3 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772- D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20. In yet another embodiment, the antibody or fragment includes at least one, two, or three complementarity determining regions (CDRs) (or collectively all of the CDRs) from a heavy chain variable region of an antibody described herein, e.g., an antibody selected from YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771- B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19. The present invention includes antibodies or fragments having the LCDR amino acid sequences of the VL domain of antibody 19 [SEQ ID NO: 12] with 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, 1 or fewer (i.e. zero), amino acid substitutions relative to any of the LCDR amino acid sequences disclosed herein. In an embodiment, the antibody or fragment comprises: a) a light chain complementarity determining region 1 (LCDR1) sequence of the VL domain of SEQ ID NO: 12, or a variant of the LCDR1 sequence comprising up to 3 amino acid substitutions; and / or b) a light chain complementarity determining region 2 (LCDR2) sequence of the VL domain of SEQ ID NO: 12, or a variant of the LCDR2 sequence comprising up to 3 amino acid substitutions; and / or c) a light chain complementarity determining region 3 (LCDR3) sequence of the VL domain of SEQ ID NO: 12, or a variant of the LCDR3 sequence comprising up to 1 amino acid substitution. In an embodiment, the antibody or fragment comprises: i. an LCDR1 comprising the sequence of SEQ ID No: 14 or a variant thereof comprising up to 3 amino acid substitutions; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 16 or a variant thereof comprising up to 3 amino acid substitutions; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 18 or a variant thereof comprising up to 1 amino acid substitution. Table 2 provides examples of amino acid substitutions within the CDR regions of both the VH domain (SEQ ID NO: 4) and VL domain (SEQ ID NO: 12) of antibody 19. Hence, in a preferred embodiment the variants of the CDR sequences mentioned herein comprise one or more amino acid substitutions at the positions described in Table 2. More preferably, the variants of the CDR sequences mentioned herein comprise one or more of the particular amino acid substitutions described in Table 2. For example, when the antibody or fragment comprises a variant of the HCDR1 comprising the sequence of SEQ ID No: 6, comprising up to 2 amino acid substitutions, it will be appreciated that the two amino acid substitutions may be at positions S31 and / or A33. It will be further appreciated that the 2 amino acid substitutions may be selected from any of S31P, S31T, S31K, S31A, A33P, and A33G. LCDR1 HCDR1 Q27 E, V S31 P, T, K, A S30 W, Y, L A33 P, G Y32 H, F HCDR2 LCDR2 G52A R A50 G S53 Y, P, A S53 T, W, F S56 T, L, Y S56 Y, T, W HCDR3 LCDR3 V96 A G91 A Y100 H, F G100A R, D, A, S G100B S S100C F, Y, A Table 2: The amino acid substitutions that may be present in the VH and VL domain CDRs. The numbering of the HCDR residues is relative to the numbering of the VH domain of antibody 19 (SEQ ID NO: 4), and the numbering of the LCDR residues is relative to the numbering of the VL domain of antibody 19 (SEQ ID NO: 12). The nomination of the position (lettering) in the first column is according to Kabat CDR determination. In an embodiment, the antibody or antigen-binding fragment thereof described herein comprises: i. the LCDR1 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771-B12, YU772-F11, YU772-G04- VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772- A11, and antibody 19 as indicated in Table 20; and / or ii. the LCDR2 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20; and / or iii. the LCDR3 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20. In yet another embodiment, the antibody or fragment includes at least one, two, or three complementarity determining regions (CDRs) (or collectively all of the CDRs) from a light chain variable region of an antibody described herein, e.g., an antibody selected from YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771- B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19. In yet another embodiment, the antibody or fragment includes at least one, two, three, four, five, or six CDRs according to Kabat numbering (e.g., at least one, two, three, four, five, or six CDRs according to the Kabat definition as set out in the sequence listing table) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from YU772-F11, or YU772- G12, or YU771-A01, or YU772-D10, or YU771-E01, or YU771-B12, or YU772-G04- VH / YU771-A09VL, or YU772-H05, or YU772-D10VH / YU772-C01VL, or YU772-A11, or antibody 19. In an embodiment, the antibody or fragment comprises an HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 of any of antibodies YU772-F11, or YU772- G12, or YU771-A01, or YU772-D10, or YU771-E01, or YU771-B12, or YU772-G04- VH / YU771-A09VL, or YU772-H05, or YU772-D10VH / YU772-C01VL, or YU772-A11, or antibody 19. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 6; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 8; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 10; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 14; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 16; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 18. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 126; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 128; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 130; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 134; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 136; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 138. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 26; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 28; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 30; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 34; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 36; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 38. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 46; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 48; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 50; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 54; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 56; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 58. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 66; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 68; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 70; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 74; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 76; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 78. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 86; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 88; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 90; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 94; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 96; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 98. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 106; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 108; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 110; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 114; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 116; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 118. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 146; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 148; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 150; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 154; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 156; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 158. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 166; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 168; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 170; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 174; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 176; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 178. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 186; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 188; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 190; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 194; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 196; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 198. In an embodiment, the antibody or antigen-binding fragment thereof comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 206; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 208; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 210; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 214; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 216; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 218. In an embodiment, the antibody or fragment comprises a heavy chain variable domain amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 4, or a heavy chain variable domain amino acid sequence that is at least 80% identical to SEQ ID NO: 4; and / or wherein the antibody or fragment comprises a light chain variable domain amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 12, or a light chain variable domain amino acid sequence that is at least 80% identical to SEQ ID NO: 12. In an embodiment, the antibody or fragment comprises a heavy chain variable (VH) domain amino acid sequence that is at least 80% identical to SEQ ID NO: 4, such as at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4. In an embodiment, the antibody or fragment comprises a heavy chain variable domain amino acid sequence that is at least 95% identical to SEQ ID NO: 4. In an embodiment, the antibody or fragment comprises a heavy chain variable domain amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 4. In an embodiment, the antibody or fragment comprises a light chain variable domain amino acid sequence that is at least 80% identical to SEQ ID NO: 12, such as at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 12. In an embodiment, the antibody or fragment comprises a light chain variable domain amino acid sequence that is at least 96% identical to SEQ ID NO: 12. In an embodiment, the antibody or fragment comprises a light chain variable domain amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 12. In an embodiment, the antibody or fragment comprises a heavy chain variable (VH) domain amino acid sequence that is at least 80% identical to SEQ ID NO: 124, such as at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 124. In an embodiment, the antibody or fragment comprises a heavy chain variable domain amino acid sequence that is at least 95% identical to SEQ ID NO: 124. In an embodiment, the antibody or fragment comprises a heavy chain variable (VH) domain amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 124. In an embodiment, the antibody or fragment comprises a light chain variable domain (VL) amino acid sequence that is at least 80% identical to SEQ ID NO: 132, such as at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 132. In an embodiment, the antibody or fragment comprises a light chain variable domain amino acid sequence that is at least 96% identical to SEQ ID NO: 132. In an embodiment, the antibody or fragment comprises a light chain variable domain amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 132. In an embodiment, the specified variation in sequence identity relative to a given SEQ ID NO of a VH or VL domain is outside of the CDR sequences. In an embodiment, the antibody or fragment comprises a heavy chain variable domain (VH) amino acid sequence of SEQ ID NO: 24; and / or a light chain variable domain (VL) amino acid sequence of SEQ ID NO: 32. In an embodiment, the antibody or fragment comprises a heavy chain variable domain (VH) amino acid sequence of SEQ ID NO: 44; and / or a light chain variable domain (VL) amino acid sequence of SEQ ID NO: 52. In an embodiment, the antibody or fragment comprises a heavy chain variable domain (VH) amino acid sequence of SEQ ID NO: 64; and / or a light chain variable domain (VL) amino acid sequence of SEQ ID NO: 72. In an embodiment, the antibody or fragment comprises a heavy chain variable domain (VH) amino acid sequence of SEQ ID NO: 84; and / or a light chain variable domain (VL) amino acid sequence of SEQ ID NO: 92. In an embodiment, the antibody or fragment comprises a heavy chain variable domain (VH) amino acid sequence of SEQ ID NO: 104; and / or a light chain variable domain (VL) amino acid sequence of SEQ ID NO: 112. In an embodiment, the antibody or fragment comprises a heavy chain variable domain (VH) amino acid sequence of SEQ ID NO: 144; and / or a light chain variable domain (VL) amino acid sequence of SEQ ID NO: 152. In an embodiment, the antibody or fragment comprises a heavy chain variable domain (VH) amino acid sequence of SEQ ID NO: 164; and / or a light chain variable domain (VL) amino acid sequence of SEQ ID NO: 172. In an embodiment, the antibody or fragment comprises a heavy chain variable domain (VH) amino acid sequence of SEQ ID NO: 184; and / or a light chain variable domain (VL) amino acid sequence of SEQ ID NO: 192. In an embodiment, the antibody or fragment comprises a heavy chain variable domain (VH) amino acid sequence of SEQ ID NO: 204; and / or a light chain variable domain (VL) amino acid sequence of SEQ ID NO: 212. "Percent (%) amino acid sequence identity" and "homology" with respect to a peptide, polypeptide or antibody sequence are defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or MEG ALIGN™ (DNASTAR) software. In an embodiment, the antibody or fragment has a heavy chain constant region chosen from, the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4, more particularly, the heavy chain constant region of IgG1 or IgG4 (e.g., human IgG1, IgG2 or IgG4). In an embodiment, the antibody has a heavy chain constant region that is IgG. In an embodiment, the antibody has a heavy chain constant region that is IgG1. In one embodiment, the heavy chain constant region is human IgG1. For example, the IgG1 heavy chain may have the sequence of (SEQ ID NO: 223). In some embodiments, the heavy chain constant region is a murine IgG1. For example, the IgG1 heavy chain may have the sequence of (SEQ ID NO: 225). In another embodiment, the antibody or fragment has a light chain constant region chosen from, e.g., the light chain constant regions of kappa or lambda. In an embodiment, the antibody or fragment has a kappa light chain constant region. In an embodiment, the antibody or fragment has a human kappa light chain constant region. For example, the light chain constant region may comprise or consist of the sequences of SEQ ID Nos. 224 or 226 as shown in Table 20. In one embodiment, the constant region is altered, e.g., mutated, to modify the properties of the antibody or fragment (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, complement function, half-life, aggregation and stability). In an embodiment, the antibody or fragment comprises a mutated human IgG1. In an embodiment, the antibody or fragment comprises a mutated murine IgG1. In an embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region which has reduced binding to the IgG Fc receptors FcγRI, FcγRII and / or FcγRIII as well as to complement component C1q. In an embodiment, the antibody or fragment has a heavy chain constant region which has increased binding to the neonatal Fc receptor (FcRn). In an embodiment, the antibody or antigen-binding fragment further comprises a LALA or LALA-PG mutation in its heavy chain constant region. One of the most widely used IgG1 variants is L234A / L235A (LALA) (J. Lund et al., J Immunol October 15, 1991, 147 (8) 2657-2662). These substitutions reduce binding to the IgG Fc receptors FcγRI, FcγRII and FcγRIII as well as to complement component C1q. Such antibodies are useful where binding and activation of Fc receptors is undesirable, for example when the product is being used as an antagonist of a cytokine or similar. More recently, L234A / L235A / P329G (LALAPG) was said to ‘completely abolish’ immune effector functions (T. Schlothauer et al., Protein Eng Des Sel. 2016 Oct;29(10):457-466. In an embodiment, the antibody or antigen-binding fragment further comprises the STR mutations L234S, L235T, G236R in the heavy chain constant region of IgG1, described in Wilkinson et al (2021), Fc-engineered antibodies with immune effector functions completely abolished. PLOS ONE 16 (12). In an embodiment, the mutations in the heavy chain constant region IgG1 are selected from: E233P, L234V, L235A, deletion of G236, D265G, A327Q, and A330S and deleted C-terminal Lysin. In an embodiment, the antibody or fragment comprises a heavy chain amino acid sequence of any of antibodies YU772-F11, or YU772-G12, or YU771-A01, or YU772- D10, or YU771-E01, or YU771-B12, or YU772-G04-VH / YU771-A09VL, or YU772-H05, or YU772-D10VH / YU772-C01VL, or YU772-A11, or antibody 19, as set out in Table 20; and / or a light chain amino acid sequence of any of antibodies YU772-F11, or YU772- G12, or YU771-A01, or YU772-D10, or YU771-E01, or YU771-B12, or YU772-G04- VH / YU771-A09VL, or YU772-H05, or YU772-D10VH / YU772-C01VL, or YU772-A11, or antibody 19, as set out in Table 20. In an embodiment, the antibody or antigen-binding fragment thereof has a heavy chain amino acid sequence of SEQ ID No: 20 and / or a light chain amino acid sequence of SEQ ID No 22. In an embodiment, the antibody or antigen-binding fragment thereof has a heavy chain amino acid sequence of SEQ ID No: 140 and / or a light chain amino acid sequence of SEQ ID No 142. In an embodiment, the antibody or antigen-binding fragment thereof further comprises a detectable moiety. By a “detectable moiety” we include the meaning that the moiety is one which, when located at the target site following administration of the antibody or fragment of the invention into a patient, may be detected, typically non-invasively from outside the body, and the site of the target located. Thus, the antibodies or fragments comprising detectable moieties may be useful in imaging and diagnosis, or in drug discovery. In an embodiment, the detectable moiety comprises a fluorophore, an enzyme, or a radioisotope. Thus, in an embodiment, the detectable moiety may be a radioactive atom which is useful in imaging. Suitable radioactive atoms include technetium-99m or iodine-123 for scintigraphic studies. Others may be selected from the group consisting of: iodine- 124; iodine-125; iodine-126; iodine-131; iodine-133; indium-111; indium-113m, fluorine-18; fluorine-19; carbon-11; carbon-13; copper-64; nitrogen-13; nitrogen-15; oxygen-15; oxygen-17; arsenic-72; gadolinium; manganese; iron; deuterium; tritium; yttrium-86; zirconium-89; bromine-77, gallium-67; gallium-68, ruthenium-95, ruthenium-97, ruthenium-103, ruthenium-105, mercury-107, rhenium-99m, rhenium- 101, rhenium-105, scandium-47. Suitable methods for coupling such radioisotopes to the antibodies – either directly or via a chelating agent such as EDTA or DTPA –can be employed, as is known in the art. Other readily detectable moieties include, for example, spin labels for magnetic resonance imaging (MRI) such as iodine-123 again, iodine-131, indium-111, fluorine- 19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron. Clearly, the antibody or fragment of the invention must have sufficient of the appropriate atomic isotopes in order for the molecule to be detectable. The radio- or other label may be incorporated in the compound in known ways. For example, if the antibody may be biosynthesised or synthesised by chemical amino acid synthesis using suitable amino acid precursors involving, for example, fluorine-19 in place of hydrogen. Labels such as99mTc,123I,186Rh,188Rh and111In can, for example, be attached via cysteine residues in the antibody. Yttrium-90 can be attached via a lysine residue. The IODOGEN method (Fraker et al (1978) Biochem. Biophys. Res. Comm. 80, 49-57) can be used to incorporate iodine-123. The reference (“Monoclonal Antibodies in Immunoscintigraphy”, J.F. Chatal, CRC Press, 1989) describes other methods in detail. Many suitable fluorophores and detection methods are well known in the art and are described, for example by Stefan Andersson-Engels et al (1997) “In vivo fluorescence imaging for tissue diagnostics. Phys. Med. Biol. 42: 815-824; Altınoǧlu et al (2008) “Near-Infrared Emitting Fluorophore-Doped Calcium Phosphate Nanoparticles for In Vivo Imaging of Human Breast Cancer” ACS Nano 2(10): 2075-84; and Chin et al (2009) “In-vivo optical detection of cancer using chlorin e6 – polyvinylpyrrolidone induced fluorescence imaging and spectroscopy” BMC Medical Imaging 9:1 (doi:10.1186 / 1471-2342-9-1). Examples include fluorescein and its derivatives, fluorochrome, rhodamine and its derivatives, Green Fluorescent Protein (GFP), dansyl, umbelliferone etc. In such conjugates, the antibodies of the invention or their functional fragments can be prepared by methods known to the person skilled in the art. The detectable moiety may comprise a detectable enzyme such as peroxidase, alkaline phosphatase, beta-D-galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase or glucose 6- phosphate dehydrogenase. The detectable moiety may comprise a molecule such as biotin, digoxygenin or 5- bromodeoxyuridine. The detectable moiety may comprise a chemiluminescent label such as luminol and the dioxetanes, or a bioluminescent label such as luciferase and luciferin. In an embodiment, the antibody or antigen-binding fragment is conjugated to a therapeutic moiety, such as a cytotoxin, a chemotherapeutic drug, an immunosuppressant or a radioisotope. Such conjugates may be referred to as "immunoconjugates" or “antibody drug conjugates”. Typically, the cytotoxic moiety is selected from a directly cytotoxic chemotherapeutic agent, a directly cytotoxic polypeptide, a moiety which is able to convert a prodrug into a cytotoxic drug, a radiosensitizer, a directly cytotoxic nucleic acid, a nucleic acid molecule that encodes a directly or indirectly cytotoxic polypeptide or a radioactive atom. Examples of such cytotoxic moieties, as well as methods of making the conjugates comprising the antibody and the cytotoxic moiety, are provided in our earlier publications WO 02 / 36771, WO 2004 / 046191, and WO 2011 / 027132 incorporated herein by reference. A cytotoxin or cytotoxic agent includes any agent that is detrimental to (e.g., kills) cells. Examples include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof. In one embodiment the cytotoxic moiety is a cytotoxic chemotherapeutic agent. Suitable chemotherapeutic agents for forming immunoconjugates are known in the art and include, but are not limited to, anti-metabolites (e.g., methotrexate, 6- mercaptopurine, 6-thioguanine, cytarabine, fludarabin, 5-fluorouracil, decarbazine, hydroxyurea, azathiprin, gemcitabin and cladribin), alkylating agents (e.g., mechlorethamine, thioepa, chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincristine, vinblastine, docetaxel, paclitaxel and vinorelbin). Antibody-drug conjugates, such as for cancer therapy are reviewed by Carter & Senter (2008), Cancer J. 14(3): 154-69, and Chari et al (2014) Angewandte Chemie International Edition 53: 3751, incorporated herein by reference, and it will be appreciated that the compounds of this aspect of the invention may considered such antibody drug conjugates (see also US 5,773,001; US 5,767,285; US 5,739,116; US 5,693,762; US 5,585,089; US 2006 / 0088522; US 2011 / 0008840; US 7,659,241; Hughes (2010) Nat Drug Discov 9: 665, Lash (2010); In vivo: The Business & Medicine Report 32-38; Mahato et al (2011) Adv Drug Deliv Rev 63: 659; Jeffrey et al (2006) BMCL 16: 358; Drugs R D 11(1): 85-95). ADCs generally comprise a monoclonal antibody against a target present on a tumour cell, a cytotoxic drug, and a linker that attaches the antibody to the drug. Various of the cytotoxic moieties mentioned above, such as cytotoxic chemotherapeutic agents, have previously been attached to antibodies and other targeting agents, and so compounds of the invention comprising these agents may readily be made by the person skilled in the art. For example, carbodiimide conjugation (Bauminger & Wilchek (1980) Methods Enzymol. 70, 151-159) may be used to conjugate a variety of agents, including doxorubicin, to antibodies. Other methods for conjugating a cytotoxic moiety to an antibody can also be used. For example, sodium periodate oxidation followed by reductive alkylation of appropriate reactants can be used, as can glutaraldehyde cross- linking. Methods of cross-linking polypeptides are known in the art and described in WO 2004 / 046191. However, it is recognised that, regardless of which method of producing a compound of the invention is selected, a determination must be made that the antibody maintains its targeting ability and that the attached moiety maintains its relevant function. In a further embodiment of the invention, the cytotoxic moiety may be a cytotoxic peptide or polypeptide moiety by which we include any moiety which leads to cell death. Cytotoxic peptide and polypeptide moieties are well known in the art and include, for example, ricin, abrin, Pseudomonas exotoxin, tissue factor and the like. Methods for linking them to targeting moieties such as antibodies are also known in the art, and include, for example, conventional ways of crosslinking polypeptides and production of the compound as a fusion polypeptide using recombinant DNA techniques. The use of ricin as a cytotoxic agent is described in Burrows & Thorpe (1993) Proc. Natl. Acad. Sci. USA 90, 8996-9000, and the use of tissue factor, which leads to localised blood clotting and infarction of a tumour, has been described by Ran et al (1998) Cancer Res. 58, 4646-4653 and Huang et al (1997) Science 275, 547- 550. Tsai et al (1995) Dis. Colon Rectum 38, 1067-1074 describes the abrin A chain conjugated to a monoclonal antibody. Other ribosome inactivating proteins are described as cytotoxic agents in WO 96 / 06641. Pseudomonas exotoxin may also be used as the cytotoxic polypeptide moiety (Aiello et al (1995) Proc. Natl. Acad. Sci. USA 92, 10457-10461). Certain cytokines, such as TNFα, INFγ and IL-2, may also be useful as cytotoxic agents. Certain radioactive atoms may also be cytotoxic if delivered in sufficient doses. Thus, the cytotoxic moiety may comprise a radioactive atom which, in use, delivers a sufficient quantity of radioactivity to the target site so as to be cytotoxic. Suitable radioactive atoms include phosphorus-32, iodine-125, iodine-131, indium-111, rhenium-186, rhenium-188 or yttrium-90, or any other isotope which emits enough energy to destroy neighbouring cells, organelles or nucleic acid. Preferably, the isotopes and density of radioactive atoms in the compound of the invention are such that a dose of more than 4000 cGy (preferably at least 6000, 8000 or 10000 cGy) is delivered to the target site and, preferably, to the cells at the target site. The radioactive atom may be attached to the antibody in known ways. For example EDTA or another chelating agent may be attached to the antibody and used to attach111In or90Y. Tyrosine residues may be labelled with125I or131I. The cytotoxic moiety may be a radiosensitizer. Radiosensitizers include fluoropyrimidines, thymidine analogues, hydroxyurea, gemcitabine, fludarabine, nicotinamide, halogenated pyrimidines, 3-aminobenzamide, 3-aminobenzodiamide, etanixadole, pimonidazole and misonidazole (see, for example, McGinn et al (1996) J. Natl. Cancer Inst. 88, 1193-11203; Shewach & Lawrence (1996) Invest. New Drugs 14, 257-263; Horsman (1995) Acta Oncol. 34, 571-587; Shenoy & Singh (1992) Clin. Invest. 10, 533-551; Mitchell et al (1989) Int. J. Radiat. Biol. 56, 827-836; Iliakis & Kurtzman (1989) Int. J. Radiat. Oncol. Biol. Phys. 16, 1235-1241; Brown (1989) Int. J. Radiat. Oncol. Biol. Phys. 16, 987-993; Brown (1985) Cancer 55, 2222-2228). The cytotoxic moiety may be a procoagulant factor, such as the extracellular domain of tissue factor (Rippmann et al (2000) “Fusion of the tissue factor extracellular domain to a tumour stroma specific single-chain fragment variable antibody results in an antigen-specific coagulation-promoting molecule.” Biochem J. 349: 805-12; Huang et al (1997) “Tumor infarction in mice by antibody-directed targeting of tissue factor to tumor vasculature.” Science. 275(5299): 547–550. The cytotoxic moiety may be an indirectly cytotoxic polypeptide. In a particularly preferred embodiment, the indirectly cytotoxic polypeptide is a polypeptide which has enzymatic activity and can convert a relatively non-toxic prodrug into a cytotoxic drug. When the targeting moiety is an antibody, this type of system is often referred to as ADEPT (Antibody-Directed Enzyme Prodrug Therapy). The system requires that the targeting moiety locates the enzymatic portion to the desired site in the body of the patient (e.g. the site of new vascular tissue associated with a tumour) and after allowing time for the enzyme to localise at the site, administering a prodrug which is a substrate for the enzyme, the end product of the catalysis being a cytotoxic compound. The object of the approach is to maximise the concentration of drug at the desired site and to minimise the concentration of drug in normal tissues (Senter et al (1988) “Anti- tumor effects of antibody-alkaline phosphatase conjugates in combination with etoposide phosphate” Proc. Natl. Acad. Sci. USA 85, 4842-4846; Bagshawe (1987) Br. J. Cancer 56, 531-2; and Bagshawe, et al (1988) “A cytotoxic agent can be generated selectively at cancersites” Br. J. Cancer. 58, 700-703); Bagshawe (1995) Drug Dev. Res. 34, 220-230 and WO 2004 / 046191, describe various enzyme / prodrug combinations which may be suitable in the context of this invention. Typically, the prodrug is relatively non-toxic compared to the cytotoxic drug. Typically, it has less than 10% of the toxicity, preferably less than 1% of the toxicity as measured in a suitable in vitro cytotoxicity test. It is likely that the moiety which is able to convert a prodrug to a cytotoxic drug will be active in isolation from the rest of the compound but it is necessary only for it to be active when (a) it is in combination with the rest of the compound and (b) the compound is attached to, adjacent to or internalised in target cells. The cytotoxic moiety may be one which becomes cytotoxic, or releases a cytotoxic moiety, upon irradiation. For example, the boron-10 isotope, when appropriately irradiated, releases D particles which are cytotoxic (US 4,348,376; Primus et al (1996) Bioconjug. Chem. 7: 532-535). Similarly, the cytotoxic moiety may be one which is useful in photodynamic therapy such as photofrin (see, for example, Dougherty et al (1998) J. Natl. Cancer Inst. 90, 889-905). In a particular embodiment, the cytotoxic moiety is an antibody, such as one that specifically binds to an immune cell, such as a cytotoxic immune cell (eg T cell). Thus, in this case, the compound of the invention may be an asymmetric IgG-like antibody (eg triomab / quadroma, Trion Pharma / Fresenius Biotech; knobs-into-holes, Genentech; Cross MAbs, Roche; electrostatically matched antibodies, AMGEN; LUZ-Y, Genentech; strand exchange engineered domain (SEED) body, EMD Serono; biolonic, erus; and Fab-exchanged antibodies, Genmab), symmetric IgG-like antibodies (eg dual targeting (DT)-lg, GSK / Domantis; two-in-one antibody, Genentech; crosslinked MAbs, karmanos cancer center; mAb <2>, F-star; and Cov X-body, Cov X / Pfizer), IgG fusions (eg dual variable domain (DVD)-lg, Abbott; IgG-like bispecific antibodies, Eli Lilly; Ts2Ab, Medimmune / AZ; BsAb, ZymoGenetics; HERCULES, Biogen Idee; TvAb, Roche) Fc fusions (eg ScFv / Fc fusions, Academic Institution; SCORPION, Emergent BioSolutions / Trubion, ZymoGenetics / BMS; dual affinity retargeting technology (Fc- DART), MacroGenics; dual (ScFv) 2-Fab, National Research Center for Antibody Medicine) Fab fusions (eg F(ab) 2, Medarex / AMGEN; dual-action or Bis-Fab, Genentech; Dock-and-Lock (DNL), ImmunoMedics; bivalent bispecific, Biotechnol; and Fab-Fv, UCB-Celltech), ScFv- and diabody-based antibodies (eg bispecific T cell engagers (BiTEs), Micromet; tandem diabodies (Tandab), Affimed; DARTs, MacroGenics; Single-chain diabody, Academic; TCR-like antibodies, AIT, Receptor Logics; human serum albumin ScFv fusion, Merrimack; and COMBODIES, Epigen Biotech), IgG / non-lgG fusions (eg immunocytokins, EMDSerono, Philogen, ImmunGene, ImmunoMedics; superantigen fusion protein, Active Biotech; and immune mobilising mTCR Against Cancer, ImmTAC) and oligoclonal antibodies (eg Symphogen and Merus). In another embodiment, the cytotoxic moiety is a pyrrolobenzodiazepine dimer (PBD). PBDs are potent anticancer agents which have been shown to have broad spectrum anti-tumour activity in vivo. These drugs exert their activity by binding the minor groove of DNA and linking the two DNA strands together in a way that cells find difficult to recognise and repair. Thus the compound of the invention may be an ADC comprising a PBD. Further information on PBDs can be found in Hartley et al, 2012 (Invest New Drugs 30: 950-958). In an aspect, the invention provides an antibody or antigen-binding fragment thereof, optionally as defined in any of the embodiments herein, that specifically binds to transforming growth factor beta receptor I (TGFβR1), wherein the antibody or fragment binds to the region comprising amino acid residues 126 to 133 of TGFβR1, and wherein the antibody or fragment competes for binding to said region of TGFβR1 with any of the antibodies defined in any of the embodiments described herein. Competition between antibodies may be assayed in vitro, for example using ELISA, FACS and / or by tagging a specific reporter molecule to one antibody which can be detected in the presence of other untagged antibody, to enable identification of specific binding members which bind the same epitope or an overlapping epitope. Cross- competition between binding members may be readily assayed by running the reverse assay, e.g., by reversing the tagged and the untagged binding members to identify pairs that block binding in both directions. Competition may be determined by surface plasmon resonance (SPR), such techniques being readily apparent to the skilled person. SPR can be carried out using Biacore™, Proteon™ or another standard SPR technique. Such competition may be due, for example, to the antibodies / fragments binding to identical or overlapping epitopes of TGFβR1. In an aspect, the invention provides a pharmaceutical composition comprising an antibody or antigen-binding fragment thereof as defined in any of the embodiments herein, and a pharmaceutically acceptable carrier, excipient or diluent. As will be appreciated by the skilled artisan, the route and / or mode of administration will vary depending upon the desired results. The pharmaceutical composition is preferably administered parenterally. By "parenteral administration" and "administered parenterally" we include the meaning of modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intra-peritoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection, inhalation and infusion. In one embodiment the pharmaceutical composition is administered by intravenous or subcutaneous injection or infusion, or by inhalation. Regardless of the route of administration selected, the antibodies and fragments of the present invention, which may be used in the form of a pharmaceutically acceptable salt or in a suitable hydrated form, and / or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art. By "pharmaceutically acceptable carrier" we include the meaning of any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonicity agents, antioxidants and absorption delaying agents, and the like that are physiologically compatible. Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the invention is contemplated. Preferably, the carrier is suitable for parenteral administration, e.g. intravenous or subcutaneous injection or infusion. Pharmaceutical compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration. Examples of suitable aqueous and nonaqueous carriers which may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants. The pharmaceutical compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonicity agents, such as sugars, polyalcohols such as mannitol, sorbitol, glycerol or sodium chloride in the compositions. Pharmaceutically-acceptable antioxidants may also be included, for example (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like. Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin. Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients e.g. as enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients e.g. from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. If appropriate, the antibody may be used in a suitable hydrated form or in the form of a pharmaceutically acceptable salt. By "pharmaceutically acceptable salt" we include the meaning of a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S.M., et al. (1977) J. Pharm. Sci. 66: 1-19). Examples of such salts include acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N'-dibenzylethylenediamine, N-methyl- glucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like. Depending on the route of administration, the active compound, i.e., antibody, may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound. For example, the compound may be administered to a subject in an appropriate carrier, for example, liposomes. Liposomes include water- in-oil-in-water CGF emulsions as well as conventional liposomes (Strejan et al. (1984) J. Neuroimmunol. 7: 27). The active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for the preparation of such formulations are generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York, 1978. The pharmaceutical compositions can be administered with medical devices known in the art. For example, a therapeutic composition of the invention can be administered with a needleless hypodermic injection device, such as the devices disclosed in US 5,399,163; US 5,383,851; US 5,312,335; US 5,064,413; US 4,941,880; US 4,790,824; or US 4,596,556. Examples of well-known implants and modules useful in the present invention include: US 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; US 4,486,194, which discloses a therapeutic device for administering medicants through the skin; US 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; US 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; US 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and US 4,475,196, which discloses an osmotic drug delivery system. Many other such implants, delivery systems, and modules are known to those skilled in the art. In certain embodiments, the human monoclonal antibodies of the invention can be formulated to ensure proper distribution in vivo. For example, the blood-brain barrier (BBB) excludes many highly hydrophilic compounds. To ensure that the therapeutic compounds of the invention cross the BBB (if desired), they can be formulated, for example, in liposomes. For methods of manufacturing liposomes, see, e.g., US 4,522,811; US 5,374,548; and US 5,399,331. The liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V.V. Ranade (1989) J. Clin. Pharmacol. In an aspect, the invention provides a method of formulating the antibody or antigen- binding fragment thereof into a pharmaceutical composition comprising mixing the antibody or antigen-binding fragment thereof as defined in any of the embodiments herein, with a pharmaceutically acceptable carrier, excipient or diluent. The pharmaceutical compositions may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in Remington: The Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, PA, 1995. In an aspect, the invention provides an antibody or antigen-binding fragment thereof as defined in any of the embodiments herein, or a pharmaceutical composition as defined in any of the embodiments herein, for use in medicine. The present antibodies or antigen-binding fragments thereof may be for use in a method of treatment or diagnosis of the human or animal body, such as a method of treatment (which may include prophylactic treatment) of a disease or disorder in a human or animal patient, which comprises administering an effective amount to the patient. Administration for therapy is preferably in a "therapeutically effective amount" sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom of a particular disease or condition. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of the disease or condition being treated. The precise dose will depend upon a number of factors, including whether the antibody or antigen-binding fragment thereof is for diagnosis or for treatment, the size and location of the area to be treated, the precise nature of the antibody or antigen-binding fragment thereof, e.g., whole antibody, Fab, or scFv fragment, and the nature of any detectable label or other molecule attached to the antibody or antigen-binding fragment thereof. A typical dose of a whole antibody, for example, can be in the range 100 μg to 1 g / kg body weight for systemic applications. The term "subject" or "patient" refers to any animal, including, but not limited to, mammals. As used herein, the term "mammal" refers to any vertebrate animal that suckle their young and either give birth to living young (eutharian or placental mammals) or are egg-laying (metatharian or nonplacental mammals). Examples of mammalian species include, but are not limited to, humans and other primates, including non-human primates such as chimpanzees and other apes and monkey species; farm animals such as cattle, sheep, pigs, goats and horses; domestic mammals such as dogs and cats; laboratory animals including rodents such as mice, rats (including cotton rats) and guinea pigs; birds, including domestic, wild and game birds such as chickens, turkeys and other gallinaceous birds, ducks, geese, and the like. Preferably, the subject is a human. In an aspect, the invention provides an antibody or antigen-binding fragment thereof as defined in any of the embodiments herein, or a pharmaceutical composition as defined in any of the embodiments herein, for use in treating and / or preventing a disease or disorder mediated by the proteolytic cleavage of TGFβR1. The antibodies or fragments of the invention can reduce and / or inhibit proteolytic cleavage of TGFβR1 as indicated above. Thus, such antibodies or fragments can be used to treat and / or prevent diseases or conditions wherein the reduction and / or inhibition of proteolytic cleavage of TGFβR1 in a subject is desired. Treatable diseases or conditions include any in which proteolytic cleavage of TGFβR1 plays a role, e.g., fibrotic disease, cancer, an immune-mediated disease, and wound healing (such as keloid). The present antibodies or antigen-binding fragments thereof are useful to treat and / or prevent a disease and condition resulting directly or indirectly from proteolytic cleavage of TGFβR1. The terms “treat”, “treatment” and “treating” refer to the reduction or amelioration of the progression, severity, and / or duration of a disease or disorder mediated by the proteolytic cleavage of TGFβR1 (e.g. cancer) resulting from the administration of one or more therapies (including, but not limited to, the administration of one or more prophylactic or therapeutic agents, such as an antibody of the invention) to a subject. In the context of cancer therapy, "treatment" includes any medical intervention resulting in the slowing of tumor growth or reduction in tumor metastases, as well as partial remission of the cancer in order to prolong life expectancy of a patient. In an embodiment, the proteolytic cleavage of TGFβR1 is in a region comprising amino acid residues 126 to 133 of TGFβR1, such as a region which corresponds to amino acid residues 126 to 133 of human TGFβR1 (SEQ ID NO: 1), as described above. In an aspect, the invention provides a method of treating and / or preventing a disease or disorder mediated by the proteolytic cleavage of TGFβR1 in a subject, the method comprising administering an antibody or antigen-binding fragment thereof as defined in any of the embodiments herein, or a pharmaceutical composition as defined in any of the embodiments herein to the subject. The skilled person could determine whether a cancer was mediated by the cleavage of TGFβR1 by demonstrating the presence of nuclear TERI-ICD by immunohistochemistry performed on a sample to be tested, in situ PLA performed on a sample to be tested, or by detecting cleaved TERI-ICD by immunoblotting performed on a sample to be tested, such as from a cancer. Methods of treatment comprise administering an antibody or antigen-binding fragment thereof, or pharmaceutical composition comprising the antibody or antigen-binding fragment thereof to a subject. The dose for a single treatment of an adult patient may be adjusted proportionally for children and infants, and also adjusted for other antibody formats in proportion to molecular weight and activity. Treatments may be repeated at daily, twice-weekly, weekly, monthly or other intervals, at the discretion of the physician. Treatment may be periodic, and the period between administrations is about two weeks or more, preferably about three weeks or more, more preferably about four weeks or more, or about once a month. In an aspect, the invention provides the use of an antibody or antigen-binding fragment thereof as defined in any of the embodiments herein, or a pharmaceutical composition as defined in any of the embodiments herein, in the manufacture of a medicament for treating and / or preventing a disease or disorder mediated by the proteolytic cleavage of TGFβR1. In an embodiment, the disease or disorder is cancer. Non-limiting examples of cancer include prostate cancer, mouth cancer, renal cancer, kidney cancer, bladder cancer, breast cancer, lung cancer, endometrial cancer, stomach cancer, brain cancer, and colorectal cancer, and recurrences or metastases of such tumors. Types of renal cancer include adrenocortical carcinoma. Types of brain cancer include brain lower grade glioma. Types of stomach cancer include gastric carcinoma. Types of kidney cancer include clear cell renal cell carcinoma (ccRCC). Types of breast cancer include triple negative breast cancer. Types of prostate cancer include castration-resistant prostate cancer. Types of mouth cancer include oral squamous cell carcinoma. In an embodiment the cancer is prostate cancer, optionally castration-resistant prostate cancer. In an embodiment, the cancer is colorectal cancer. In an embodiment, the cancer is oral squamous cell carcinoma. In an embodiment, the disease is fibrosis. Non-limiting examples of fibrotic diseases include glomerulonephritis, neural scarring, dermal scarring, pulmonary fibrosis, lung fibrosis, radiation induced fibrosis, hepatic fibrosis (such as NASH), myelofibrosis), burns, immune mediated diseases, inflammatory diseases (including rheumatoid arthritis), transplant rejection, cancer, Dupuytren's contracture, atherosclerosis and gastric ulcers. In an embodiment, at least one further therapeutic agent is administered to the subject. As used herein, the term “therapeutic agent” refers to any agent that can be used in the treatment, management or amelioration of a disease or disorder mediated by the proteolytic cleavage of TGFβR1 and / or a symptom related thereto. In certain embodiments, the term “therapeutic agent” refers to any antibody of the invention. In certain other embodiments, the term “therapeutic agent” refers to an agent other than an antibody of the invention. A therapeutic agent may be an agent which is known to be useful for, or has been, or is currently being used for the treatment, management or amelioration of a disease or disorder mediated by the proteolytic cleavage of TGFβR1 or one or more symptoms related thereto. Further therapeutic agents include chemotherapeutic agents such as those described herein. In a further aspect, the invention provides a method of identifying an agent for use in treating and / or preventing a disease or disorder mediated by the proteolytic cleavage of TGFβR1, the method comprising: providing TGFβR1 or a portion or variant thereof, said portion or variant comprising amino acid residues 126 to 133 of TGFβR1; providing a candidate agent; and determining whether the candidate agent reduces and / or inhibits proteolytic cleavage of TGFβR1, or said portion or variant thereof, wherein proteolytic cleavage of TGFβR1 is in a region comprising amino acid residues 126 to 133 of TGFβR1. The capability of a candidate agent to reduce and / or inhibit proteolytic cleavage of TGFβR1, or the portion or variant thereof, may be assessed by any method as discussed herein. In an embodiment, the method comprises selecting the candidate agent for further investigation. Preferably, the identified agent is one that reduces the level of proteolytic cleavage of TGFβR1 by at least 10%, 20%, 30%, 40% or 50% compared to the level of proteolytic cleavage of TGFβR1 in the absence of the agent, or the identified agent is one that reduces the level of proteolytic cleavage of TGFβR1 by at least 70%, 80%, 90%, 95% or 99% compared to the level of proteolytic cleavage of TGFβR1 in the absence of the agent. Most preferably, the identified agent is one that reduces the level of proteolytic cleavage of TGFβR1 to an undetectable level, or eliminates proteolytic cleavage of TGFβR1 compared to the level of proteolytic cleavage of TGFβR1 in the absence of the agent. The candidate agent may be any of an antibody, a peptide, a peptidomimetic, a natural product, a carbohydrate, an aptamer or a small organic molecule. Preferably the TGFβR1 or a portion or variant thereof comprises a TACE and / or PS1 cleavage site. It is appreciated that the identification of an agent that reduces and / or inhibits proteolytic cleavage of TGFβR1, or said portion or variant thereof, may be an initial step in a drug screening pathway, and the identified agents may be further selected e.g. for the ability to prevent translocation of the TGFβR1-ICD to the nucleus and / or to inhibit tumour growth. Thus, the method may further comprise the step of testing the candidate agent in an assay as described herein and / or testing the candidate agent for efficacy in an animal model of cancer. It will be appreciated that the antibody or fragment of the invention may be used as a positive control, i.e. used as positive control that does reduce and / or inhibit proteolytic cleavage of TGFβR1. In an embodiment, the candidate agent is tested for efficacy in an animal model of cancer. In an embodiment, the cancer is one which is mediated by the proteolytic cleavage of TGFβR1. The invention may comprise the further step of synthesising and / or purifying the identified agent. The invention may further comprise the step of formulating the agent into a pharmaceutically acceptable composition. In a further aspect, the invention provides the use of antibody or antigen-binding fragment thereof as defined in any of the embodiments herein to reduce and / or inhibit proteolytic cleavage of TGFβR1; and / or to reduce and / or inhibit the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell. Reduction and / or inhibition proteolytic cleavage of TGFβR1, and reduction and / or inhibition of the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell, and methods for determining such reduction and / or inhibition are as described herein. In a further aspect, the invention provides a kit comprising an antibody or antigen- binding fragment thereof as defined in herein, or a pharmaceutical composition as defined herein. A kit comprising an antibody or antigen-binding fragment thereof is provided. The antibody or antigen-binding fragment thereof may be labelled to allow its reactivity in a sample to be determined. Kits may be employed in diagnostic analysis. A kit may contain instructions for use of the components. Ancillary materials to assist in or to enable performing such a method may be included within the kit. In an embodiment, the kit contains a further therapeutic agent. In an embodiment, the kit contains components for detecting biomarkers that specifically determine the activation status of the non-canonical TGFER1 pathway in cells. Protein biomarkers can be detected, for example, by ELISA or in situ PLA. The detection of RNA biomarkers can be detected by qRT-PCR, digital PCR or droplet PCR. An example of such an assay is in situ PLA for the detection of nuclear TβRI in complex with APPL as described in Song et al., Oncotarget, 2016 Jan 5;7(1):279-92. In a further aspect, the invention provides a nucleic acid molecule comprising a nucleotide sequence encoding the antibody or antigen-binding fragment thereof as defined herein. The invention provides a nucleic acid molecule that comprises a nucleotide sequence encoding any of the antibodies or fragments as described herein. The nucleic acid may be RNA, DNA or cDNA. The nucleic acid may be in an essentially isolated, or purified form. By an “isolated” nucleic acid molecule we include the meaning of one which is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid molecule. An “isolated” nucleic acid molecule, such as a cDNA molecule, can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized. As used herein, the term “polynucleotide,” “nucleotide,” nucleic acid” “nucleic acid molecule” and other similar terms are used interchangeably and include DNA, RNA, mRNA etc. The invention provides a nucleic acid comprising a nucleotide sequence that encodes an antibody or antigen-binding fragment thereof that specifically binds to transforming growth factor beta receptor I (TGFβR1), wherein the nucleotide sequence comprises a HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 sequence that is at least 80, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical or is 100% identical to a HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 sequence in the sequence listing table (Table 20), such as the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and / or LCDR3 sequence of any of antibodies YU772-F11, or YU772-G12, or YU771-A01, or YU772- D10, or YU771-E01, or YU771-B12, or YU772-G04-VH / YU771-A09VL, or YU772-H05, or YU772-D10VH / YU772-C01VL, or YU772-A11, or antibody 19. Also included are nucleic acid molecules comprising nucleotide substitutions wherein each substitution produces no amino acid change or produces a conservative amino acid change (i.e. the nucleotide substitution is a synonymous substitution) in the corresponding protein sequence. In an embodiment, the nucleic acid molecule comprises a nucleotide sequence that is at least 80% identical to the sequence of SEQ ID NO: 3 and / or a nucleotide sequence that is at least 80% identical to the sequence of SEQ ID NO: 11. In an embodiment, the nucleic acid comprising a nucleotide sequence that encodes an antibody or antigen-binding fragment thereof that specifically binds to transforming growth factor beta receptor I (TGFβR1), comprises a nucleotide sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical or is 100% identical to a heavy chain variable region defined in the sequence listing, such as the heavy chain variable region of any of antibodies YU772-F11, or YU772-G12, or YU771-A01, or YU772-D10, or YU771-E01, or YU771-B12, or YU772-G04-VH / YU771-A09VL, or YU772-H05, or YU772-D10VH / YU772-C01VL, or YU772-A11, or antibody 19. In an embodiment, the nucleic acid comprising a nucleotide sequence that encodes an antibody or antigen-binding fragment thereof that specifically binds to transforming growth factor beta receptor I (TGFβR1), comprises a nucleotide sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical or is 100% identical to a light chain variable region defined in the sequence listing, such as the heavy chain variable region of any of antibodies YU772-F11, or YU772-G12, or YU771-A01, or YU772-D10, or YU771-E01, or YU771-B12, or YU772-G04-VH / YU771-A09VL, or YU772-H05, or YU772-D10VH / YU772-C01VL, or YU772-A11, or antibody 19. Also provided are two nucleic acid molecules, wherein the first nucleic acid molecule comprises a nucleotide sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical or is 100% identical to a heavy chain variable region (VH) defined in the sequence listing, such as the VH of any of antibodies YU772-F11, or YU772-G12, or YU771-A01, or YU772-D10, or YU771-E01, or YU771-B12, or YU772-G04- VH / YU771-A09VL, or YU772-H05, or YU772-D10VH / YU772-C01VL, or YU772-A11, or antibody 19, and the second nucleic acid molecule comprises a nucleotide sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical or is 100% identical to a light chain variable region (VL) defined in the sequence listing, such as the VL of any of antibodies YU772-F11, or YU772-G12, or YU771-A01, or YU772-D10, or YU771-E01, or YU771-B12, or YU772-G04-VH / YU771-A09VL, or YU772-H05, or YU772-D10VH / YU772-C01VL, or YU772-A11, or antibody 19. The nucleic acids of the invention are prepared or obtained in a manner known in the art (for example by automated DNA synthesis and / or recombinant DNA techniques) on the basis of the information relating to the amino acid sequences of the polypeptides of the invention provided herein and / or can be isolated from a suitable natural source. In a further aspect, the invention provides a vector comprising the nucleic acid molecule as defined herein. The nucleic acids of the invention may be in the form of a vector, such as a plasmid, cosmid or YAC. The vector can be of any type, for example a recombinant vector such as an expression vector. Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator sequences, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate. Vectors may be plasmids, viral e.g. ‘phage, or phagemid, or adenoviral, AAV, lentiviral, etc. as appropriate. Many known techniques and protocols for manipulation of nucleic acid, for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells and gene expression, and analysis of proteins, are known in the art. It is appreciated that in certain embodiments the nucleic acid molecule and the expression vector may be used in the treatment aspects of the invention via a gene therapy approach using formulations and methods described below and known in the art. In a further aspect, the invention provides a host cell comprising the nucleic acid as defined herein or the vector as defined herein. In another aspect, the invention relates to a host cell that expresses or is capable of expressing one or more antibodies or antigen-binding fragments thereof that specifically binds to transforming growth factor beta receptor I (TGFβR1); and / or contains a vector of the invention, and / or a nucleic acid of the invention. According to a particularly preferred embodiment, the host cell is a bacterial cell; other useful cells are yeast cells, fungal cells or mammalian cells. Suitable bacterial cells include Gram-negative bacteria such as Escherichia coli (e.g. BL21), Proteus and Pseudomonas and Gram-positive bacteria such as Bacillus, Streptomyces, Staphylococcus and Lactococcus. Suitable fungal cells include cells from species of the genus Trichoderma, Red-headed mould and Aspergillus. Suitable yeast cells include Saccharomyces genus (e.g. Saccharomyces cerevisiae), Schizosaccharomyces genus (e.g. Schizosaccharomyces pombe), Pichia genus (e.g. Pichia pastoris, Pichia methanolica) and Hansenula species. Suitable mammalian cells include, for example, HEK293 cells, CHO cells, BHK cells, HeLa cells, COS cells and the like. However, it will be appreciated that amphibian cells, avian cells, insect cells, plant cells and any other cells used by those skilled in the art for the expression of heterologous proteins can be used. Examples of plant cells include Physcomitrium patens. Methods for introducing nucleic acid molecules into a host cell may employ any available technique. For eukaryotic cells, suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome-mediated transfection and transduction using retrovirus or other virus, e.g. vaccinia or, for insect cells, baculovirus. Introducing nucleic acid in the host cell, in particular a eukaryotic cell may use a viral or a plasmid-based system. In a further aspect, the invention provides a method of producing an antibody or antigen-binding fragment thereof as defined herein, the method comprising expressing a nucleic acid molecule as defined in any embodiment herein, optionally comprising culturing the host cell as defined herein, and further optionally comprising isolating the antibody or antigen-binding fragment thereof from the host cell. In a further aspect, the invention provides an antibody or antigen-binding fragment thereof, pharmaceutical composition, method, use, kit, nucleic acid molecule, vector or host cell substantially as described herein, with reference to the accompanying description, examples and drawings. The present invention will now be described with reference to the following non-limiting Figures and Examples. BRIEF DESCRIPTION OF THE DRAWINGS Fig. 1 Shows the periplasmatically expressed scFvs from individual clones 11 to 20, screened for binding against the recombinant TGFbR1-ECD-133-myc(His)6 and TGFbR1-ECD-125-myc(His)6 as well as TGFbR1 derived peptides spanning from amino acid 106-120 and 106-125 of SEQ ID NO. 1. Fig. 2. Shows a graph illustrating a concentration dependent inhibition of translocation of TβRI-ICD to the nucleus of human castration-resistant prostate cancer (PC-3U) cells. Fig.3 Shows a graph illustrating the inhibition of TGFβ-induced invasion of PC-3U cells by the chimeric mouse mAb#19. Fig.4 Shows the determination of the dissociation constant (Kd) of the chimeric mouse antibody #19 against the recombinant human TGFbRI-ECD133-myc(His)6. Chimeric murine mAb#19 was loaded at 200 nM (Run1), 100 nM (Run2), 50 nM (Run3), 20 nM, (Run4) and chimeric murine mAb#19 at 100 nM in absence of immobilized TGFbR1- ECD133-myc(His)6 (Run5) was used as a reference. Fig. 5 Shows the determination of the equilibrium dissociation constant (Kd) of the chimeric mouse antibody #19 against human TGFbRI-133-huFc. Murine control antibody (#4-4-20 with specificity for fluorescein) was loaded at 200 nM (Run1), chimeric murine mAb#19 at 200 nM (Run2), 100 nM (Run3), 50 nM (Run4), 25 nM, (Run5). Run 1 had been used as a reference for the Kd analysis, whereas Run 6 (murine control antibody (#4-4-20 with specificity for fluorescein) at 400 nM (Run6) had not been included in the analysis. Fig. 6 Shows a graph illustrating the concentration dependent inhibition (IC50) of translocation of TβRI-ICD to the nucleus of PC-3U cells. Fig. 7 Shows a table over the alignment of the c-terminal human and murine Alk5 sequences (aa 101 to 147) derived from the recombinant proteins that were tested for epitope mapping. The single point amino acid mutation in each construct is depicted in bold. Fig. 8A-D Shows binding of the murine chimeric mAb#19 against titrated amounts of recombinant TGFbRI mutants, wherein the Alanine was mutated at positions 127 (A), 128 (B) and 131 (C). The results for the obtained affinities for the single mutations are summarized in the table in (D). Recombinant ECD proteins with mutations that abolished binding by the murine chimeric antibody #19 are depicted as n.f. Fig. 9A-B Shows recombinant ECD-mutations separated by SDS-PAGE and stained by Coomassie blue or immunoblotted with the murine chimeric Ab#19. Fig. 10A-B Figure 10A: Shows the amino acids that define the epitope of the murine chimeric mAb#19, as determined by binding to the recombinant ECD. (Fig. 8 and Fig. 9) mutations. Figure 10B: Epitope mapping for the mAb #19 and #F11 with alignment of the human ECD-TGFbR1 protein sequences from aa 1 to 147. The putative transmembrane region from amino acid position 127 to 147 is shaded. (A) Summary of the mAb #19 epitope mapping performed by introducing single point mutation exchanges in the recombinant protein (ECD-Protein) spanning within amino acid position 126 to 133. Substitutions at amino acid positions that substantially reduce binding of the mAb in ELISA or Western-blot are underlined and depicted in bold. (B) Summary of the mAb #19 epitope mapping using libraries of overlapping synthetic TGFbR1 peptides. Core epitopes based on common sequences in overlapping peptides are underlined and residues that are affected by alanine mutation are depicted in bold and italics. (C) Summary of the mAb #F11 epitope mapping using libraries of overlapping synthetic TGFbR1 peptides in analogy to (B). Fig. 11A-B The mean (±SD) plasma concentration vs. time profiles for the murine chimeric mAb19 after i.p. administration to athymic nude Foxn1nu mice (n=3 per time point) at nominal dose levels of 10 and 50 mg / kg. (A) represents the time scale from 0 to 72 hours post-dose, whereas (B) represent the full-time course of the study. Fig. 12A-D Show graphs illustrating the effects on tumor growth (A, C), lymph nodes (B), and lymph node metastases (D) upon treatment with murine chimeric mAb#19 in a human PC3U orthotopic prostate cancer model. Fig. 13A-B Show histology sections from tumor tissues and regional lymph nodes treated from mice treated with the murine chimeric mAb#19. Fig. 14A-B In situ PLA to visualize nuclear complex formation of TGFbRI-ICD (by detection of C-terminal HA tag) and p300 (detected by anti-HA and goat polyclonal anti-p300 (R&D Cat. AF3789), respectively) in histology sections from tumour tissues removed from mice treated with PBS (blank control), isotype control IgG1 mAb (#anti- Fluorescein) at 50 mg / kg or two concentrations of chi-mAb#19 (10 mg / kg and 50 mg / kg). A: representative IHC sections; B: Numeric representation of analyses of tissue sections: Complex formation is statistically reduced upon treatment with the chim-mAb#19 at 50mg / kg and 10 mg / kg, in comparison to vehicle control or treatment with isotype control IgG1 at 50mg / kg. ** p< 0.01 and **** p<0.001 students T-test. Fig. 15 Shows the plasma concentrations of mouse mAb#19 in blood measured by Mass Spectroscopy at the end of treatment period which lasted 30 days. Blood sample was withdrawn from the mice 72 h after the last intraperitoneal injection. Fig. 16Shows the analysis of gained body weight in mice with tumor burden by measuring the mouse’s gross weight during treatment period. Fig. 17A-B Show mAb#19 binding to its endogenous target in PC-3U (A) and RWPE (B) cells, respectively. Fig. 18 Shows IC50 determination of the (A) murine chimeric mAb#19 and the (B) fully human mAb#19 (carrying the LALA mutation) against recombinant human TGFbRI ECD-133-myc-(His)6 protein. Fig. 19A-B Shows concentration dependent inhibition of translocation of TβRI-ICD to the nucleus in PC3U cells treated with different concentrations of human mAb#19- IgG1-LALA or chimeric mAb#19-IgG1. Fig. 20 A-B PC-3U cells were treated with different antibodies (#4, #16, #19) or Lily compound (Ly; Galunisertib) in the indicated concentrations, with or without TGF-beta stimulation for 6 hours. Graphs are means+SEM from three independent experiments. The intensity of immunoblots was measured and the ratio of pSmad2 / total Smad2 are regarded as normalized signal of pSmad2. Student t test, * between different sets of samples (TGF-beta-stimulated versus unstimulated cells) . ** P < 0.01, *** P <0.001. ▲ within one set of experiments (Lily compound treated versus untreated cells). ▲▲ < 0.01, ▲▲▲ P <0.001. Figure 21A and B: Staining of TGFERI in PC3U cells. Selected antibody candidates were used for staining of TGFERI in PC3U cells. PE geometrical mean fluorescence intensity (MFI) (linear scale) is plotted against corresponding concentrations of antibody candidates (log scale). Figure 22 - Evaluation of the inhibitory effect of affinity matured antibodies on the generation of nuclear TERI-ICD in complex with p300. Nuclear TβRI-ICD HA-tagged in complex with endogenous p300 assay in PC3U cells A9 cells (KO for TβRI by CRISPR / Cas9)) reconstituted with stable expression of TβRI-HA-tagged (C-terminal tagged) and treated with affinity maturated antibodies (mAbF11 (22A), mAb19 (22B), mAbG12 (22C), D10 (22D), Yumab 19 (22E), A09 (22F), B12 (22G). Figure 23 - Invasion assay showing the invasion of human breast carcinoma MDA MB- 231 cells. MDA MB-231 cells were treated with mAb #F11 (200nM), mAb#A19 (200nM), ctrl mAb Pavilizumab (200nM) and Galunisertib (10 μM). mAb#F11, A19 and Pavilizumab carry the same Fc silencing mutations as described. After 1hr, cells were treated with TGF-β1 for 24 h. Bar graphs represent optical density (OD) of invaded cells measured at 560nm. Error bars represent means ± SEM from three independent experiments, ^^P≤.005, *P≤.05 (student t-test). Figure 24: In situ PLA assay to show the number of nuclear TβRI-ICD in complex with p300 in human prostate cancer (PC3U) cells treated as indicated. mAb#19 was more effective than mAb#4 and antibody 82.18 to prevent generation of nuclear TβRI-ICD. Error bars represent means ± SEM from three independent experiments,***P≤.001, (student t-test). Figure 25: The amino acid sequence of human ALK5 with the transmembrane region depicted in bold. The arrows labelled as 1 and 2 show where recombinant ALK5 was cleaved by recombinant TACE. The first cleavage site (arrow 1) was between amino acid A and A. The second cleavage site (arrow 2) was between amino acid A and V. The identification of cleavage sites was determined by mass spec analyses. Figure 26: A: Schematic representation of the recombinant TGFbRI-ECD-133- myc(His)6protein with the point mutations depicted at amino acid position 128. B: SDS-PAGE (12% in MES buffer) of the recombinant TGFbRI-ECD-133-myc(His)6 proteins (wt, A128G-, A128I-mutations) in absence and presence of TACE. The recombinant wt TGFbRI-ECD-133-myc(His)6protein is cleaved by TACE. Cleavage is strongly inhibited by substitution of the alanine at position 128 with glycine or isoleucine. Lane 1: wt TGFbRI-ECD-133-myc(His)6 protein after overnight incubation at 24°C with the TACE enzyme. The apparent molecular weight corresponds to the calculated molecular weight of 10,981 Da after cleavage at amino acid position 128 (A). Lane 2: the wild type TGFbRI-ECD-133-myc(His)6protein after overnight incubation at 24°C in absence of the TACE enzyme. The apparent molecular weight corresponds to the calculated molecular weight of 13,658 Da. Lane 3: molecular mass ladder (Cat#26616, ThermoFisherScientific) Lane 4: the TGFBRI-ECD-A128G-133-myc(His)6 protein after overnight incubation at 24°C with the TACE enzyme. Lane 5: the TGFBRI-ECD-A128G-133-myc(His)6protein after overnight incubation at 24°C in absence of the TACE enzyme. Lane 6: molecular mass ladder (Cat#26616, ThermoFisherScientific) Lane 7: the TGFBRI-ECD-A128I-133-myc(His)6 protein after overnight incubation at 24°C with the TACE enzyme. Lane 8: the TGFBRI-ECD-A128I-133-myc(His)6protein after overnight incubation at 24°C in absence of the TACE enzyme. Lane 9: molecular mass ladder (Cat#26616, ThermoFisherScientific) Figure 27: Prostate cancer tumors and lymph nodes in mice injected with prostate cancer cells after treatment with 50 mg / kg control (ctrl) mAb, 50 mg / kg mAb19, 50 mg / kg mAbF11 and 10 mg / kg mAbF11, respectively. Representative picture of prostate cancer tumors after treatments (figure a). Weight of prostate tumors after treatments, all treatments resulted in decreased tumor weight compared to control mAb, 50 mg / kg (N=4) 50 mg / kg mAb19: N=4, difference 183 mg, p = 0,05, 50 mg / kg mAbF11: N=5, difference 192 mg, p > 0,05, and 10 mg / kg mAbF11: N=6 difference 158 mg, p = 0,05) (figure b). Volume of prostate tumors after treatments, compared to control mAb, 50 mg / kg (N=4) 50 mg / kg mAb19 showed no significant decrease in tumor volume (N=5, p = 0,07), 50 mg / kg mAbF11 significantly reduced the tumor volume (N=4, difference 185 mm3, p > 0,05), 10 mg / kg mAbF11 also significantly reduced the tumor volume (N=4,difference 170 mm3, p > 0,05) (figure c). Representative picture showing lymph nodes after treatments (figure d). Weight of lymph nodes compared to control mAb 50 mg / kg (N=7), treatment with 50 mg / kg mAb19 significantly decreased the weight of lymph nodes compared to control (N=5, difference 9 mg, p > 0,05). Same was shown with 50 mg / kg mAbF11 treatment (N=7, difference 9 mg, p > 0,05).10 mg / kg mAbF11 showed no significant decrease in weight (N= 9, p= 0,16) (figure e). The volume of the lymph nodes was significantly reduced in all treatments with mAb19 and mAbF11 compared to control mAb 50 mg / ml, (N=6), 50 mg / kg mAb19: N=8, difference 13 mm3, p = 0,05, 50 mg / kg mAbF11: N=7, difference 17 mm3,p > 0,05, and 10 mg / kg mAb F11: N=8, difference = 15 mm3, p > 0,05) (figure f). The different treatments didn’t affect the weight of mice compared to Ctrl mAb 50 mg / kg (figure g). Figure 28: TGFβR1 expression in mCRPC tumors after treatment with mAb 19 50 mg / kg, F11 mAb (10 or 50 mg / kg) or control mAb (50 mg / kg) The high expression of TGFβR1 was reduced after 50 mg / kg treatment with mAb 19 (difference = 180608 cells, p > 0,05), 50 mg / kg mAb F11 (difference = 178955 cells, p > 0,05) or mAb F11 10 mg / kg (difference = 138022 cells, p > 0,05) compared with control mAb (figure a and b). Low expression of Ki67 was decreased after treatment with mAb 19 (difference = 45903 cells, p > 0,05), 50 mg / kg mAb F11 (difference = 34113 cells, p > 0,05) or mAb F11 10 mg / kg (difference = 32955 cells, p > 0,05) compared with control mAb. The medium expression of Ki67 was reduced in expression after treatment with 10 mg / kg mAb F11 (difference = 14545 cells, p > 0,05) compared with control mAb. Treatment with 50 mg / kg mAb 19 or 50 mg / kg mAb F11 showed no difference in medium expression of Ki67. Lastly, high expression of Ki67 was decreased after mAb F11 treatment at both 50 mg / kg (difference = 12763 cells, p > 0,05) and 10 mg / kg (difference = 17994 cells, p > 0,05) compared with control mAb. No difference was shown after 50 mg / kg mAb 19 treatment (figure c and d). Low expression of Vimentin was reduced after treatment with 50 mg / kg mAb 19 (difference = 63262 cells, p > 0,05), 50 mg / kg mAb F11 (difference = 34534 cells, p > 0,05) or mAb F1110 mg / kg (difference = 54443 cells, p > 0,05) compared with control mAb. Also, medium expression of Vimentin was decreased after treatment with 50 mg / kg mAb 19 (difference = 46192 cells, p > 0,05), mAb F11 treatment at 50 mg / kg (difference = 44331 cells, p > 0,05) and 10 mg / kg (difference = 69962 cells, p > 0,001) compared to control mAb. (figure e and f). Figure 29: Size and volume of prostate tumors after treatments with F11 mAb (3 / 10 / 30 mg / kg I.P twice a week) or control mAb (30 mg / kg I.P twice a week). Representative figure, showing prostate tumors after treatments (figure a). Volume of prostate tumors were measured after these treatments. Treatment with 3 mg / kg mAbF11 showed no significant decrease in tumor volume (p-value = 0,75), but treatment with 10 mg / kg mAbF11 significantly decreased the tumor volume compared with control mAb, (difference = 147 mm3, p-value > 0,05). Increased concentration of mAbF11 with 30 mg / kg also reduced the tumor volume compared to control mAb, (difference = 138 mm3, p-value > 0,05) (figure b). Representative figure show lymph nodes after 30 mg / kg control mAb treatment, 3 mg / kg mAbF11 treatment, 10 mg / kg mAbF11 treatment and 30 mg / kg mAbF11 treatment (figure c). The volume of the lymph nodes was also measured. 10 mg / kg mAbF11 treatment decreased the volume of lymph nodes compared with control mAb, (difference = 10 mm3, p-value > 0,05). Treatment with 30 mg / kg mAbF11 reduced the volume as well compared with control mAb, (difference = 8 mm3, p-value > 0,05). Decreased concentration mAbF11 with 3 mg / kg showed no significant decrease in volume of lymph nodes compared with control mAb, (difference = - 3 mm3, p-value = 0,59) (figure d). Weight measurement of mice after 30 mg / kg control mAb treatment, 3 mg / kg mAbF11 treatment, 10 mg / kg mAbF11 treatment and 30 mg / kg mAbF11 treatment (figure e). Figure 30: TGFβR1 expression in mCRPC tumours after treatment with F11 mAb (3 / 10 / 30 mg / kg) or control mAb (30 mg / kg) The medium score of TGFβR1 expression was reduced in 3 mg / kg mAbF11 (difference = 71468 cells, p = 0,017), 10 mg / kg mAbF11 (difference = 76653 cells, p = 0,017) and 30 mg / kg mAbF11 (difference = 88622 cells, p = 0,007) compared with ctrl mAb. High expression of TGFβR1 was decreased after 3 mg / kg mAbF11 (difference = 214031 cells, p = 0,001), 10 mg / kg mAbF11 (difference = 208635 cells, p > 0,001) and 30 mg / kg mAbF11 (difference = 202263 cells, p = 0,002) (a and b). Low expression of Ki67 was reduced after 3 mg / kg mAbF11 (difference = 56055 cells, p = 0,02), 10 mg / kg mAbF11 (difference = 64585 cells, p = 0,001) and 30 mg / kg mAbF11 (difference = 72849 cells, p > 0,0001) compared with ctrl mAb. Reduction of Ki67 medium expression after mAbF11 treatment: 3 mg / kg (difference = 21498 cells, p = 0,005), 10 mg / kg (difference = 20845 cells, p > 0,0001), 30 mg / kg (difference = 24357 cells, p > 0,0001). Reduction of Ki67 high expression after mAbF11 treatment: 3 mg / kg mAbF11 (difference = 56054 cells, p = 0,02), 10 mg / kg mAbF11 (difference = 64585 cells, p = 0,001) and 30 mg / kg mAbF11 (difference = 72849 cells, p > 0,0001) (c and d). Expression of the EMT marker Vimentin was reduced only at 30 mg / kg mAbF11 treatment: low (difference = 100784, p = 0,002), medium (difference = 100416, p-value = 0,003) and high (difference = 98960, p-value = 0,035) (e and f). Figure 31: Representative figure, showing mCRPC prostate tumor size after control for Docetaxel treatment (vehicle) and Docetaxel 10 mg / kg treatment (figure a). Volume of prostate tumors after treatment with 10 mg / kg Docetaxel showing significant decrease in tumor volume compared with Control Docetaxel (p value > 0,001, (difference = 64 mm3) (figure b). Weight measurement of mice after Control Docetaxel treatment and 10 mg / kg Docetaxel treatment. After about 2-3 weeks of treatment, about 50 % of mice treated with Docetaxel were forced to be sacrificed due to severe side effects and weight loss (figure c). Figure 32: Protein expression levels after treatments with Docetaxel. Treatment with 10 mg / kg of Docetaxel decreased low score (difference = 15746 cells, p > 0,0001) and medium score (difference = 11795 cells, p = 0,008) of TGFβR1 compared with ctrl test mAb (figure a and b). Ki67 low expression was decreased after 10 mg / kg Docetaxel treatment (difference = 13705 cells, p > 0,05). Finally, Vimentin low (difference = 12642 cells, p = 0,015) and medium expression (difference = 9958 cells, p = 0,03) was reduced compared to ctrl test mAb (figure c and d). Finally, Vimentin low (difference = 12642 cells, p = 0,015) and medium expression (difference = 9958 cells, p = 0,03) was reduced compared to Ctrl (figure e and f). Figure 33: Experimental phase schedule Figure 34: (a) Pictures of the wound healing assay at T0, T0+4h, T0+24h, T0+48h and T0+72h of Control, Galunisertib, CTL Ab at 50, 100 and 200 nM and CDD Ab at 50, 100 and 200 nM conditions (without TGFβ1 stimulation). (b) Pictures of the wound healing assay at T0, T0+4h, T0+24h, T0+48h and T0+72h of TGFβ1, Galunisertib, CTL Ab at 50, 100 and 200 nM and CDD Ab at 50, 100 and 200 nM conditions with TGFβ1 stimulation). Figure 35: Mean normalized percentage of area compared to T0 area Figure 36 - HCT116 cells from ATCC were cultured on to the sterile coverslips in Mc Coy´s 5A medium. Cells were starved in media containing 1% FBS for 16 hrs and then stimulated with TGFβ (10ng / ml) at indicated time points 0hr, 3hrs 6hrs and 24 hrs. Figure 37: Immunohistochemical analysis of TbRI expression in tissue sections derived from OSCC. Expression of TbRI was analyzed by IHC using Capra C 1183 antibody. The indicated areas (within black boxes) are shown in higher magnifications in the lower panel. Scale bar is 50 micrometer. Figure 38: Histological and immunohistochemical analysis of TbRI expression in OSCC. Expression of TbRI was analyzed by IHC and the expression was judged as weak, moderate, or strong by the software program Image J. The expression was significantly increased with higher stage of OSCC. one-way ANOVA p ** > 0.001. Scale bar is 50 micrometer. Figure 39: Treatment of OSCC patient-derived organoids with TGFb1 and two different inhibitors. A. Patient-derived organoids (PDOs) including tumour epithelial cells or the adjacent normal epithelial cells were isolated from clinical samples according to the protocol Wang B. et al. An organoid library of salivary gland tumors reveals subtype- specific characteristics and biomarkers. J Exp Clin Cancer Res, 2022(41):350). The cells were seeded on Matrigel to form organoids, and then the organoids were treated in the following conditions for 48h: Ctr Ab (100 nM); Ctr Ab (100 nM + TGFβ1 (10ng / ml); F11 Ab (100 nM) + TGFβ1 (10ng / ml); LY2109761 (10ng / ml) + TGFβ1 (10ng / ml). Black arrowheads show budding of tumor cells into Matrigel as a response to TGFβ1 stimulation in the presence of an isotype specific control antibody (control Ab 100 nM). B. Tumour budding or satellite clones sprouting from the primary PDOs were counted as sprouting ratio. Treatment with the therapeutic antibody F11 at 100 nM and Galunisertib at 10 ng / ml (LY2109761) inhibited both TGFb1-induced budding (pseudopodia) of OSCC as shown in b. Raw data were analyzed with Graphpad Prism 9 software, and statistical analysis was performed with one-way ANOVA, *p< 0 .05, ** p< 0.01, ***p< 0.001, ****p <0.0001. Data are presented as mean ± S.D Examples Example 1 – Generation of constructs expressing the extracellular domain (ECD) of the TGFbRI 1.1 Cloning of the plasmid for TGFbRI-ECD-133-myc-(His)6 antigen expression 10 μg of the periplasmatic expression vector pOPE101-215 (Yol) (Genbank Y14585.1) was cut with the restriction enzymes NcoI (ThermoFisherScientific) and BamHI (ThermoFisherScientific) in presence of the 1 x FastDigest buffer over-night at 37 °C. The vector backbone was separated from the 215 insert by separation in a 1 % agarose gel and isolated by usage of the “Gel extraction and PCR clean up kit” from Machery- Nagel (Düren, Germany). For generation of the PCR-fragment encoding for the Extracellular Domain (ECD) of the human TGFbRI (Uniprot: P36897), a reaction was composed consisting of 5 μl of 10 x buffer, 100 ng of the plasmid pcDNA3-TGFbRI-HA (encoding the entire TGFbRI gene (SEQ ID NO: 1)) and μl of 2 mM dNTPs mix and 1 μl of polymerase, 1.5 μl of the sense primer S-huTbRI-NcoI-QVQ9-pOPE (gaataggccatggcgcaggtgcaggcgttacagtgtttctgccac) (SEQ ID NO: 231) and 1.5 μl of the antisense primer AS-huTbRI-133BamHI-pOPE (ccgatagggatcctggtccagcaatgacagctgc (SEQ ID NO: 232); the last amino acid of ECD ends at position 133 (P) and AS-huTbRI- 125BamHI-pOPE (ccgatagggatccttccacaggaccaaggccagg (SEQ ID NO: 233); the last amino acid of ECD ends at position 125 (E) respectively. For cloning of the murine ECD, the sense primer S-murineTbRI-NcoI-1-pOPE gaatagg gcc atg gcg acg ctg ctc ccg ggg gcg (SEQ ID NO: 234) was combined with the human antisense primer AS-huTbRI- 133BamHI-pOPE in presence of a synthetic plasmid covering the murine ECD (R&D Systems, #RDC0709). The PCR reaction were performed with 5 min denaturation at 96 °C, followed by 32 cycles of 15 seconds denaturation at 96 °C, 20 seconds annealing at 62 °C, 30 seconds extension at 72 °C and lastly one extension at 72 °C for 5 min. The PCR product was purified by usage of a 1% agarose gel as described for the vector preparation. 2 μg of the gel-purified PCR fragment was cut with NcoI and BamHI for 2 hours at 37 °C. The cut PCR fragment was subjected to column purification according to the kit instructions. 25 ng of the purified PCR fragments were ligated with 200 ng of the appropriate prepared pOPE101 plasmid and ligation occurred over-night at 4 °C in ligation buffer and 1 μl of ligase (T4 DNA ligase, ThermoFisher Scientific). 7 μl of the ligation mix was transformed into heat shock competent XL10 Gold bacteria (Stratagene, USA) and plated on selective LB-GAT plates (0.1 M glucose, 100 μg / ml ampicillin, 12 μg / ml tetracycline) and incubated over-night at 37 °C. A single colony was picked and an over-night culture was started in selective LB-GAT medium. The pOPE101vector was isolated by usage of a plasmid isolation kit and the insert sequenced by usage of the sequencing primer (attaaagaggagaaattaacc) (SEQ ID NO: 235). 1.2 Expression and Purification of TGFERI-myc-(His)6 tagged protein The plasmid pOPE101 encoding the myc and (His)6 tagged TGFERI gene was transformed into E. coli XL10 Gold (Stratagene, USA) and transformants were selected for on LB agar plates containing 100 μg / ml carbenicillin, 12.5 μg / ml tetracycline and 0.1 M glucose as a repressor. For expression, an overnight-culture in selective LB medium (100 μg / ml carbenicillin, 12.5 μg / ml tetracycline and 0.1 M glucose) was diluted in freshly prepared analogous selective medium and grown at 37 °C until an optical density (at 600 nm) of 0.6 was reached after which protein expression was induced by the addition of IPTG to a final concentration of 75 μM. After 12 hours induction at 24 °C (230 rpm), the proteins were harvested from the periplasmatic space. The pelleted bacteria were resuspended in 1 / 16 culture volume of cold Spheroblast solution (50 mM Tris-HCl pH = 8.0, 20% Sucrose, 1 mM EDTA) and gently shaken for 1 hour at 4 °C. The suspension was centrifuged at 30,000 g for 1 hour at 4 °C and the supernatant, representing the periplasmatic extract, was dialyzed twice overnight against 5 liters of PBS at 4 °C. The solution was passed through a 0.45 μm filter and adjusted to 0.5 M NaCl and 20 mM imidazole for loading on a Ni-NTA FPLC- column (GE-Healthcare, USA). The (His)6-tagged protein was eluted with elution buffer (PBS adjusted to 0.5 M NaCl and 0.5 M imidazole) and protein-containing fractions were dialyzed twice overnight against 2 liters of PBS at 4 °C. Aliquots were adjusted to 1 mg / ml with PBS and stored at – 80 °C. Purity and integrity of the protein was confirmed by Coomassie-gel staining and immunoblot using the c-Myc tag specific mAb 9E10. 1.3 Cloning and expression of biotinylated ECD 33-133-Avi-(His)6 The plasmid pOPE101 TGFbR1 ECD-QVQ 33 to133 clone F1 was propagated in XL10- Gold E. coli. Plasmid DNA was isolated using Thermo Scientific GeneJET Plasmid Miniprep Kit #K0503. The 81 nt oligonucleotides Avi-cassette-cs (GATCCGGAGGTAGTGGTCTGAACGACATCTTCGAGGCTCAGAAAATCGAATGGCACGAACA TCATCACCACCATCACTAAT) (SEQ ID NO: 236) and Avi-cassette-ncs (CTAGATTAGTGATGGTGGTGATGATGTTCGTGCCATTCGATTTTCTGAGCCTCGAAGATGTC GTTCAGACCACTACCTCCG) (SEQ ID NO: 237) were synthesized by Sigma-Aldrich. The bacterial strains used were XL10-Gold Ultracompetent Cells and Stratagene 200314d- Biotin was from Supelco 4-7868100 mg (Sigma-Aldrich). Quantification of biotin was done using Pierce Biotin Quantitation Kit, Thermo Scientific 28005. A plasmid construct for expression of ECD (amino acids 33-133 in TGFbR1) fused to an Avi-His tag in E. coli was constructed by inserting a codon optimized construct with a C-terminal Avi- 6xHis tag into the vector pOPE101. The two oligos were annealed and ligated into a BamHI + Nhe1 digested vector and the mixture used to transform XL 10 Gold bacteria, colonies were screened, and a correct clone was isolated. 1.4 Expression of a protein of the expected size was verified by Western blot. Biotinylated ECD of TGFbR1 was obtained by co-expression of the biotin ligase, BirA, and purification using Ni-NTA affinity chromatography. The degree of biotinylation was determined using a biotin quantification kit. 1.5 Peptides The peptide 4095-272 consisting of Biotin-SGSGPGLGPVELAAVIAGP-NH2 (SEQ ID NO: 238) which includes aa’s 119-133 of the TGFERI was synthesized by Bachem AG, Switzerland. Example 2 - Phage display selection on ECD 33-133-Avi-(His)6 using phage libraries. Phage display was performed to enable isolation of scFv fragments with specificity for the extracellular domain of human TGFER1. 2.1 Phage display selection Biopanning was performed using four selection rounds of enrichment employing two human synthetic scFv phage libraries, SciLifeLib1 and SciLifeLib2 (SciLifeLab, Stockholm, Sweden). SciLifeLab 1 and 2 are naive human synthetic scFv libraries, similar in design and construction to previously reported libraries (Säll, et al., Protein Eng Des Sel (2016) 29: 427-437). Briefly, human germline genes IGHV3-23 and IGKV1-39 were used as library scaffold and Kunkel mutagenesis was used to introduce diversity into four of the six complementarity determining regions (CDR); namely CDR- H1, CDR-H2, CDR-H3 and CDR-L3. The selection was performed using biotinylated ECD 33-133-Avi-(His)6 (aa 33-133, see Example 1 for details) and streptavidin-coated magnetic beads (Dynabeads M-280, ThermoFisher Scientific, #11206D). The selection pressure was increased by gradually decreasing the antigen amount (33-177 nM) and by increasing the number of washes between the different rounds. In order to remove non-specific or streptavidin binders pre-selection was performed by incubation of the phage stocks against empty streptavidin coated magnetic beads prior to round 1 and 2. Also, 1 % bovine serum albumin (BSA) was included as blocking agent throughout the selection procedure. Elution of antigen-bound phages was performed using a trypsin-aprotonin approach. Recovered phages were propagated in XL1 Blue E. coli, either on agar plates at 37 °C overnight (Rounds 1 and 2) or in solution at 30 °C overnight (Rounds 3 and 4). Phage stocks were made by infecting with an excess of M13K07 helper phage (New England Biolabs, # N0315S) and scFv display induced by the addition of IPTG. The overnight cultures were PEG / NaCl-precipitated, resuspended in selection buffer and used for the next round of selection. 2.2 Re-cloning and expression of scFv To allow production of soluble scFv, phagemid DNA from the third and fourth round of each selection track was isolated. In pools, the genes encoding the scFv fragments were restriction enzyme digested and sub-cloned into screening vector pHAT-6, providing a signal for secretion of the scFv along with a triple-FLAG tag and a hexahistidine (His6) tag at the C-terminus. The constructs were subsequently transformed into TOP10 E. coli. Single colonies were picked, cultivated and IPTG- induced for soluble scFv expression in 96-well format. In total, 278 scFv clones present in bacterial supernatant were prepared for a primary ELISA screen. 2.3 ELISA screen Human ECD 33-133-Avi-(His)6 (see Example 1), and negative control protein streptavidin were coated into a 384-ELISA well plate at 1 μg / ml in PBS at 4°C overnight. Plates were washed twice and blocked for 2 h in blocking buffer (phosphate- buffered saline (PBS) supplemented with 0.5% bovine serum albumin (BSA) + 0.05% Tween20). Triple-FLAG-tagged scFv, present in bacterial supernatant, were diluted 1:5, in blocking buffer and allowed to bind. Detection of binding was enabled through an HRP-conjugated anti-FLAG M2 antibody (Sigma-Aldrich #A8592) followed by incubation with 1-step Ultra TMB ELISA substrate (ThermoFisher Scientific #34029). The colorimetric signal development was stopped by adding 1 M sulfuric acid and plates were read at 450 nm. All samples were assayed in duplicates. 2.4 DNA sequencing 75 positive scFv clones showing binding to TGFbR1-ECD were sent for Sanger DNA sequencing to GATC Biotech (Ebersberg, Germany). 2.5 Results Two selection tracks were carried out in parallel on human TGFER1-ECD-AviHis using phage scFv libraries SciLifeLib 1 and 2. Following re-cloning of selected scFv clones, a total of 278 clones (colonies) were picked from selection rounds 3 and 4. A primary ELISA screen resulted in 75 potential hits. DNA sequencing of these resulted in the identification of 17 sequence unique clones; B-ML012-4, B-ML012-5, B-ML012-6, B- ML012-7, B-ML012-8, B-ML012-9, B-ML012-10, B-ML012-11, B-ML012-12, B-ML012- 13, B-ML012-14, B-ML012-15, B-ML012-17, B-ML012-18, B-ML012-19 and B-ML012- 20. Example 3 - Affinity characterization of selected scFv This example describes the experiments that allowed selection of 8 of the 17 clones to progress. The 17 unique scFv clones from Example 2 were selected for further characterization by ELISA and biolayer interferometry (BLI) in a kinetic screen-based approach to enable ranking of the different clones. 3.1 Expression and purification of scFv Expression of the 17 scFv were carried out in TOP10 E. coli cells. 50 ml cultures were started and protein expression induced at exponential phase by the addition of isopropyl thiogalactoside (IPTG) overnight at 30°C. Cell lysis was performed through B-PER Bacterial Protein Extraction Reagent (Thermo-Fisher) and purification performed using immobilized metal affinity chromatography IMAC (Nickel Sepharose 6 Fast Flow, GE Healthcare). SDS-PAGE was performed to determine purity and integrity of the purified scFv and concentrations determined by the BCA (Bicinchoninic Acid) assay kit (Pierce). 3.2 ELISA Streptavidin and the different human TGFbR1-constructs (125, 131, 133, Example 1) diluted to 1 μg / ml in PBS were added to the wells of an ELISA plate and incubated at 4°C overnight. Plates were washed twice and blocked for 2 h in blocking buffer (phosphate-buffered saline (PBS) supplemented with 0.5 % bovine serum albumin (BSA) + 0.05 % Tween20). The biotinylated 4095-272 peptide (Example 1), containing the sequence corresponding to amino acids 119 to 133 of the ECD, was added to the streptavidin surface and incubated for another 1-2 hours. Purified scFv, diluted to 1 μg / ml, were allowed to bind for 1-2 hours. Detection of binding was enabled through an HRP-conjugated anti-FLAG M2 antibody (Sigma-Aldrich, #A8592) followed by incubation with 1-step Ultra TMB ELISA substrate (ThermoFisher Scientific, #34029). The colorimetric signal development was stopped by adding 1 M sulfuric acid and plates were read at 450 nm. All samples were assayed in duplicates. 3.3 Biolayer interferometry (BLI) Kd-estimation of selected scFvs against the recombinant human TGFbRI-ECD133- myc(His)6. The Kd was monitored in real-time by interferometry Bio-layer detection with the BLItz System from Fortébio, USA. All dilutions were performed in PBS which includes the dilution of the TGFbRI-antigen, scFv and also the baseline and wash buffers. Loading of target antigen occurred with 4 μl at a concentration of 1 mg / ml. Each scFv was loaded with 4 μl and measured at a concentration of 5 μM only. As control, measurements were performed with the scFv #16 that did not show any binding toward the immobilized TGFbRI-ECD133-myc(His)6in ELISA. Immobilization of the antigen occurred with a Biosensor Ni-NTA tip (cat# 18-5101). No subtraction of the control run was performed. Initial baseline: 30 seconds, 4μl Antigen loading: 120 seconds, 4μl Baseline: 80 seconds, 250 μl Association: 120 seconds, 4 μl Dissociation: 120 seconds, 250 μl 3.4 Results
[0002] B-ML012-14 ++ + 1.3 x 10-7 7. B-ML012-15 ++ ++ 6.6 x 10-8 1. B-ML012-17 ++ ++ 1.1 x 10-7 6. B-ML012-18 - - 1.6 x 10-6 13. B-ML012-19 ++ - 3.3 x 10-7 12. B-ML012-20 ++ ++ 1.0 x 10-7 5. Table 3. The binding signals of selected scFv were assayed by ELISA and biolayer interferometry (BLI); “+++” strong, “++” less strong, “+” minor “-“ no binding was detected. Periplasmatic scFvs from individual clones (here shown clone 11 to 20; Fig. 1) were screened for binding against the recombinant TGFbR1-ECD-133-myc(His)6 (dark bars) and TGFbR1-ECD-125-myc(His)6 (grey bars) as well as TGFbR1 derived peptides spanning from amino acid 106-120 (checked bar) and 106-125 (dashed bar). Wells were coated with coating buffer only as negative control (empty bar). ScFv clone 19 showed binding toward the recombinant TGFbR1 protein ending at amino acid 133 but lacks binding against the shorter version ending at amino acid 125. None of the control peptides were bound. Example 4 - IgG conversion of eight scFvs to IgG and validation of binding In this Experiment, eight of the most promising scFv clones from the phage selection (Example 2) and subsequent binding analyses (Example 3) were converted to the mouse IgG1 (mIgG1) subclass; namely B-ML012-4, B-ML012-5, B-ML012-14, B- ML012-15, B-ML012-16, B-ML012-17, B-ML012-19 and B-ML012-20. At conversion, these were given new names in order to better reflect the new format; mouse mAb#4, mAb#5, mAb#14, mAb#15, mAb#16, mAb#17, mAb#19 and mAb#20, respectively. The control antibody had been cloned into the same murine IgG1 framework and is directed against Fluorescein. 4.1 Cloning Following amplification by polymerase chain reaction (PCR) using the primers listed in Table 4, gene constructs containing the VH region of the scFv of interest were incorporated into the pFUSE-CHIg-mG1 (Invivogen) plasmid containing the constant region of the mouse IgG1, using standard cloning by restriction digest (AflII and AfeI) and ligation. Primer name Nucleotide sequence SEQ ID NO VH _forward_AfIII ACTAGTCTTAAGTGAGGTGCAATTGTTGGAGAGC 239 VH_reverse_AfeI AGTCAGTTTAGCGCTGGAGACGGTGACCAG 240 VL _forward_AgeI AGATACCACCGGTGACATCCAGATGACCCAGTCTCCA 241 VL_reverse_XhoI CGTTTGATCTCGAGCTTGGTCCCCTGGCCAAA 242 Table 4. Primer sequences for amplification of the VH and VL fragments. On the basis of binding to the c-terminal part of ECD and / or binding to P3CU cells in immunostaining and / or strong ECD binders based on affinity seen from BLITZ data, the following 8 scFv’s were selected for a first test in cell assays once converted into chimeric murine IgG1 (mIgG1) antibodies. These were: #4, 5, 14, 15, 16, 17, 19 and 20. Similarly, gene constructs containing the VL region of the scFv of interest were incorporated into the pFUSE-CLIg-mKappa plasmid (Invivogen) containing the constant region of the mouse Kappa chain, using enzymes AgeI / XhoI followed by ligation. All constructs were verified by sequencing performed at GATC Biotech (Ebersberg, Germany). The converted scFv clones and corresponding mouse IgG1 are listed in Table 5A. scFv Mouse IgG1 B-ML012-4 mouse mAb#4 B-ML012-5 mouse mAb#5 B-ML012-14 mouse mAb#14 B-ML012-15 mouse mAb#15 B-ML012-16 Mouse mAb#16 B-ML012-17 mouse mAb#17 B-ML012-19 mouse mAb#19 B-ML012-20 mouse mAb#20 Table 5A. Converted scFv clones and corresponding clones in mouse IgG1 format 4.2 Expression and purification Transfection of plasmid DNA into expiHEK293 cells was performed using an ExpiFectamineTM 293 Transfection Kit (ThermoFisher Scientific #A14525) in 300 ml cultures. After 8 days of cultivation at 37 °C, 6 % CO2, 80 % rH and 400 rpm, the media supernatant was mixed with 1 ml Protein G Sepharose Fast Flow (GE Healthcare, #17-0618-02) at 120 rpm for 1 hour at room temperature, collected on a gravity flow column and washed in 10 ml buffer (20 mM NaH2PO4, 50 mM NaCl, pH 7.4). Immediately following elution in 0.1 M Glycine, pH 2.7, neutralization was performed by addition of 1 M Tris-HCl, pH 8.8, and buffer was exchanged to PBS using spin filters. SDS-PAGE was performed to determine purity and integrity of the purified IgG and protein concentration was determined by the BCA assay kit (Pierce). 4.3 ELISA Streptavidin diluted to 2 μg / ml in PBS was added to the wells of a 384-well ELISA plate and incubated at 4 °C overnight, followed by washing and incubation in blocking buffer (PBS supplemented with 3 % BSA) for another 1-2 hours at room temperature. 0.1 μg / ml ECD 33-133-Avi-(His)6(see Example 1), diluted in assay buffer (PBS supplemented with 0.3 % BSA and 0.05 % Tween20) was added to half of the wells. To the other half only assay buffer was added. After another incubation at 1 hour, twelve concentrations of each of the purified mIgG1 antibodies were added (1:2 dilutions, starting from 1 μg / ml). After cycles of incubation and washing, detection of binding was enabled through a HRP-conjugated goat anti-mouse kappa antibody (Southern Biotech, #1050-05) followed by incubation with 1-step Ultra TMB ELISA substrate (ThermoFisher Scientific, #34029). The colorimetric signal development was stopped by adding 1 M sulfuric acid and plates were read at 450 nm. All samples were assayed in duplicates. The two clones in the set that previously had shown binding to the 4095-272 peptide, namely B-ML012-4 and B-ML012-19 (see Example 3) were again assessed for binding to this peptide. The same protocol as described above was used, except that the ECD 33-133-Avi-(His)6 was exchanged for 0.1 μg / ml biotinylated 4095-272 peptide (Example 1). 4.4 Results All clones were successfully produced (0.1-1.8 mg), except for B-ML012-15, which did not result in any measurable amounts after purification. This clone was therefore excluded from further studies. As the candidate #15 did not express well in the mammalian cells it was replaced by candidate #17. Binding was confirmed to the extracellular domain of TGFbR1 for all produced IgG in Table 5. From the ELISA results it could be seen that only candidate #4 and #19 showed binding to both the ECD 33-133 and the peptide #4095-272. All candidates except #3 and #16 showed binding to the ECD 33-133. Clone # 3 4 5 14 15 16 17 19 20 -ve TERI-ECD 33-133 avi - + + + na - + + + - Peptide 369 + - - - na - - - - - Peptide 4095-272 - + - - na - - + - - Comment* * * Binds ECD and peptide 4095-272 Table 5B: The binding of selected murine chimeric antibodies determined by ELISA. To summarize, the ELISA binding pattern as summarized in Table 3 for scFv (Example 3) to TGFbR1-ECD-33-133-avi and peptide #4095-272 was confirmed for the corresponding IgG molecules. Example 5 - Selection of final candidate, B-ML012-19 (ab#19) To further discriminate between the candidates the functional assays described in Examples 5.1-5.3 were performed. 5.1 Translocation of the intracellular domain of TGFβ (ICD) into the cell nucleus Materials Following cell lines had been used: (1) the wild type PC3U cell line (androgen independent human prostate carcinoma cell line); (2) A9, an isogenic PC3U cell line in which the TGFER1 expression (in exon2) had been silenced by usage of the CRISPR- Cas9 technique; (3) the A9 cell line in which the full length TGFER1 expression had been reconstituted by transformation with an expression plasmid encoding for a C-terminally, HA-tagged human TGFER1. A9 TGFβRI (CRISPR-Cas9 gene edition) cell line was used to silence TGFβRI / ALK5 in human prostate cancer (PC3U) cells, thereafter cells were reconstituted with TGFβRI- HA tag (in C-terminal part of the protein). The A9 cell line was generated by Anders Wallenius. The primary antibodies used were anti-HA rabbit Abs (Cell Signaling Cat.3724) and anti-p300 goat antibody (R&D. Cat. AF3789). The PLA kits used were Duo 92002, Duo92006 and Duo92007 (Sigma). TGF-β1 (Catalogue number: 100-21, Peprotech Ltd.) was applied at a concentration of 10 ng / ml. RPMI1640 medium and FBS was from Sigma and ultrapure water from Sartorius AriumPro UV system. Treatment Abs: Murine chimeric #19 Ab: mAb#19; cAb1114-1.1 mouse antibody and control antibody; anti-fluorescein Ab00102-1.1 mIgG1. Methods Step 1 Cell culture 1stday, A9 (ALK5-HA) reconstituted cells were seeded in an 8-well chamber slide (5x104cells per well) on sterile glass slides. 2ndday, the cells were starved with medium supplemented with 1 % FBS for 16 h. 3rdday, the cells were pretreated with murine chimeric #19 Abs, human #19 Abs, and human isotype specific control Abs, for 1 hour, and then stimulated with TGF-β1 10 ng / ml for 6 h. Step 2 Fixation and permeabilization slides 1. The slides were washed 4 times with PBS and then fixed in 4 % paraformaldehyde (pre-warmed at 37°C) for 30 min at room temperature. 2. After 4 times washing with PBS, the slides were permeabilized in 0.1 % Triton X-100 in PBS for 10 min. Step 3 PLA staining was performed according to PLA kits instruction of PLA kits as previously reported [4]. Step 4 Collection of images for PLA staining Digital images were taken by using a fluorescence microscope (Axioplan 2, Carl Zeiss) with a digital camera (C4742-95, Hamamatsu), with a X40 objective lens (Carl Zeiss Micro-Imaging). The setting for digital pictures, and PLA analysis were automatically saved as part of the raw data. Step 5 Analysis PLA signaling Analysis of PLA signaling for nuclear TβRI-ICD in complex with p300 was performed by the use of Duolink Image Tool that was specially developed for quantification of PLA signaling. Positive control used in the experiment: TGF-β1 treatment in absence of antibodies, presented as No #190 nM. Negative control used in this experiment: Staining without antibodies in presence of or absence of TGF beta (only the A9-cells). All the samples were examined as triplicates. Statistics GraphPad Prism 7 was used for analysis of the half maximal inhibitory concentration value (IC50). A concentration dependent inhibition of translocation of TβRI to the nucleus is shown in Fig. 2. Relative values for nuclear TβRI-ICD (as visualized by in situ PLA) in PC3U cells treated with TGFβ1 and different concentrations of murine chimeric mAb#19 are shown. 5.2 Invasiveness, measurement cell mobility Protocol for PC3U invasion assay Day 1: PC3U cells were seeded in a 10 cm plate with 8x105cells in 10% FBS (RPMI 1640, Sigma). Day 2: 10 % media was removed and replaced with 1% FBS media in order to starve cells Day 3: 1. 0.5 ml warm culture medium (without serum) was added to the interior wells of the inserts in a Rehydration Matrigel Invasion Chamber (Corning, Cat. 354483, and rehydrated for 2 hours at 37 °C in presence of 5 % CO2. 2. Cell suspensions were prepared by trypsinisation and resuspended in 1 % FBS media at a concentration of 1x105cells / ml. 3. Antibodies (Abs) were diluted in the media for the upper and lower chamber Lower chamber: Antibodies were diluted directly in 5 % FBS media at 400 nM, 200 nM, 100 nM, 75 nM, 50 nM, and 25 nM (0.75 ml in each well). Upper chamber: Abs were diluted in 1 % FBS media at 800 nM, 400 nM, 200 nM, 150 nM, 100 nM, and 50 nM (0.25 ml in each well). Note: Antibodies were added in twofold concentration in the upper chamber at the beginning, whereupon then the same amount of cell suspensions (0.25 ml) was added. Final concentrations of antibodies were 400 nM, 200 nM, 100 nM, 75 nM, 50 nM and 25 nM. 4. The Invasion Chamber was incubated for 1 hours at 37 °C at 5 % CO2. 6. The cells were stimulated with TGFβ110 ng / ml (Peprotech). Day 4 1. After 30h TGFβ1 stimulation, the non-invading cells in the upper wells were removed by scrubbing. 2. The inserts were immediately stained with 400 μl Cell Stain Solution for imaging and quantification. Day 5 The stained cells were dissolved with 200 μl Extraction Solution, and the OD value at 560 nm was measured. Concentration dependent inhibition of TGFβ1-induced invasion of PC-3U cells treated with TGFβ 10 ng / ml (purchased from Peprotech Ltd.), for 30 h, and different concentrations mouse mAb#19 is shown in Fig. 3. Quantification of cell free area bottom side filter using ImageJ script on brightfield images on the transwell filters. Mean values ± SEM is calculated from three independent experiments. PC3U cells treated with TGFβ1 alone, together with isotype specific IgG1 (IgG) or non-treated (CNTR), is shown as controls. Based on the outcome of the above assays and the previous ELISA results an aggregated view of the data resulted in that two antibody (AB) candidates #4 and #19 were selected for further progression. Galunisertib (LY2157299 at 10 μM). Data are calculated based on the ratio response for control antibody / candidate antibody. AB 4 19 LY2157299 WT (Ctrl) WT TGFβ Assay (6h / 24h) ICD 5.5±0.5 6.7±1.4 12.1±2.1 4.5±2.1 23.7±7.1 translocation (in situ PLA (HAab- p300 complex dots / nuclei) Invasiveness* 7.4±0.5 7.7±1.5 - 7.4±0.5 13.7±0.2 (OD*100) Invasiveness** - - 53±13 37±7.6 165±10 (cell count) Table 6: Selected candidates and results of functional assays. Cells were treated with TGFbeta for 6h in the nuclear intracellular domain (ICD) translocation study and for 24 h in the invasiveness study. Optical densitometry (OD) at 560 nanometer. To further characterize the two remaining candidates’ biophysical characterization was performed for candidates #4 and #19 Materials and methods: Size exclusion chromatography (SEC) was performed by use of two different systems: 1. A Superdex Increase 200 3.2 / 300 (Cytiva) connected to an Agilent 1100 HPLC system equipped with a DAD detector. The running buffer was 20 mM HEPES and 150 mM NaCl at pH 7.5. 2. A Bio SEC 3 column, 300 Å 7.8 x300 mm (Agilent) connected to an Agilent 1100 HPLC system equipped with a DAD detector. The running buffer was running buffer 150 mM NaxHyPO4, pH 6.8. Samples: antibodies were diluted to approximately 0.5 mg / ml in running buffer and 50 μL was applied to the column. Samples were analyzed on both systems. Isoelectric focusing gel electrophoresis (IEF): IEF was run using a Novex™ pH 3-10 IEF Protein Gel (ThermoFisher) according to the supplier’s recommendation. Samples were 1 and 4 uL of undiluted antibodies with a concentration of 2.5 mg / ml Tm measurement by Differential Scanning Fluorimetry (DSF): For determination of protein melting curves a Prometheus NT.48 (Nanotemper) was used. The signal at wavelengths 350 and 330 nm were recorded, and the 350 / 330 quote was plotted against temperature. The scan rate was 1 degree / minute, and the protein concentration was 0.5 mg / ml. Chemical denaturation was done using guanidinium hydrochloride (Sigma (G405 Lot#SLBC7059V) and PBS was from Sigma (D8537-500ml Lot RFNB7745). The 350 and 330 signals were measured in the Prometheus instrument by running a gradient between 20 and 21 degrees with a step of 0.2 degrees / minute. The average signal was calculated and plotted against the concentration of GmdCl. Samples were incubated with different concentrations of guanidinium hydrochloride, incubated for 1 hour and the A350 / 330 ratio was determined and plotted against the concentration of guanidinium hydrochloride in the sample to generate a chemical denaturation graph. Results The two candidates mAb#4 and mAb#19 were characterized by biophysical methods above with the aim to find distinguishing characteristics to enable the decision for choosing a preferred candidate. The key difference observed between mAb#4 and mAb#19 was their behavior in the size exclusion chromatography where mAb#4 was significantly delayed on both the columns used while mAb#19 eluted at the expected retention time. Neither thermal nor chemical denaturation studies revealed any differences between the two candidates that impacted on the choice of candidate. These results would suggest that mAb#4 is prone to aggregation and therefore mAb#19 was selected as the final candidate. Example 6 - Detailed characterization of mAb#19 6.1 Affinity measurement Biacore (SPR) and Blitz 6.1.1 Biacore (Surface Plasmon Resonance, SPR) measurement Material and methods Biotinylation of the chimeric mAb#19 Biotinylation of the chimeric mAb#19 was performed by usage of the EZ-Link Sulfo- NHS-LC-LC-biotin reagent (Cat#21338, Thermo Fisher Scientific). 10 μl of a 10 mM biotinylation reagent (dissolved in H2O) was added to 200 μl (1 mg) of the murine chimeric mAb#19 at a concentration of 5 mg / ml and incubated on ice for 2 hours (corresponding to a 13-fold excess). The reaction was stopped by addition of 20 μl 1 M glycine. The biotinylated protein was dialyzed multiple times against PBS (over-night at 4 °C) in order to remove unreacted biotin. The concentration of the biotinylated Ab was determined by a spectrophotometer. Affinity measurements were performed using a BiaCore T200 (Cytiva). Covalent immobilization of mAB#19 on CM5 chip The immobilization of mAB#19 was carried out on a CM5 chip using a manual run. Antibody was diluted to 25 μg / ml in 10 mM NaAc buffer, pH 5.0. The surface was activated by an injection of a mixture of EDC / NHS for 7 min, at the flow rate 10 μl / min. Antibody was injected over the activated surface at the flow rate 2 μl / min for 30 - 45 sec. The surface was deactivated by the injection of 1M ethanolamine for 7 min at the flow rate 10 μl / min. The typical immobilization level was around 800 RU. Immobilization of biotinylated mAB#19 on streptavidin chip (SA) The immobilization of biotinylated antibodies was performed on a SA chip using a manual run. Antibodies were diluted 1:200 in the 1xHBS-P, pH 7.4. Prior to immobilization, the chip surface was preconditioned three times 1 min with 1M NaCl, 50mM NaOH at the flow rate 10 μl / min and antibodies were injected at the flow rate 2 μl / min for about 40 sec to obtain the immobilization level around 800 RU. Antigen preparation ECD 133-myc-His(6) was diluted to 100 nM starting concentration in the 1xHBS-P running buffer, followed by a 1:1 serial dilution in the same buffer, resulting in 5-points concentrations, ranging from 100 nM to 6.25 nM. A single cycle kinetics experiment was used. The run parameters were: contact time - 60 sec, dissociation time - 600 sec, start-up cycles - 5, flow rate - 30 μl / min, blank injections - 2 and a temperature of 25 °C. After completion of the cycle with ECD 133-myc-His antigen, the surface was regenerated by a 30 sec injection of 146 mM H3PO4, at the flow rate 30 μL. Results The binding of ECD 133-myc-His to immobilized biotinylated and covalently immobilized non-biotinylated antibodies was validated. A 1:1 binding model analysis was performed to obtain the dissociation constant (Kd) of the interactions. ECD 133- myc-His bound to covalently immobilized mAb#19 with affinities of 5.6 and 6.5 nM, determined by two independent experiments. ECD 133-myc-His was interacting with the immobilized biotinylated mAb #19 similarly as observed for covalently immobilized non-biotinylated antibody and the Kd was determined to be 2.5, 1.8 and 2.3 nM in three independent experiments. 6.2 Kd-determination by Interferometry (Blitz measurement) Kd determination of the antibody mAb#19 against the recombinant human / murine TGFbRI-ECD133-myc(His)6 and human TGFERI-133-huFc. The Kd was monitored in real-time by interferometry Bio-layer detection with the BLItz System from Fortébio, USA. All dilutions were performed in PBS containing 10 μg / ml Biocytin which includes the dilution of the TGFERI-antigen, antibody and also the baseline and wash buffers. Loading of target antigen occurred with 4 μl at a concentration of 0.5 mg / ml. Antibody was loaded with 4 μl at indicated concentrations. As control, measurements were performed at the second highest concentration in absence of the antigen. Immobilization of the antigen occurred with a Biosensor Ni- NTA tip (cat# 18-5101) for the human and murine TGFERI-ECD133-myc(His)6 and with the Biosensor AHC tip (cat#18-5060) for the human TGFERI-133-human Fc protein. Initial baseline: 30 seconds Antigen loading: 120 seconds Baseline: 80 seconds Association: 120 seconds Dissociation: 120 seconds Murine chimeric IgG1-#19 against the human TGFERI-ECD133-myc(His)6: The Kd was measured at four mAb#19 concentrations (200 nM, 100 nM, 50 nM and 20 nM) and the background, determined with the antibody concentration at 100 nM in absence of the target antigen, was subtracted (see Fig 4). Kon(1 / Ms)=1.7 x 10^5 (Ka error= 1.4 x 10^3); Koff (1 / s)= 6.4 x 10^-4 (Koff error=1.9 x 10^-5) Kd= 3.7 x 10^-9 M Ind Sample ID Conc KD Ka Ka Kd Kd Rmax Rmax R X^2 R¨2 ex (nM) (M) (1 / M Error (1 / s) Error Error equilibrium s) 1 Chim#19 200 3.7 1.70 1.14 6.356 1.879 4.64 0.017 4.555 2.2 0.9 36e 1e5 6e3 e-4 e-5 99 18 995 -9 2 Chim#19 100 3.7 1.70 1.14 6.356 1.879 3.338 0.025 3.218 2.2 0.9 36e 1e5 6e3 e-4 e-5 55 18 995 -9 3 Chim#19 50 3.7 1.70 1.14 6.356 1.879 2.7 0.030 2.512 2.2 0.9 36e 1e5 6e3 e-4 e-5 24 18 995 -9 4 Chim#19 20 3.7 1.70 1.14 6.356 1.879 1.548 0.020 1.304 2.2 0.9 36e 1e5 6e3 e-4 e-5 75 18 995 -9 5 Chim#19 100 absence of ECD Table 7: Summary of Kd determination of the murine chimeric mAb#19 against the immobilized TGFERI-ECD133-myc(His)6 . mAb #19 format Human ECD TGFbR1- Human ECD TGFbR1-133- Murine ECD TGFbR1-133- 133-myc(His)6huFc myc(His)6Murine chimeric IgGI1 3.7 nM 13 nM 18 nM human IgGI- 5.9 nM not applicable not tested LALA Table 8. Summary Kd determinations. Kd values as determined by Bio-layer interferometry (BLI). Recombinant TβRI-ECD proteins were immobilized and the antibodies were used as an analyte. 6.3 - Concentration dependent inhibition (IC50) for TβRI-ICD translocation Materials and methods: A9 cells: CRISPR-Cas gene edition was used to silence TGFβRI / ALK5 in human PC3U cells. A9-ALK5-HA cells: HA-tagged C-terminal part of TGFβRI was reconstituted in A9 cells. Both cell lines were developed in Landström research lab by Anders Wallenius ((Wallenius A., Mu Y., Rudolfsson S., Schmidt A., Zang G. and Landström M. Manuscript in preparation). Both cell lines were used and grown in RPMI1640 medium and 10 % FBS (Sigma). The following primary antibodies were used: anti-HA rabbit Abs (Cell Signaling Cat.3724), and anti-p300 goat antibody (R&D. Cat.AF3789). The PLA kit (Duo 92002, Duo92006, Duo92007) was purchased from Sigma. Treatment Abs: mouse mAb#19 Ab (B-ML_012-19, cAb1114-1.1, mouse IgG1), and mouse mAb Ctrl; isotype specific IgG1 (Catalog number#MAB001, Clone 11711, Lot no: IX241811A from R&D Systems) or #Fluorescein Abs from Absolute Antibodies (control abs). TGF-β1 was purchased from Peprotech Ltd. (Cat. 100-21.), and used at 10 ng / ml. Step 1 Cell culture 1stday, A9-ALK5-HA reconstituted cells were seeded in an 8-well chamber slide (5x104cell per well). 2ndday, the cells were starved with the medium supplemented with 1 % FBS for 16 h. 3rdday, the cells were pretreated with #control Fluorescein or mouse mAb#19 Abs for 1 hour, and then were cells stimulated with TGF-β110 ng / ml for 6 h. Step 2 Fixation and permeabilization slides 1. The slides were washed 4 times with PBS and then fixed in 4% paraformaldehyde (pre-warmed at 37oC) for 30 min at room temperature. 2. After 4 times washing with PBS, the slides were permeabilized in 0.1 % Triton X- 100 in PBS for 10 min. Step 3 PLA staining followed by the instruction of PLA kits [4]. Step 4 Collect images for PLA staining Digital images were taken by using a fluorescence microscope (Axioplan 2, Carl Zeiss) with a digital camera (C4742-95, Hamamatsu), with X40 objective lens (Carl Zeiss MicroImaging). Step 5 Analysis PLA signaling Analysis of in situ PLA signaling for nuclear TβRI-ICD (via detection of HA tag) in complex with p300, was performed using Duolink Image Tool that was specially developed for quantification of PLA signaling. Two positive controls were used in the experiment: TGF-β1 treatment with no antibody and TGF-β1 treatment plus #control Fluorescein at 200 nM. The two positive controls had the same level of in situ PLA signal. The value is presented as No mAb#19 0 nM. Negative control used in this experiment: A9-cells without treatment, but with all the staining Abs, to control the staining background. Concentration dependent inhibition of translocation of TβRI-ICD to the nucleus is shown in Fig. 6. Relative values for nuclear TβRI-ICD (as visualized by in situ PLA) in PC3U cell treated with TGFβ1 and different concentrations of mouse mAb#19 is shown. Data shows the percent of control (= TGFβ treated cells; TGFβ1 was purchased from Peprotech Ltd.) after treatment with 6 different concentration of mouse mAb#19, e.g., 12.5, 25, 50, 100, 200, 400 nM respectively. Filled circles shows the average for three measurements, non-filled circles are the individual points from the actual concentration. An isotype specific mouse IgG1; catalog number #MAB001, Clone 11711, Lot number: IX241811A from R&D control at 200 nM (black dot) was used to calculate percent of control value and the individual point are found at the zero point of the concentration curve. From these results, it was concluded that treatment with mouse mAb#19 prevents TGFβ1-induced translocation of TβRI-ICD to the nucleus and exhibit an IC50 of 39 nM. 6.4 Concentration dependent inhibition of TGFβ1-induced invasion of PC-3U cells. Materials and methods: Invasion assay. Invasion assays was performed by using the Matrigel Invasion Chamber (Corning, Cat. 354483). The basement membrane layer of the cell culture inserts was rehydrated in 500 μl serum-free RPMI-1640, and 1×105cells in cell suspensions in 1 % FBS media were seeded into the upper chambers, with or without TGFβ1. The following antibodies were used (mouse mAb#19 from Absolute Antibodies LN T1733A02 and an isotype specific mouse IgG1; catalogue number #MAB001, Clone 11711, Lot number: IX241811A from R&D was used as control). Antibodies were diluted in the media for the upper and lower chamber as following; Lower chamber: Abs were diluted directly in 5 % FBS media at 400 nM, 200 nM, 100 nM, 75 nM, 50 nM, 25 nM, (0,75 ml each well) Upper chamber: dilute Abs in 1 % FBS media at 800 nM, 400 nM, 200 nM, 150 nM, 100 nM, 50 nM, (0,25 ml each well). Note: abs in twofold concentration in the upper chamber at the beginning, and then the same amount of cell suspensions (250 ml) was added. The final concentrations were 400 nM, 200 nM, 100 nM, 75 nM, 50 nM, 25 nM. The media was removed from the inserts. After incubation of the Invasion Chamber for 1 hours at 37 °C with 5 % CO2; cells were the stimulated with TGFβ1 at 10 ng / ml (Peprotech). After 30h with TGFβ stimulation, the non-invading cells was removed by scrubbing and then the inserts were immediately stained with 400 microliter Cell Stain Solution for image and quantification. The stained cells were solved with 200 μl Extraction Solution, and the optic density (OD) value was measured at 560 nM adapted from Mu et al., Nature Comms 2011 [4]. Concentration dependent inhibition of TGFβ-induced invasion of PC- 3U cells treated with TGFβ1 10 ng / ml (purchased from Peprotech Ltd.), for 40h, and different concentrations mouse mAb#19 are shown in Fig. 3. Quantification of cell free area bottom side filter using ImageJscript on brightfield images on the transwell filters. Mean values ± SEM is calculated from three independent experiments. PC3U cells treated with TGFβ alone, together with isotype specific IgG1 (IgG) or non-treated (CNTR), is shown as control. From these results, it was concluded that treatment with mouse mAb#19 prevented TGFβ-induced invasion of PC-3U cells. 6.5 Concentration effect on pSMAD levels was not demonstrated by treatment with Human mA#19; human IgG1 LALA (L234A / L235A) in PC3U cells Immunoblot data for p-Smad2 / total Smad2 shows that treatment with mAb19# did not affect the canonical TGFE-induced phosphorylation of its substrate Smad2. Thus treatment with mAb#19 is selective and does not affect the canonical physiological TGFE-Smad-signaling pathway (see Figure 20). Thus it is likely that treatment with mAb#19 will have less undesired side effects than competitors targeting the TERI- kinase (e.g. Galunisertib or the next generation of TERI-kinase inhibitor). Methods: PC-3U cells were treated with different antibodies or Galunisertib (a small compound inhibitor of kinase activity of TERI / ALK5) in the indicated concentration, with or without TGF-E stimulation for 6 hours. Graphs are means+SEM from three independent experiments. The intensity of immunoblots was measured and the ratio of pSmad2 / total Smad2 are regarded as normalized signal of pSmad2. Student t test, * between different sets of samples (TGF-E-stimulated versus unstimulated cells). ** P < 0.01, *** P <0.001. & within one set of experiments (lily compound treated versus untreated cells). ▲▲ P < 0.01, ▲▲▲ P <0.001. 6.6 In silico prediction of immunogenicity Determination of immunogenicity risk of antibody candidate using an in-silico methodology of counting T-cell epitopes. A central part in the generation of antidrug antibodies (ADA:s) toward mAbs is the presence of T-helper (Th) epitopes in the product. The presence of Th-epitopes and associated risk can be assessed by in silico methods. These methods predict Th-epitopes given the sequence(s) of the product and can be used to rank candidate products by immunogenicity. Both EMA and FDA have guidelines for the systematic investigation of immunogenicity risk [EMA guideline on immunogenicity assessment of therapeutic proteins: Guideline on Immunogenicity assessment of therapeutic proteins], and [EMA Guideline on immunogenicity assessment of monoclonal antibodies intended for in vivo clinical use.: Guideline Mabs in clinical use]. The immunogenicity of the variable heavy and light chains of the antibody mAb#19 were assessed using in silico methods at SciCross AB (https: / / www.scicross.com / ). The in silico method used, scans the candidate sequences for T-cell epitopes. The method has been trained on datasets of known epitopes and scores the likeliness on a normalized scale where a score of 1 corresponds to a very likely T-cell epitope. In general scores in the range between 1-5 are most relevant for ranking candidates. The total number of predicted epitopes for a candidate can then be used as a measure of overall immunogenicity risk. Results The variable heavy chain shows three regions with predicted strong promiscuous T-cell epitopes (binding to several different alleles). In addition to this, the variable heavy chain shows a high number of T-cell epitopes with scores 4-5, i.e., weaker epitopes but still with a relevant score. The mAb#19 variable light chain contains two regions with promiscuous T-cell epitopes. The pattern of many weak T-cell epitopes is not seen in the light chain. Conclusion Both the variable light and heavy chains of mAb#19 were assessed for immunogenicity. Furthermore, the scores for both chains were combined into an overall score. Overall, the light chain does not show a high content of predicted T-cell epitopes. Using in silico methodology, mAb#19 has a signal for potentially inducing antidrug antibodies (ADAs). However, it is ranked similar as Avastin, which is known to have a low immunogenicity in the clinic. Product Score Adalimumab 9.43 Avastin 5.09 mAb#19 4.92 Herceptin 0.00 Table 9. Ranked overall immunogenicity of mAb#19 and three products that are on the market. 6.7 Epitope mapping Epitope mapping of the mouse mAb#19 through sequential substitution of amino acids from position 126 to 133 within the recombinant TGFERI-myc-(His)6 tagged protein. The mouse mAb#19 binds to the recombinant TGFERI ECD stretching from the N- terminal end to amino acid 133. Binding however is abolished against a corresponding slightly shorter recombinant ECD-TGFERI that ends at position 125. The antibody epitope is therefore located within amino acid 126 and 133. The epitope was further restricted by designing recombinant ECDs carrying a sequential amino acid substitution. The single amino acid substitution within the ECD of the recombinant TGFbRI was introduced by usage of the sense primer S-huTERI-NcoI-pOPE in combination with an antisense primer listed in Table 10. The ECD was recombinantly produced as described in Example 1 and purified by usage of Ni-NTA coupled sepharose (GE Healthcare). The concentration of the purified ECD-myc-(His)6 tagged proteins were determined by specific absorbance at 260 nm (Spectrophotometer) and analyzed for purity by a Coomassie stained 12% SDS PAGE gel. The IC50binding affinities of the mouse mAb#19 against the coated recombinant amino acid mutations were assessed by ELISA (1) and binding reactivity against denatured proteins was assessed by immunoblot (2). Table 10: Primer for the introduction of a single amino acid substitution within the SEQ ID No. TGFERI-ECD Primer Nucleotide sequence in antisense 5´->3´ 1 AS-Alk5- ccgatagggatcctggtccagcaatgacagctgcCGCTTCCACAGGACCAAGG 243 L126A-BamHI 2 AS-Alk5- ccgatagggatcctggtccagcaatgacagcACcCAGTTCCACAGGACCAAGG 244 A127G- BamHI 3 AS-Alk5- ccgatagggatcctggtccagcaatgacagccagCAGTTCCACAGGACCAAGG 245 A127L-BamHI 4 AS-Alk5- ccgatagggatcctggtccagcaatgacagcTACCAGTTCCACAGGACC 246 A127V-BamHI 5 AS-Alk5- ccgatagggatcctggtccagcaatgacCAGtgcCAGTTCCACAGGACCAAGG 247 A128L-BamHI 6 AS-Alk5- ccgatagggatcctggtccagcaatgacAACtgcCAGTTCCACAGGACC 248 A128V-BamHI 7 AS-Alk5- ccgatagggatcctggtccagcaatgacAGAtgcCAGTTCCACAGGACC 249 A128S-BamHI 8 AS-Alk5- ccgatagggatcctggtccagcaatgacTTCtgcCAGTTCCACAGGACC 250 A128E-BamHI 9 AS-Alk5- ccgatagggatcctggtccagcaatgacTTTtgcCAGTTCCACAGGACC 251 A128K-BamHI 10 AS-Alk5- ccgatagggatcctggtccagcaatGCCagctgcCAGTTCCACAGG 252 V129G- BamHI 11 AS-Alk5- ccgatagggatcctggtccagcACCgacagctgcCAGTTCCACAGGACC 253 I130G-BamHI 12 AS-Alk5- ccgatagggatcctggtccACCaatgacagctgcCAGTTCCACAGG 254 A131G- BamHI 13 AS-Alk5- ccgatagggatcctggTGCagcaatgacagctgcCAGTTCCACAGG 255 G132A- BamHI 14 AS-Alk5- ccgatagggatccTGCtccagcaatgacagctgcCAGTTCCACAGG 256 P133A-BamHI Nucleotide sequence in sense 5´->3´ S-huTERI- gaatagggccatggcggcgctgctcccgggggcg 257 NcoI-pOPE Table 10: The sense (bottom) and antisense-primer used to introduce single amino acid substitutions within the recombinant extracellular TGFERI domains. Fig. 7 shows the alignment of the C-terminal human and murine Alk5 sequences (aa 101 to 147) derived from the recombinant proteins that were tested for epitope mapping. The single point amino acid mutation in each construct is depicted in bold. The predicted transmembrane region is shown in the box. 6.8. Assessment of the IC50 of the mAb#19 against the mutated TGFbRI-ECDs Concentrations of the recombinant proteins were normalized (5 ng / μl) and titrated for coating on an ELISA-plate. The mouse antibody was incubated over-night and detected with an HRP-conjugated polyclonal goat anti mouse antibody (DAKO, #P0447) and the IC50 determined by non-linear regression fit according to GraphPad Prism9 (inhibitor versus normalized response-variable slope). The ELISA-assay of the mouse mAb#19 against titrated amounts of recombinant TGFbRI mutants are shown in Figs. 8A-C. The amount of coated recombinant protein sufficient to obtain half maximum binding (IC50) was calculated by non-linear regression. Alanine at position 127 (A) was mutated to three amino acids Glycine, Leucine, Valine. Compared to wild type (wt), the affinity was maintained (G) or two- fold deteriorated (L, V). Alanine at position 128 (B) was mutated to the seven amino acids Glycine, Isoleucine, Leucine, Valine, Serine, Glutamic acid, Lysine. Compared to wt, the affinity was maintained (V), (E), improved (K), (L), (S), two-fold deteriorated (I) or abolished (G)-not shown. Alanine at position 131 (C) was mutated to the amino acid Glycine which resulted in a twofold deterioration in affinity. The table in Fig. 8D is a summary of the obtained affinities for the single mutations. Calculations for proteins where the IC50 was not within the (95 %) confidence interval are not depicted in the graphs and marked as n.f. (not feasible) in Fig. 8D (L126A, A128G, V129G, I130G, G132A, P133A). 6.9 Assessment of mAb#19 binding against recombinant ECD proteins by immunoblot Recombinant ECD mutations and wt were separated on an SDS-PAGE gel and stained by PAGE blue to ensure an equal amount of loading. An equivalent gel was blotted on a nitrocellulose membrane (ThermoFisherScientific, iBlot2), blocked with 2 % M-PBS and incubated with the mouse mAb#19 for over-night at 4 °C. Detection was performed with an HRP-conjugated goat antibody (DAKO, #P0447) and ECL substrate (ECL Select Western Blotting Detection Reagent, Cytiva Cat# RPN2235) according to instructions. Binding could be detected against the recombinant ECD wild type (wt) protein (see Fig. 9, Lane 14 & 15 (A); Lane 11 & 12 (B)) and recombinant protein carrying the mutation A127G (Lane 2 A), A127L (Lane 3 A), A127V (Lane 4 A), A128L (Lane 5 A), A128V (Lane 6 A), A128S (Lane 7 A), A128E (Lane 9 A), A128K (Lane 10 A), A128G: (Lane 5 & 6-B), A128I (Lane 7 & 8 B) A131G (Lane 13 A). Binding was abolished towards the mutations L126A (Lane 1 A), V129G (Lane 11 A), I130G (Lane 12 A) and strongly impaired against the mutations G132A (Lane 2 B) and P133A (Lane 3 B). The binding pattern coincides with the results obtained from the IC50 determination. Binding of the mAb#19 could be detected against the ECD substitution A128G if loaded at a higher amount (5μg) (Lane 5 & 6 B). Binding towards the A128G at normalized amount (2.5 μg) was nearly abolished (coinciding with the IC50 results). Recombinant mutations (2.5 μg of each) were separated by SDS-PAGE and stained by Coomassie blue or blotted and immunoblotted with the chimeric mAb#19 followed by detection with HRP-conjugated polyclonal goat anti-mouse antibody as demonstrated in Fig. 9 A and B. Recombinant ECD considered to be bound by the mAb#19 are depicted in bold. Conclusion In order to restrict the epitope of the mAb#19 against the recombinantly TGFERI-ECD, sequential substitution of the amino acids within position 126 and 133 were constructed. The binding of these ECD recombinant mutations and wt towards the mAb#19 were assessed by determination of the IC50concentration and western blot analysis and both methods gave coinciding results. Binding of the mAb#19 was abolished if the substitutions occur at position L126, V129, I130, G132 and P133. Fig.10A shows five amino acids that are involved in the binding of mouse mAb#19 to the target: L126, V129, I130, G132 and P133 (as numbered in SEQ ID NO: 1). Example 7 - Epitope mapping by usage of a synthetic HUMAN TGF BETA RECEPTOR TYPE 1 peptide library. The epitopes of the mAb #19 (chimeric murine) and the mAb #F11 (silenced Fc) were restricted using array screening libraries of human TGFbR1 with synthetic overlapping peptides (Geysen HM, Meloen RH, Barteling (1984). Use of peptide synthesis to probe viral antigens for epitopes to a resolution of a single amino acid. SJ. Proc Natl Acad Sci U S A. 1984 Jul;81(13):3998-4002). To target the linear epitope, the TGFbR1 sequence is converted into a library of overlapping linear peptides directly synthesized on a proprietary solid support called “mini-card”. Thereby, three different libraries with a linear peptide length of 7, 10 and 15 amino acids had been synthesized with an offset of one residue. To further restrict the binding contribution of a particular amino acid at its position, a fourth linear synthetic library had been constructed with a length of 15 amino acids, but with the residue at position 10 replaced by alanine. To target a discontinuous or conformational dependent epitope, conformational epitopes of the TGFBR1 were mimicked using the CLIPS chemistry (Timmerman et al. (2007). Functional reconstruction and synthetic mimicry of a conformational epitope using CLIPSTM technology. J. Mol. Recognit. 20:283–299). Four human TGFBR1 derived libraries had been constructed: (1) for the constrained peptide length of 10, 8-mers peptides with an offset of one residue were incorporated on position 2-9. Cysteine residues were inserted on positions 1 and 10 and joined by mP2 CLIPS in order to create a loop mimic. Native Cysteines are replaced by Cys-acm. (2) in analogy, for constrained peptides of length 17, 15-mer peptides with an offset of one residue were incorporated on position 2-16. Cysteine residues were inserted on positions 1 and 17 and joined by mP2 CLIPS in order to create a loop mimic. (3) a library that mimics a β-turn peptide with a length of 20 had been constructed. 18-mer peptides with an offset of one residue were incorporated on positions 2 – 19. Residues on positions 10 and 11 were replaced by “PG” motif in order to induce the β-turn formation. Cysteine residues were inserted on positions 1 and 20 and joined by mP2 CLIPS in order to stabilize the mimic. Native Cysteines are replaced by Cys-acm. (4) a library that mimics α-helical peptide with a length of 19 and an offset of one residue had been constructed. Cysteines are inserted on positions 1 and 5 and joined by means of mP2 CLIPS to nucleate an α-helical structure. Native Cysteines are replaced by Cys- acm. Chips were blocked and incorporated with the respective antibodies over-night at 4°C. As control of unspecific binding, a murine antibody against fluorescein and Pavilizumab, an Fc-silenced, fully human antibody had been used for mAb19 and F11 respectively. Binding of antibodies is quantified using an automated ELISA-type read-out. A binding event was only noted if multiple overlapping peaks were present within this binding region. Putative core epitopes were identified from adjacent peptides with similar or maximally 30% lower intensity as the top peak within a binding region. Example 8 – Pharmacokinetic data Material and Methods Analytical work Concentration of the mAb#19 was determined using surrogate peptide approach, where concentration of the protein is quantified based on LC / MS / MS quantitation of unique proteolytic peptides. Target protein was enriched from plasma sample using protein G and digested with trypsin. Unique heavy chain peptide ASQSISSYLNWYQQKPGK (SEQ ID NO: 258) was used for quantitation, while three other peptides from both light (NTLYLQMNSLR (SEQ ID NO: 259) and EVQLLESGGGLVQPGGSLR (SEQ ID NO: 260)) and heavy (LLIYAASSLQSGVPSR (SEQ ID NO: 261)) chains were used as confirmatory peptides. Trastuzumab and its unique peptide VVSVLTVLHQDWLNGK was used as an internal standard to correct variations in the measurement process. Sample preparation IgG was purified from mouse plasma using protein G paramagnetic beads on KingFisher Flex purification system (Thermo Fisher Scientific, Vantaa, Finland). A minor modification to protocol used in study ADM-18-1965b was an upgrade of the instrument magnetic head to more suitable for processing standard and deep well plates. Due to the magnetic head change, there was an increase in sample processing volume (incubation and washings) from 200 μl to 500 μl. Briefly, 20 μl of plasma samples and 20 μl of internal standard (trastuzumab, 20 μg / ml) were diluted with phosphate buffered saline to final volume of 500 μl. Protein G beads (50 μl of 10 % slurry) were washed with 500 μl of PBS and incubated with diluted sample for 60 minutes. Beads were washed three times in 500 μl of PBS and IgG was eluted from the beads in 100 μl of 0.5 M acetic acid. Finally, 80 μl of the eluted fraction was dried on SPD111 vacuum concentrator (Thermo Fisher Scientific). Samples were processed as undiluted and diluted 5-fold (1+4) with commercial blank mouse plasma. For surrogate peptide analysis the purified IgG was digested with trypsin. Briefly, 20 μl of denaturing solution (8 M urea, 50 mM Tris-HCl, 20 mM dithiothreitol, pH 7.5) was added to dried sample and incubated in 37 °C for 60 min. Freshly diluted iodoacetamide (4 μl, 0.27 M in water) was added to final concentration of 45 mM and samples were incubated for 30 min at room temperature. Sample was diluted with 0.25 M Tris-HCl (pH 7.5) to 110 μl and 0.5 μg of trypsin (trypsin to protein ratio 1:40) was added in 10 μl of 1 mM HCl. Sample was digested overnight at 37 °C and acidified with 10 μl of 10 % formic acid prior analysis with LC-MS. All incubations were done in a thermomixer with 500 rpm. Standard plasma samples were prepared by spiking the pure standard to blank CD1 mouse plasma to obtain concentrations from 0.122 to 250 μg / ml in plasma by using one volume of spiking solution and nine volumes of plasma. Similarly, quality control (QC) samples were prepared in plasma for concentrations at 1.6, 8.0, 40 and 200 μg / ml. Standards and controls were then prepared for analysis in the same way as the samples. Pharmacokinetic analysis The pharmacokinetic parameters were calculated using Phoenix 64 (Build 6.4.0.768) WinNonlin (version 6.4) software, using non-compartmental methods (NCA). The doses reported by the sponsor were used for all animals. The terminal phase half-life (T1 / 2) was calculated by least-squares regression analysis of the terminal linear part of the log concentration–time curve. The area under the plasma concentration–time curve (AUC) was determined with the linear trapezoidal rule for increasing values and log trapezoidal rule for decreasing values up to the last measurable concentration (AUC0-last), and extrapolation of the terminal elimination phase to infinity (to calculate AUC0-infinity) was used when possible; the following criteria were used: x Minimum of 3 points (not including Cmax) used to calculate lambda (with R2 adjusted >0.85) x T1 / 2 shorter than the time-span used to calculate lambda x AUClast-infinity < 20% of AUC0-infinity The maximum plasma concentration (Cmax) and the time to reach Cmax (tmax) were derived directly from the plasma concentration data. Results Analysis of plasma samples The analytical method performance during the sample analysis is shown in Appendix I. The results obtained from each individual analyzed sample are given in Appendix II (dose 50 mg / ml) and Appendix III (dose 10 mg / ml, data from Mannila 2019, ADM-18- 1965c). Concentration of the mAb#19 was determined using surrogate peptide approach developed earlier. Peptide ASQSISSYLNWYQQKPGK from antibody heavy chain was used for quantitation while three other peptides (heavy chain: LLIYAASSLQSGVPSR, light chain: NTLYLQMNSLR and EVQLLESGGGLVQPGGSLR) were used as confirmative peptides. Good correlation with the confirmatory peptides against the ASQS peptide was observed (NTLY r2=0.944, LLIY r2=0.945 and EVQL r2=0.991). The on-study method performance (intra-assay accuracy & precision and range) was evaluated using back-calculated data from the standard samples as well as plasma spiked QC samples. For the standards accuracy target is ± 20 % (± 30 % at limit of quantitation). For the QC samples ≥ 67 % should be within ± 20 % of nominal. Precision target is ≤ 20 %. Acceptable accuracy (standards 87.5-112.2%, 118.1 % at LOQ), controls 71.6 - 112.2 % (87.5% within 20 % of nominal), precision (10.2 %) and range (0.12 – 250 μg / ml) was observed. Concentrations on all three analyzed blank Foxn1nu mice plasma samples were below limit of detection. mAb#19 concentrations were calculated from the diluted samples (multiplying the result with the dilution factor) as results of the undiluted samples taken between 2 and 72 hours were over the upper limit of quantitation. All results obtained with diluted samples were in the measurement range. Results obtained with the diluted and undiluted samples between timepoints 216 and 1176 hours were compared. Good linearity of dilution was observed (mean bias -0.6 μg / ml, slope 0.987, intercept 0.841, r2=0.992). Appendix I - Analytical method performance Compound Monoclonal antibody 19 Surrogate peptide ASQSISSYLNWYQQKPGK Detection limit (ng / ml) 0.08 Quantitation limit (ng / ml) 0.12 Fit range (ng / ml) 0.12 – 250 R2 >0.994 Standard Concentration Accuracy % (n=2) (ng / ml) 0.12 118.1 0.24 106.2 0.49 112.2 0.98 81.0 1.95 101.4 3.91 100.9 7.81 90.7 15.6 87.5 31.3 96.5 62.5 101.7 125 106.1 250 98.1 Snedecor-precision* (%) 10.2 QC Concentration (μg / ml) Accuracy % 1.6 (QC) 71.6 1.6 (QC) 112.2 8.0 (QC) 91.2 8.0 (QC) 95.1 40 (QC) 86.3 40 (QC) 90.0 200 (QC) 90.0 200 (QC) 97.0 Appendix II - Measured concentrations of monoclonal antibody 19 in mouse plasma after i.v administration at 50 mg / kg. Sample Sample Time Concentration Mean plasma SD ID (h) (μg / ml) concentration (μg / ml) (μg / ml) 1A 2 3072A 2 452362 78.13A 2 328 4A 4 4205A 4 460448 24.66A 4 464 7A 8 4538A 8 407420 28.59A 8 400 10A 24 29811A 24 394348 48.312A 24 352 13A 72 24914A 72 283290 44.415A 72 337 16A 216 18117A 216 179174 9.9318A 216 163 19A 504 11420A 504 145138 21.621A 504 156 22A 1176 30.923A 1176 22.624.6 5.5724A 1176 20.3 104-10A Blank <LOD106-1A Blank <LOD- -106-3A Blank <LOD <LOD: below detection limit Appendix III - Measured concentrations of monoclonal antibody 19 in mouse plasma after i.p. administration at 10 mg / kg. Pharmacokinetic analysis The mean (±SD) plasma concentration vs. time profiles for mAb#19 for 72 and fulltime study are shown in Figs. 11A and 11B, respectively. Calculated pharmacokinetic parameters are displayed in Table 11. The measured plasma concentrations are given in Appendix II and Appendix III. After i.p. administration of mAb#19 at 10 mg / kg, plasma concentrations peaked at 8 h post-dose with Cmax of 94.4 μg / ml, AUClast of 21700 h*μg / ml and the mean half-life of 354 h. After i.p. administration at 50 mg / kg, plasma concentrations peaked at 4 h post-dose with Cmax of 448 μg / ml, AUClast of 158 000 h*μg / ml and the mean half-life of 315 h. After administration at 10 and 50 mg / kg, the values for Cmax / Dose were 9.44 and 8.96 μg / ml suggesting that the increase in exposure is proportional to the dose. Dose proportionality is supported by the fact that the respective values for AUC0-last / Dose were somewhat consistent at 2170 and 3150 h*μg / ml. Furthermore, the fact that the half-lives were comparable between the dose levels, suggests that the pharmacokinetics are not dose dependent. Estimate Group Parameter Unit 10 50 R2(adjusted) - 0.93 0.97 Number of points - 5 5 (lambda_z) Lambda zlowerh 48.0 24.0 Lambda zupperh 504 1176 T1 / 2 h 354 315 Tmax h 8.00 4.00 Cmaxμg / ml 94.3 448 Cmax / Dose kg*μg / ml / mg 9.43 8.96 Tlast h 504 1180 Clast μg / ml 23.3 24.6 AUC0-last h*μg / ml 21 700 158000 AUC0-last / Dose h*kg*μg / ml / mg 2170 3 150 AUC0-infinityh*μg / ml c.n.c.* 169000 AUC0-infinity / Dose h*kg*μg / ml / mg c.n.c.* 3 370 AUClast-infinity % 35.4* 6.61 Table 11. The calculated pharmacokinetic parameters for mAb#19 after i.p. administration to athymic nude Foxn1nu mice (n=3 per time point) at nominal dose levels of 10 and 50 mg / kg. *due to the high value for AUClast-infinity, data could not be extrapolated to infinity and, thus, values for AUC0-infinityand AUC0-infinity / Dose could not be reliably calculated. Summary Monoclonal antibody #19 (mAb#19) was administered to athymic nude Foxn1nu mice via the intraperitoneal (i.p.) at 10 and 50 mg / kg and plasma samples collected after dosing were analyzed using LC-MS / MS. After i.p. administration at 10 mg / kg, the apparent Cmax of 94.3 μg / ml was achieved 8 hours post-dose and the value for AUClastwas 21700 h*μg / ml. Half-life of the apparent terminal phase was 354 h. After i.p. administration at 50 mg / kg, the apparent Cmaxof 448 μg / ml was achieved 4 hours post-dose and the value for AUClastwas 158 000 h*μg / ml. Half-life of the apparent terminal phase was 315 h. After administration at 10 and 50 mg / kg, the values for Cmax / Dose were 9.43 and 8.96 μg / ml suggesting that the increase in exposure is proportional to the dose. Furthermore, the fact that the half-lives were comparable between the dose levels, suggests that the pharmacokinetics are dose-independent. Example 9 – Proof of concept study mIgG1 Mouse antibody #19 in vivo study (Ethical approval: Dnr A7-18). Repeated intraperitoneal (i.p.) administration of mAb#19 to human PC3U xenografted athymic nude mice: Effects on tumour size, TERI-ICD levels and invasiveness was determined. To evaluate the effect of mAb#19 on tumour size, invasiveness and TβRI-ICD levels in male athymic nude mice grafted with human PC3U cells to ventral prostate after i.p. administration twice weekly for 30 days. Materials and methods Animals: Male Hsd:Athymic Nude-foxn 1 nu mice, grafted with human PC3U cells to ventral prostate, 5-6 weeks old, weighing 25-30 g (purchased from Harlan Laboratories, inc.) mAb#19 and isotype specific control ab from Absolute Antibodies. Vehicle: Phosphate buffered saline (PBS) Isotype control: IgG1; Anti-Fluorescein [4-4-20 enhanced Ab 00102-10.16 mouse IgG1 LALA, kappa), 50 mg / kg x i.p. injections twice weekly for 30 days with 50 mg / kg and 10 mg / kg of mAb, volume: 10 ml / kg. The mice were sacrificed 72 hrs after the last dose on the 30th day after the start of administration. x The tumour weight / size, invasion, metastasis, effects on nuclear TβRI-ICD by in situ PLA, as well as antibody concentration in plasma (determined by Admescope). Gr. Compound Dose Route Days of Time of Number administration termination of animals No. (mg / kg) 1 Vehicle --- i.p. 30 days, i.p. 72 hrs after 15 last dose 2 Isotype 50 i.p. 30 days, i.p. 72 hrs after 15 control (IgG1) last dose 3 mAb#19 50 i.p. 30 days, i.p. 72 hrs after 17* last dose 4 mAb#19 10 i.p. 30 days, i.p. 72 hrs after 17* last dose Table 12. Experimental Groups. * Two satellite animals per dosing group (Satellite animals are extra animals dosed as per protocol but not subjected to toxicological and pathological observations and tests.) Experimental procedures Animals: 64 male Hsd:Athymic Nude-foxn 1 nu mice 5-6 weeks old from Harlan are used in the study. The mice are injected with human PC3U cells to the ventral prostate 7 days prior to compound administration. The mice were randomized into different cages before study start and kept in conventional housing and fed standard rodent chew (CRM; 801730, from special diets services; SDS) and tap water ad libitum. During the study, observation of animal health is performed. Ethical approval: Dnr A7-18. Administration of drug: The mice are weighed and a dose of vehicle (10 mL / kg, i.p.), isotype control (50 mg / kg, i.p.) or mAb#19 (50 or 10 mg / kg, 10 mL / kg, i.p.) was administered twice weekly for 30 days. The formulation is made fresh daily and stirred well before administration. Endotoxin-levels in the formulations have been monitored prior to administration. No loading dose was used. Blood sampling: Blood was sampled at 72 hours after the last dose. Blood was withdrawn from anaesthetized mice by heart puncture into pre-labelled and pre-chilled microtainer tubes containing EDTA. Blood samples are immediately put on ice prior to centrifugation. It is important that the exact sampling times are recorded. Plasma is prepared by centrifugation for 10 minutes at approximately 3000 g at +4 °C within 20 minutes from sampling. The plasma was transferred to pre-chilled polypropylene tubes, 50 μL and then transferred to 1.4 ml Thermo Screenmate tubes. The tubes were immediately frozen on dry ice and stored frozen at -70 °C. The 1.4 ml PK-sampling of satellite animals: In order to get information about the PK-profile, there was two satellite animals per dosing groups. Blood samples was taken from tail vein 8 hours (or 4 hrs) after administration on the first day of dosing (two animals per dosing group). Moreover, blood samples are taken: -1 h (or 30 min) before second dose -1 h (or 30 min) before dose No. 6 -8 h after dose No. 6 (or 4 h if more practically). The results are shown in Figs 12A-D. Effects on tumor growth (A) and lymph node metastases (B) upon treatment with mouse-mAb#19 in a human PC3U orthotopic prostate cancer model [6]. 2 x 105PC3U cells were injected into the ventral prostate of athymic nude mice. One week later, mice were injected intraperitoneally (i.p.) with vehicle PBS, isotype-specific control mAb IgG (anti-Fluorescein 50 mg / kg), mouse- mAb#19 (10 mg / kg) or mouse-mAb#19 (50 mg / kg) twice a week for a period of 4 weeks (in total 8 times). Tumors were collected and weighed after 30 days and shows that the tumor-weights and areas of both treatment groups with mouse-mAb#19 at 10 mg / kg and 50 mg / kg are significantly lower when compared with vehicle group (P <0.05 ^). In addition, tumors derived from mice treated with mouse-mAb#19 at 50 mg / kg are significantly smaller than those treated with the same amount of isotype- specific control mAb IgG150 mg / kg. No significant difference of tumor weight is found between treatment with the mouse-mAb#19 at 10 mg / kg and the control mAb IgG1 group at 50 mg / kg. Figures 12C and 12D shows that the tumor and lymph node areas of both treatment groups with mouse-mAb#19 at 10 mg / kg and 50 mg / kg are significantly lower when compared with vehicle group and isotype-specific control mAb IgG150 mg / kg (P <0.02 ^^, P <0.001 ^^^). In addition, lymph derived from mice treated with mouse- mAb#19 at 50 mg / kg are significantly smaller than those treated with the same amount of isotype-specific control mAb IgG1 50 mg / kg. No significant difference of tumor weights is found between treatment with the mouse-mAb#19 at 10 mg / kg and the control mAb IgG1 group at 50 mg / kg. Histology sections from tumor tissues and regional lymph nodes are shown in Fig. 13 A and B, respectively. In situ PLA was used to visualize nuclear complex formation of endogenous TGFβRI- ICD (via detection of HA tag) and p300 (detected by anti-HA and p300 (R&D. Cat. AF3789), respectively) in histology sections from tumour tissues treated with PBS (blank control), isotype control IgG1 mAb (#anti-Fluorescein) at 50 mg / kg or two concentrations of mouse-mAb#19 (10 mg / kg and 50 mg / kg). Fig. 14A shows representative in situ PLA data for endogenous nuclear TERI-ICD (via detection of HA tag) in complex with endogenous p300; and Fig. 14B shows numeric representation of analyses of tissue sections: Complex formation is statistically reduced upon treatment with the mouse-mAb#19 at 50 mg / kg, in comparison to vehicle control or treatment with isotype control IgG1 at 50 mg / kg. ** p<0.01, *** p<0.001 students T-test. The Plasma concentrations of mouse-mAb#19 in blood measured by Mass Spectroscopy (Admescope®, Finland) is shown in Fig. 15. Blood was sampled at 72 hours after the last dose in prechilled EDTA tubes. Analysis of the gain of body weight in mice with tumor burden by measuring the mouse’s gross weight during treatment period is shown in Fig. 16. Bar graph shows the mean ± S.E.M. from vehicle group (n = 14), isotype specific control (n = 11), mouse-mAb#1910 mg / kg (n=13) and mouse- mAb#19 50 mg / kg (n=12). Example 10 - Mouse mAb#19 binding to endogenous target analyzed by FACS Material and methods Human PC3-U cells were incubated in a human Fc block / viability dye solution for 10 min on ice. After wash, cells were fixed and permeabilized for 20 min on ice after which they were stained with mouse mAb#19 or isotype-specific IgG1 control mouse #4-4- 20 antibodies at different concentrations (100, 30, 10, 3, 1, 0.3, 0.1, 0.03, 0.01 and 0.003 μg / ml) for 30 min on ice. After wash, cells were incubated with PE conjugated goat anti-mouse IgG secondary antibody solution for 30 min on ice. A CytoFlex (Beckman Coulter) was used for analyses. Graphs show MFI (PE) signal from mouse mAb#19 antibody on live single cells minus the MFI (PE) signal from isotype-specific control antibodies (#4-4-20; #anti- Fluorescein) at different concentrations (nM) (Fig. 17A and B). Binding of mAb#19 on endogenous target in PC-3U and RWPE cells analyzed by FACS is shown in Fig. 17A and B, respectively. PC-3U (A) and RWPE (B) cells were incubated in a human Fc block / viability dye solution for 10 min on ice. After wash, cells were fixed and permeabilized for 20 min on ice after which they were stained with mouse-mAb#19 or ctrl#4-4-20 antibodies at different concentrations (100, 30, 10, 3, 1, 0.3, 0.1, 0.03, 0.01 and 0.003 μg / ml) for 30 min on ice. After wash, cells were incubated with PE- conjugated goat anti-mouse IgG secondary antibody solution for 30 min on ice. Analysis was made on CytoFlex (Beckman Coulter). Graphs show MFI (PE) signal from mAb#19 on live single cells minus the MFI (PE) signal from ctrl at different concentrations (nM). Analyses were performed at Truly Translational. From these results it was concluded that mAb#19 binds to its target i.e., endogenous TβRI, in PC3U and RPWE cells with a Kd of 10.70 (A) and 7.81 nM (B), respectively (Figure 17). Example 11 – Determination of IC50: Comparison human mAb#19 LALA-IgG1 versus mouse mAb#19 IgG1 Determination of IC50: The IC50, the concentration sufficient to achieve 50 % of maximum binding, was determined by ELISA. Recombinant human TGFERI ECD 133-myc-(His)6 was coated on a Nunc ELISA plate (Maxisorp, #439454, ThermoScientific, USA) at 500 ng / well (over- night at 4 °C in 0.1 M Na2CO3buffer pH 9.6) and blocked with 2 % Milk-PBS (1 hour at RT). Serial dilution of the mouse or human mAb#19 were incubated over-night at 4 °C. Bound antibody was detected with an HRP-conjugated polyclonal goat anti mouse antibody (DAKO. #P0447) or HRP-conjugated polyclonal rabbit anti-human antibody (DAKO, #P0212) respectively. The TMB-color formation was blocked by addition of H2SO4 (after approximately 30 seconds), and absorbance measured at 450 nm. The ELISA plate was washed three times with T-PBS after each incubation step. For calculation of the IC50, the concentration sufficient to obtain 50% saturation, the maximum and minimal values were set to 100 and 0 % respectively and a non-linear regression was modelled (Prism 7, GraphPad, USA). The option “inhibitor versus normalized response” with a variable slope was chosen for the IC50 calculation. Fig. 18 shows IC50determination of the mouse mAb#19 (A) and the fully human mAb#19 (B) against recombinant human TGFERI ECD-133-myc-(His)6protein. The IC50 value (% of maximal binding) of both mAb#19 versions are found to be very similar in the sub-nanomolar range, also summarized in Table 13. mAb#19 format Human TGFbR1-ECD-133-myc(His)6A: chimeric IgG1 0.104 nM B: human IgG1-LALA 0.139 nM Table 13 - IC50 determination of the mouse mAb#19 (A) and the fully human mAb#19 (B) against recombinant human TGFERI ECD-133-myc-(His)6protein. Material and Methods A9 PC3U cells described under section 6.3 which where reconstituted with TGFβRI-HA tag (in C-terminal part of the protein).hu-mAb#19 LALA-IgG1 and mouse-mAb#19 has been described above. In situ PLA technique and antibodies, imaging used as described above. Cell culture condition as described above. In short, the hu-mAb#19 LALA- IgG1 and mouse-mAb#19 shows very similar biophysical characteristics as demonstrated in Figs 20A and B, respectively. Relative values for nuclear TβRI-ICD (as visualized by in situ PLA) in PC3U cells treated with TGFβ1 and different concentrations of Ab#19 are shown. PLA was performed in HA-ALK5 reconstituted A9 (PC3U ALK5- / -) cells using rabbit anti HA-pAb and mouse anti p300 for detection. Treatment with isotype control at same concentrations did not affect translocation of TβRI-ICD to the nucleus. The functionality of hu-mAb#19 and mouse-mAb#19, and their respective control antibodies, was investigated and compared in established cell- based assays (nuclear HA-tagged TβRI-ICD in complex with endogenous p300 in A9 cells) and as described under section 6.3 above. This method was used to investigate the effect of the drug on nuclear TβRI-ICD in complex with the transcriptional co- regulator p300 (this complex was initially described by the inventors in [4]. As shown in Fig. 19, the inventors observed that both antibodies function well with IC5045 nM for the hu-mAb#19 (A) and IC5042 nM for the mouse-mAb#19 (B). From these data it was concluded that the hu-mAb#19 LALA- IgG1 and mouse- mAb#19 shows very similar biophysical characteristics as demonstrated above. Example 12 – mouse-mAb #19 binding to endogenous target analyzed by FACS Material and methods Human PC3-U cells were incubated in a human Fc block / viability dye solution for 10 min on ice. After wash, cells were fixed and permeabilized for 20 min on ice after which they were stained with mouse mAb#19 or isotype-specific IgG1 control mouse #4-4- 20 antibodies at different concentrations (100, 30, 10, 3, 1, 0.3, 0.1, 0.03, 0.01 and 0.003 μg / ml) for 30 min on ice. After wash, cells were incubated with PE conjugated goat anti-mouse IgG secondary antibody solution for 30 min on ice. A CytoFlex (Beckman Coulter) was used for analyses. Graphs show MFI (PE) signal from mouse- mAb#19 antibody on live single cells minus the MFI (PE) signal from isotype-specific control antibodies (#4-4-20; #anti-Fluorescein) at different concentrations (nM) (Figures 17A and 17B). Example 13 – Affinity maturation of mAb19 YUMAB, GmbH, (Braunschweig, Germany) generated affinity maturated antibodies utilizing mAb#19 as the parental template antibody (cAb 1114-1.1), provided by MetaCurUm Biotech AB. The parental mAb#19 was expressed as a soluble phage- and Fab- fragment in order to test the feasibility in the applied selection system. The VH and VL genes of mAb#19 had been synthesized and cloned into the YUMAB phagemid- vector as a Fab format. The Fab fragment was then packaged as a phage particle and as well as a soluble Fab antibody in E. coli for an antigen binding test in ELISA. Hereby, the antigen target antigen used was recombinant hu-extracellular domain (ECD)-133- huFc and hu-ECD 133-myc(His)6. The parental antibody Fc regions were modelled in order to determine surface CDR residues possibly implicated in binding target. Thereby, the most similar template from databases had been screened and used for grafting the parental CDR’s, followed by a de novo modelling of the HCDR3. The amino acids predicted to be most important for binding had been consequently selected for being mutated, resulting in the selection of 18 positions in the VH- (HCDR1, HCDR2 and HCDR3) and 12 positions in VK- domain (LCDR1, LCDR2 and LCDR3). Next, a NGS library of 1-2 x 106IgG sequences for each germline was investigated for amino acid usage at each position and degenerated codons for each position were selected under following considerations: (a) wt amino acids and amino acids with a higher or equal frequency of 0.1 % were included, (b) Usage of C, M, N and W was avoided / reduced, (c) in average, 12 amino acids at each position, and (d) 4 mutations in VH or VK were allowed. Primers were designed based on the selected degenerated codons and overlap extension PCR was used to introduce mutations in all CDRs. The mutated VH / VL genes were cloned into YUMAB’s phagemid vector and 3 libraries had been in total generated: VHmut / VLmut, VHwt / VLmut, VHmut / VLwt. A quality control of each library was performed with 24 randomly picked colonies by analyzing the PCR-amplified insert for the expected size and Sanger-sequencing. Overall, the size of the libraries showed in average 78 % functional clones with an overall size of 14 x 108colony forming units (cfu). The VHmut / VLmut, VHwt / VLmut, VHmut / VLwtlibraries were packaged in phages and revealed to have a size of 2.1x, 1.7x and 1.8 x 1012phage-particles / ml respectively. Affinity driven in vitro selection (panning) was performed by using four variable strategies with increasing stringency by antigen limitation and competition in the second panning round. The first panning round was performed in presence of Strept beads as well as human Fc, huAlk1-mFc, huAlk4-mFc and huAlk7-mFc for negative and biotinylated huTGFER1-huFc at 50 nM for positive selection. The second panning round was performed in presence of biotinylated huTGFER1-huFc at 50 nM, 5 nM, 0.5 nM and 0.05 nM for strategy 1 to 4 respectively in presence of huTGFER1-huFc at 500 nM for binding competition. Next, 384 soluble Fab-antibodies from each strategy were expressed in soluble form and screened for ELISA binding against four different antigens: 1. huTGFER1-huFc (pos.); 2. human Fc (neg.); 3. huAlk1-mFc (neg.); 4. huAlk4-mFc (neg.). A positive hit was defined if the ELISA binding signal to the positive antigen was larger than 0.1, whereas the signal to the negative antigen was smaller than 0.1. Furthermore, the S / N ratio between positive and negative antigen had to be larger than 3. On average, 514 binding clones had been identified, giving a positive hit of around 33 %.96 clones with the best S / N ratio from each strategy had been sequenced resulting in 253 unique mutated antibodies in total. 192 unique Fab fragments were expressed and their affinity was measured by BLI (Biolayer Interferometry) by immobilization of biotinylated huECD-133-huFc onto Streptavidin sensors. Clones were ranked according to their lowest Koff-rate and the best 25 candidates were converted into fully IgG1 for mammalian expression. Fully IgGs were purified by Protein A chromatography and quality controlled by reducing SDS-PAGE and UV / VIS. Ranking of the expressed IgGs was performed by (a) determination of the EC50 by ELISA using the ECD-huFc as coated antigen and (b) BLI affinity measurement by Protein A immobilization of the IgG candidate and using huECD-133-myc(His)6 as an analyte in concentration ranging from 500 to 0.5 nM. Compared to the parental antibody, the EC50 value was improved for 24 of the tested IgGs, with a maximum decrease of factor 6. In the affinity ranking, the top 10 antibodies show quite similar EC50 values with an approximate affinity increase of at least two times. The best antibody showed an affinity increase of factor 3. The best 5 IgG candidates were further tested in an ELISA for unspecific binding on representative biomolecules. Thereby, DNA, LPS, Lysozyme and mammalian cell lysate were coated on the ELISA plates and bound antibodies were detected with antibodies directed against human Fc. All candidates showed a binding ratio in the range of 0.9 to 1.7 compared to Palivizumab, a human IgG with silenced Fc that had been used as a negative control (data not shown). Example 14 - Flow cytometry evaluation of human affinity maturated antibody 19 variants Methods: PC3-U adherent cells were stained for expression of TGFERI with affinity matured antibody candidates detected using a PE-conjugated anti-human IgG antibody. Flow cytometry analysis of TGFERI staining in PC3U cells was used as a first evaluation method for antibody candidates. Effective concentration 50% (EC50) and dissociation constant (Kd) were used to evaluate the antibodies affinities. To test antibody stability, candidate antibodies were kept at 45qC for 48h and 168h, subsequently their biding efficiency to TGFERI in PC3U cells was evaluated by flow cytometry. Results 24 maturated antibodies were chosen for further selection of a top candidate. Flow cytometry staining of TGFβRI in PC3U cells was used as an evaluation method of antibodies affinity. After first experiment, based on EC50- and Kd-values (see Table 14), 14 antibody candidates were selected. The second validation allowed to select top 5 candidates to be further tested for antibody stability (see Table 15, Figure 21A and 21B): YU772-G12 (EC50=3,9 Kd=2,8), YU772-D10 (EC50=3,5 Kd=2,6), YU771-B12 (EC50=3,6 Kd=1,8), YU772-F11 (EC50=0,4 Kd=0,4) and YU772-G04-VH YU771-A09-VL (EC50=2,2 Kd=2,0). Antibody stability test was performed over 7 days, when selected antibodies were kept either at 45qC or 4qC (controls). After 48h and 168h, flow cytometry staining of TGFbRI in PC3U cells was performed and antibodies were evaluated by their EC50- and Kd- values (see Table 16 and 17). YU772-F11 antibody was chosen as the best antibody candidate when considering both affinity and stability. Table 14. Kd and EC50-values of selected antibody candidates. Best antibody candidates chosen for follow up studies are marked in bold and with *: Increase Increase Increase EC50 relative to relative to relative t ° Kd clone #191° Max M o clone #191 FI clone #191° run run run YU771-A01* 1,5 1,6 1,0 2,7 560864,00 0,9 YU771-B12* 1,6 1,5 1,0 2,8 1118838,00 1,9 YU771-C02 1,8 1,4 1,6 1,6 527798,00 0,9 YU771-D07* 1,4 1,7 1,2 2,2 400781,00 0,7 YU771-E01* 1,8 1,4 1,7 1,5 367063,00 0,6 YU771-F05 2,2 1,1 2,1 1,2 211130,00 0,4 YU771-F10 3,2 0,8 3,2 0,8 408616,00 0,7 YU771-GO2 2,7 0,9 2,5 1,1 772466,00 1,3 YU771-G03 1,7 1,4 1,7 1,6 862609,00 1,4 YU772-A04 1,6 1,5 1,7 1,6 276824,00 0,5 YU772-A11* 1,8 1,4 1,7 1,6 491394,00 0,8 YU772-C01 2,3 1,1 2,6 1,0 142914,00 0,2 YU772-D10* 1,0 2,4 1,0 2,6 487729,00 0,8 YU772-F11* 0,8 2,9 0,7 3,7 1919159,00 3,2 YU772-G04 1,6 1,5 1,6 1,7 359465,00 0,6 YU772-G12* 1,3 1,9 1,2 2,2 804661,00 1,3 YU772-H05* 1,6 1,5 1,3 2,0 443482,00 0,7 YU773-E05* 1,6 1,5 1,3 2,0 623758,00 1,0 YU774-H01* 1,8 1,4 1,7 1,6 906948,00 1,5 YU774-H11 1,0 2,5 0,9 3,1 71994,00 0,1 YU772-G04- VH YU771- A09-VL* 1,3 1,8 1,1 2,4 1265129,00 2,1 YU774-H11 VH-YU772- C01 VL 3,0 0,8 2,9 0,9 281027,00 0,5 YU771-G11 VH-YU772- C01 VL* 1,4 1,7 1,3 2,0 968885,00 1,6 aver average age average Max EC50 Kd MFI Clone 19 2,4 2,7 600082,00 Best antibody candidates in this study Table 15 Kd and EC50-values of selected antibody candidates. Best antibody candidates chosen for follow up studies are marked in bold and with *: EC50relative torelative to relative to clone #19 Kd clone #19Max MFIclone #19 YU771-A01 3,9 1,3 4,3 1,3 299023 0,5 YU771-B12* 3,6 1,5 1,8 3,0 715986 1,1 YU771-D07 8,9 0,6 9,7 0,6 500000 0,8 YU771-E01 5,9 0,9 5,8 1,0 306426 0,5 YU772-A11 3,7 1,4 3,5 1,6 418353 0,6 YU772-D10* 3,5 1,5 2,6 2,1 607668 0,9 YU772-F11* 0,4 12,3 0,4 12,4 1272431 2,0 YU772-G12* 3,9 1,3 2,8 2,0 1034977 1,6 YU772-H05 4,9 1,1 3,5 1,6 525737 0,8 YU773-E05 3,6 1,4 2,7 2,0 442369 0,7 YU774-H01 25,9 0,2 9,8 0,6 2806628 4,3 YU772-G04- VH YU771- A09-VL* 2,2 2,4 2,0 2,7 1165597 1,8 YU771-G11 VH-YU772- C01 VL 3,8 1,4 3,7 1,5 613051 0,9 YU772-D10 VH-YU772- C01 VL 4,0 1,3 3,9 1,4 1026743 1,6 average average EC50 average Kd Max MFI Clone 19 5,2 5,5 646460 *Best antibody candidates in this study Table 16. Kd and EC50-values of selected antibody candidates kept for 48h either at 45qC or 4qC (controls). Best antibody candidate chosen for follow up studies is marked in bold and with *: 48h EC50relative torelative to relative to clone #19 Kd clone #19Max MFIclone #19 YU772-G12_4C 5,6 1,5 3,7 2,0 600000 0,8 YU772-G12_45C 4,9 2,3 3,5 2,6 591970 1,3 YU772-D10_4C 3,0 2,9 1,6 4,5 336362 0,5 YU772-D10_45C 2,5 4,5 2,3 4,0 345815 0,7 YU771-B12_4C 1,4 6,0 1,4 5,4 2198906 3,0 YU771-B12_45C 2,5 4,5 1,9 4,9 1654438 3,5 YU772-F11_4C* 0,5 18,7 0,5 15,4 1850493 2,5 YU772- F11_45C* 0,4 28,8 0,4 23,0 1605941 3,4 YU772-G04-VH YU771-A09- VL_4C 1,1 8,2 1,1 6,5 1286989 1,7 YU772-G04-VH YU771-A09- VL_45C 1,2 9,3 1,4 6,8 1106015 2,4 averag e average average EC50 Kd Max MFI Clone #19_4C 8,6 7,3 742167 Clone #19_45C 11,2 9,3 469013 Table 17. Kd and EC50-values of selected antibody candidates kept for 168h either at 45qC or 4qC (controls). Best antibody candidate chosen for follow up studies is marked in bold and with *:168h EC50relative torelative to relative to clone #19 Kd clone #19Max MFIclone #19 YU772-G12_4C 5,8 2,0 3,9 2,7 580000 0,6 YU772- G12_45C 5,1 3,8 3,6 4,8 574717 0,9 YU772-D10_4C 3,9 3,1 2,5 4,2 386526 0,4 YU772- D10_45C 4,4 4,4 3,1 5,6 432719 0,7 YU771-B12_4C 2,0 6,0 1,6 6,7 1999272 2,1 YU771- B12_45C 3,0 6,6 2,3 7,6 1286431 2,1 YU772- F11_4C* 0,6 20,5 0,6 18,0 1649524 1,7 YU772- F11_45C* 0,8 25,3 0,8 21,9 1525467 2,5 YU772-G04- VH YU771- A09-VL_4C 3,0 4,0 2,4 4,4 1077691 1,1 YU772-G04- VH YU771- A09-VL_45C 4,5 4,3 3,7 4,7 960442 1,5 average average average EC50 Kd Max MFI Clone #19_4C 11,9 10,5 970103 Clone #19_45C 19,6 17,3 620000 *Best antibody candidates in this study Methods and definitions: Evaluation of Results / Calculations Average Geometrical Mean fluorescence intensity (MFI) was calculated using FlowJo software. MFI of isotype control was subtracted from MFI of each sample and used for further analysis. Data were plotted in Graph Pad Prizm 7.0. EC50 values were generated using a non- linear regression fit model ( [Agonist] vs. response -- Variable slope (four parameters) with default Fitting method - Least squares regression. Kd values were generated using a non-linear regression fit model (One site – specific binding). To improve curve fitting in some of the samples specific constrains were applied. Example 15 - Proximity ligation assay (PLA) for HA-TERI and p300 Affinity matured antibodies were used to treat cells to evaluate the inhibitory effect of the generation of nuclear TERI-ICD in complex with p300 (HA-TERI +p300). Nuclear TβRI-ICD HA-tagged in complex with endogenous p300 assay in PC3U cells A9 cells (KO for TβRI by CRISPR / Cas9) reconstituted with stable expression of TβRI-HA- tagged in the C-terminal part and treated with affinity maturated antibody clones (F11 (Figure 22A), G12 (Figure 22C), A09 (Figure 22F), B12 (Figure 22G), D10 (Figure 22D), mAb19 (Figure 22B), Yumab A19 (Figure 22E). Clone IC50 F11 26 nM G12 34.1 nM A09 39.7 nM B12 39.8 nM D10 45.7 nM mchimAb19 55.4 nM Yumab mAb 19# 60.8 nM Table 18 Materials A9 (TGFERI (CRISPR-Cas gene edition was used to silence TGFERI / ALK5) human PC3U cells were reconstituted with TGFERI-HA tag (in C-terminal part of the protein). CRISPR / Cas9-method developed in Landström research lab by Anders Wallenius. Reconstituted cells are generated in our own research lab (Anders Wallenius). RPMI1640 medium and FBS (Sigma). Primary Abs: anti-HA rabbit Abs (Cell Signaling Cat.3724), and anti-p300 goat antibody (R&D. Cat.AF3789). PLA kit (Duo 92002, Duo92006, Duo92007 Sigma). Treatment Abs: #No.19 Abs, and #Fluorescein Abs (control ab) ordered from Absolute Antibodies Summer 2019 and delivered to our lab. in August 2019. TGF-E1 was purchased from Peprotech and used at 10 ng / ml. Equipment 1. Fluorescence microscope (Zeiss, Axioplan 2) 2. 37°C cell incubator 3. Orbital shaker 4. Heated humidity chamber 5. Hydrophobic pen for delimiting the reaction area 6. Freezer block (for enzymes) 7. Blob-Finder image analysis software 8. Prisma 7 software Methods and protocol Step 1 Cell culture 1stday, A9(ALK5-HA) reconstituted cells were seeded in an 8-well chamber slide (5x104cell per well). 2ndday, the cells were starved with the medium supplemented with 1% FBS for 16 h. 3rdday, the cells were pretreated with #control Fluorescein or #No.19 Abs for 1 hour, and then were stimulated with TGF-E110 ng / ml for 6 h. Step 2 Fixation and permeabilization slides 1. The slides were washed 4 times with PBS and then fixed in 4% paraformaldehyde (pre-warmed at 37oC) for 30 min at room temperature. 2. After 4 times washing with PBS, the slides were permeabilized in 0.1% Triton X-100 in PBS for 10 min. Step 3 PLA staining followed by the instruction of PLA kits. 1. Blocking a) Vortex the Duolink®Blocking Solution. b) Add 1 drop (~40 μL) of Duolink®Blocking Solution to each 1cm2sample. Be sure to cover the entire sample with Blocking Solution. c) Incubate the slides in a heated humidity chamber for 60 minutes at 37°C. 2. Primary Antibody Incubation a) Vortex the Duolink® Antibody Diluent. b) Dilute your primary antibody or antibodies to suitable concentration in the Duolink®Antibody Diluent. c) Tap off the Duolink®Blocking Solution from the slides d) Add the primary antibody solution to each sample. e) Incubate the slides in a humidity chamber. Use the optimal incubation temperature and time for your primary antibodies. 3. Duolink®PLA Probe Incubation a) Vortex PLUS and MINUS PLA probes b) Dilute the PLUS and MINUS PLA probes 1:5 in the Duolink®Antibody Diluent. c) Tap off the primary antibody solution from the slides. d) Wash the slides 2x 5 minutes in 1x Wash Buffer A at room temperature. e) Tap off excess wash buffer and apply the PLA probe solution. f) Incubate the slides in a pre-heated humidity chamber for 1 hour at 37°C. 4. Ligation NOTE: Wait to add the ligase until immediately prior to addition to the sample. Make sure ligation buffer is completely thawed and mixed well prior to usage. a) Dilute the 5x Duolink®Ligation buffer 1:5 in high purity water and mix. b) Tap off the PLA probe solution from the slides. c) Wash the slides 2x 5 minutes in 1x Wash Buffer A at room temperature. d) During the wash, retrieve the Ligase from the freezer using a freezer block (-20°C). e) Add Ligase to the 1x Ligation buffer from step (a) at a 1:40 dilution and mix. f) Tap off excess wash buffer and apply the ligation solution. g) Incubate the slides in a pre-heated humidity chamber for 30 minutes at 37°C. 5. Amplification a) Dilute the 5x Amplification buffer 1:5 in high purity water and mix. b) Tap off the ligation solution from the slides. c) Wash the slides 2x 5 minutes in 1x Wash Buffer A at room temperature. d) During the wash, retrieve the Polymerase from the freezer using a freezer block (-20°C). e) Add Polymerase to the 1x Amplification buffer from step (a) at a 1:80 dilution and mix. f) Tap off excess wash buffer and apply the amplification solution. g) Incubate the slides in a pre-heated humidity chamber for 100 minutes at 37°C. 6. Final Washes a) Tap off the amplification solution from the slides. b) Wash the slides 2x 10 minutes in 1x Wash Buffer B at room temperature. c) Wash the slides in 0.01x Wash Buffer B for 1 minute. 7. Preparation for Imaging a) Tap off excess wash buffer from the slides. b) Mount the slides with a coverslip using a minimal volume of Duolink®In Situ Mounting Medium with DAPI. c) Wait for 15 minutes before analyzing in a fluorescence or confocal microscope, using at least a 20x objective. d) After imaging, store the slides in the dark at 4°C for up to 4 days or at - 20°C for up to 6 months. Step 4 Collect images for PLA staining Digital images were taken by using a fluorescence microscope (Axioplan 2, Carl Zeiss) with a digital camera (C4742-95, Hamamatsu), with X40 objective lens (Carl Zeiss MicroImaging). Step 5 Analysis PLA signaling Analyze PLA signaling for nuclear TERI-ICD in complex with p300, was performed by the use of Duolink Image Tool that was specially developed for quantification of PLA signaling. Step 6 Statistics Prisma 7 was used for analysis of IC 50 Two positive controls were used in this experiment: TGF-E treatment with no antibody and TGF-E treatment plus #control Fluorescein 200 nM. The two positive controls had the same level of in situ proximity ligation signal. The value is presented as No #190 nM. Negative control used in this experiment: Staining without antibodies (only the A9-cells). Example 16 - Invasion assays from prostate cancer and breast carcinoma cells The inventors observed a significant inhibition of TGFE-induced invasiveness in response to TGFE in human triple negative breast carcinoma cells (MDA MB231 cells) (Figure 23) when treated with affinity maturated F11 and A19 used at 200 nM compared with control antibody Pavilizumab at 200 nM. Galunisertib (a TGFE Type I receptor kinase inhibitor) was used at 10 microM as control for experiment. Methods - Invasion assay – MDA MB-231: MDA MB-231 cells were seeded in 10 cm plates. Cells were grown in DMEM media containing 10% FBS, 1% PEST and 1% L- glutamine at 37°C in the presence of 5% CO2 until the cells attain 70-80% confluency. Then the cells were starved for 12 hours in DMEM media containing 1% FBS, 1% PEST and 1% L-glutamine. Next the cells were trypsinized, washed in 1X PBS and suspended in serum free media, to remove any traces of trypsin. Next the cells were counted. 2 X 105 / ml cells were used for the experiment. Further experimental procedure is carried out according to the invasion assay protocol from Corning™ BioCoat™ Matrigel™ Invasion Chamber (Fisher Scientific 11573570). Cells were treated with Ctrl Ab Pavilizumab (200nM), F11 Yumab Ab (200nM), Clone A19 Ab (200nM), Galunisertib10 microM. Cells were stimulated with TGF-β1 (10 ng / ml) 1hr after antibody treatment accordingly for 24 hrs and incubated in invasion chambers for 24 hours at 37°C in the presence of 5% CO2. The results were obtained by analyzing the protein concentration of invaded cells (optical density (O.D.) at 560 nm). Images were taken using Zeiss light microscope. The graph plotted from the obtained OD values for different treatments. Example 17 – Epitope mapping Summary: The inventors hired Pepscan©; a CRO for analyses of linear and conformational epitope mapping in human TERI to identify binding of mAb#19. Results from Pepscan© described in Table 19 below shows which amino acids mAb#19 was found to bind to. Materials and methods Epitope mapping was conducted as described in Example 7 above. Results Putative core epitopes were identified and are listed in Table 19. To investigate which residues within these epitopes may be important for interaction, linear 15-mer peptides bearing single alanine mutations at position 10 were made. Multiple mutations were found to decrease binding, these could be considered important for the binding. Residues possibly involved in the interaction are underlined and marked in bold (Table 19). Residue number Residue numbering Core epitope according to P36897 (according to SEQ ID (SEQ ID NO: 247) NO: 1) 47-58 71-82 CIAEIDLIPRDR (SEQ ID NO. 228) 94-109 118-133 SPGLGPVELAAVIAGP* (SEQ ID NO. 229) Table 19: Core epitopes for mAb#19. Core epitopes are based on common sequences in overlapping peptides (overlapping sequences within 30% of the top peptide intensity in the peak). Residues that were affected by alanine mutation (>70% binding loss compared to native sequence) are underlined and in bold. *Likely contains multiple smaller parts of epitope. Example 18 – Comparative data Summary: The inventors investigated the functional activity of Capra antibody 82.18 with several antibodies generated in the collaboration with SciLifeLab DDDp, including mAb#19 using in situ PLA assay (as described above in Example 15), to measure nuclear TbRI-ICD in complex with p300. The indicated antibodies in Figure 24 were used to treat cells to evaluate the inhibitory effect of the generation of nuclear TbRI- ICD in complex with p300 (HA-TbRI +p300). Antibody 16 was used as an isotype- specific IgG antibody in this experiment. The inventors have performed a comparison of an antibody raised against a peptide consisting of amino acids 114-124 of TGFβR1 (antibody 82.18) with antibody #19. The inventors have shown than antibody 19 is better at preventing cleavage of TβRI and the subsequent release of TβRI-ICD in an in situ PLA assay, which is a functional assay to show the presence of nuclear TβRI-ICD, performed in wild type (WT) castration-resistant prostate cancer (PC3U) cells (Figure 24). Example 19 - Results of MS analysis of TACE cleavage of TGFBR1 peptides Summary The inventors used mass spectrometry (MS) analyses to investigate potential TACE cleavage sites in recombinant TbR1 peptides in collaboration with SciLifeLab Drug Discovery Development Platform. Two novel potential cleavage sites were identified as described below. Determination of the TACE-cleavage site on the recombinant ECD of the human TGFbR1. The TGFbR1133-myc-(His)6 was expressed as described in chapter 1.2 and dialysed twice against deionized water. To 5.5 ml (13 mg) of the recombinant TGFbR1133-myc- (His)6, 3 ml of TACE (300 ng) (R&D Systems cat#930-ADB) was added and the reaction volume was filled up to 30 ml with 21.5 μl TACE-cleavage buffer (50 mM Tris pH 7.4, 2 mM CalCl2, 0.1 % Triton X-100). Digestion occurred for 9 hours at 27°C. The TACE-cleavage reaction was stopped by the addition of 12 μl reducing Lämmli- buffer (4 x concentrated NuPage sample buffer (cat#NP0007) and 4.6 μl of NuPage Reducing agent (cat#NP0009)), followed by heating up for 10 min at 95°C. 15 μl sample (4.1 μg recombinant TGFbR1133-myc-(His)6)was loaded on a NuPAGE Gel 4- 12% (cat#NP0336BOX) and separated under U=130 V, I=500 mA by usage of MES buffer (cat#NP0002). After separation had been completed, the gel was than (1) fixed in 46% MeOH, 7% HAc for 1 hour; (2) stained in 46% MeOH, 7% HAc, 0.1 % filtered Coomassie R-250 for 1 hour; (3) destained in 5% MeOH, 7.5% HAc for 36 hours; (4) and incubated for 5 hours in 1.5 % HAc. The band was cut out, 20 μl of H2O was added and the sample was stored at minus 20°C. The eluted protein samples were hydrolyzed my microwave exposure for 6 min at 8y0 % power, followed by reduction and alkylation to disrupt disulfide bonds. After acid hydrolysis using 3 M HCL, the samples were desalted using OASIS HLB Elution plats (Waters) and analysed by LC-MS / MS. Data were searched against the Uniprot / E. coli and EMBL customer user database. 18 peptides (Mascot score 763.5 and 18% sequence coverage) were identified suggesting the C-terminal end to be VELA or VELAA. The TACE-cleavage therefore occurred after amino acid position 127 (alanine) and / or position 128 (alanine) of the human TGFbR1. TACE cleavage of recombinant ECD-133-TGFbR1 myc(His)6is strongly inhibited by introduction of the A128G or A128I mutation. Two recombinant ECD-133-TGFbR1 myc(His)6 proteins carrying a point mutation A128G or A128I had been produced as described for the wild-type production. A TACE- assay was performed as described in chapter X. Samples were separated on an SDS- PAGE gel and visualized by PAGE blue (Fig. 26B). Exposure of the wt ECD-133-TGFbR1 myc(His)6 protein (13 658 Da) with TACE resulted in the appearance of a smaller fragment in the size that corresponds to the cleavage after the C-terminal end at amino acid 127 or 128 (10891 Da or 10981 Da respectively). In contrast, the protein ECD- 133-TGFbR1 myc(His)6carrying either the A128G or A18I mutation mainly maintain its original apparent molecular weight (13 644 Da and 13 700 Da respectively), indicating that TACE-cleavage had not occurred. This is shown in Figure 26B. Example 20 - Treatment with monoclonal antibodies against TGFβ Type I receptor hinders growth and metastasis of castration-resistant prostate cancer in vivo Prostate cancer (PCa) is the second most common cancer from in men and the fifth deadliest cancer form in men. In 2018, about 1.3 million men were diagnosed with PCa with about 360 000 deaths (1). Growth of PCa is dependent of the androgen testosterone, which also therefore is a target of androgen deprivation therapy (ADT). ADT is used in various stages of PCa, such as prevention of PCa metastasis, and in combination with radiotherapy against local and advanced local PCa, and also when radiotherapy is not the optimal treatment against PCa (2). In advanced PCa, the tumor is no longer responsive to ADT and classified as castration resistant prostate cancer (CRPC) (3). New anti-androgens Enzalutamide and Abiraterone acetate are used when chemotherapy is not an option for PCa patients and when CRPC has metastasized. Chemotherapy with Docetaxel and Cabazitaxel are frequently used for metastatic CRPC (mCRPC). Together, this range of treatment will only increase the survival of PCa patients with a few months, ranging from 11-74 months (4). The most common metastatic site for PCa are the bones. Patient survival decreases dramatically when PCa has metastasized to the bones; 90 % of all PCa patients has bone metastases and 70 % of all PCa related deaths are caused by bone metastasis (5). Thus, preventing of mCRPC is instrumental for increasing the survival of PCs patients. Transforming growth factor-β (TGF-β) is a key player for the epithelial mesenchymal transition (EMT) causing migration / invasion of PCa by stabilizing snail family transcriptional repressor 1(SNAI1) and downregulation of E-Cadherin as well as increased expression of vimentin (6). Other associations of TGF-β are linked to PI3 / AKT pathway, RAS / MAPK kinase pathway, angiogenesis, and metastasis (7). For several years, different treatments with various targets against the TGF-β signaling pathway have been studied. Targets against TGF-β signaling pathway are exerted for instance by interference of activation of latent TGF-β, ligand receptor interactions and TGF-β receptor kinase inhibitor. A few of these treatments have shown to improve patient survival (8). Our group have discovered that the TERI undergoes proteolytic cleavage resulting in the formation of a soluble intracellular domain (TβRI-ICD) which enter the nucleus where it drives expression of pro-invasive genes like Snai1 and MMP2 / 9, as well as expression of TβR1. Recently we have reported that this oncogenic pathway regulates proliferation of mCRPC cells (9-13). Monoclonal antibodies, mAb19 and mAbF11 are capable of preventing proteolytic cleavage of TGFβRI by steric hindrance. By targeting the cleavage of TGFβRI, the non-canonical TGF-β signalling pathway is effectively inhibited. Methods Athymic male nude mice (Envigo, 6-8 weeks old) were used for the orthoptic prostate xenograft model. A lower midline incision was performed on the mice. In the first in vivo experiments, 300 000 PC-3U cells in 10 microliter sterile PBS were injected into the right anterior prostate lobe of 18 mice. After one week of injection, mice were randomized into four treatment groups: 4 mice in 50 mg / kg Ctrl mAb, 5 mice at 50 mg / kg mAb19, 4 mice at 50 mg / kg mAb, 50 mg / kg mAbF11 and 5 mice at 10 mg / kg mAbF11. Mice were treated with 50 mg / kg control (ctrl) mAb, 50 mg / kg mAb19, 50 mg / kg mAbF11 or 10 mg / kg mAbF11 injected intraperitoneally twice per week for 4 weeks. In the second in vivo experiment, 300000 PC-3U cells in 10 μl sterile PBS were injected into the right anterior prostate lobe of 59 mice. After one week of injection, mice were randomized into six treatment groups: 13 mice in Ctrl mAb, 15 mice in 3 mg / kg mAbF11, 10 mice in 10 mg / kg mAbF11, 10 mice in 30 mg / kg mAbF11, 6 mice in Ctrl and 5 mice in 10 mg / kg Docetaxel. Mice were treated with 30 mg / kg control mAb, 3 mg / kg mAbF11, 10 mg / kg mAbF11, 30 mg / kg mAbF11, ctrl for Docetaxel and 10 mg / kg Docetaxel twice per week for 4 weeks. Treatments were administrated intraperitoneally. After four weeks of treatment, mice were sacrificed. Tumors and lymph nodes were weighed, and the volumes were measured with a caliper. Immunohistochemistry analysis of specified proteins was performed, sections were incubated for 1 hour at 60 degrees. Then they were rehydrated in xylene twice each for 15 min, 100 ethanol for 5 min, 95%, 70% ethanol and deionized H2O for 5 min. Next, the sections were treated with Antigen Retrieval Reagent at 95 °C for 15 min and rinsed thereafter with deionized H2O. Then the sections were kept in 0.75% H2O2 / 75% methanol for 15 min, rinsed with deionized H2O for 5 min and washed 3 times with PBS. Then sections were blocked with 5 % goat serum for 1 hour at room temperature. The sections were incubated with primary antibodies: TGFβR1 (1:500), Ki67 (1:250) and Vimentin (1:100), diluted in 5 % goat serum overnight at 4 °C. After overnight incubation with primary antibodies, sections were washed 3 times in PBS and then incubated with secondary antibody. Sections were washed 3 times in PBS and then developed with DAKO REAL EnVision Detection system (substrate), counterstained with hematoxylin and mounted in aqueous mounting medium. Digital images for IHC were acquired by scanning with Pannoramic 250 Flash II (3DHistech, Hungary). The number of positive cells in relation to negative control mAb (difference) was quantified using software QuPath and subdivided into low, medium and high expression levels of the target antibody. Results and discussion We used a preclinical orthotopic mCRPC mouse model described in Zang et al., 2019, to test treatments (injections) with the monoclonal antibodies (mAb), mAb19 and mAbF11. Both mAb candidates prevent proteolytic cleavage of TGFβR by steric hindrance. Our results show that both mAb19 and mAbF11 decreased tumour weight. Treatment with 50 mg / kg mAb19 resulted in a significant decrease in tumor weight compared to control mAb (difference = 183 mg, p > 0,05). The same effect was shown for 50 mg / kg mAbF11 (difference = 192 mg, p > 0,05), and for 10 mg / kg F11 mAb (difference = 158 mg, p = 0,05) (figure 1b). Similar results were shown for tumor volumes. Our data show that treatment with 50 mg / kg mAb19, resulted in a reduction of the tumor volume with 169 mm3compared with control mAb, the reduction was however not significant (p = 0,07). A significant decrease in tumor volume was observed for 50 mg / kg mAbF11 (difference = 185 mm3, p > 0,05), and for 10 mg / kg mAbF11 (difference = 170 mm3, p > 0,05) (table 21, figure 27c). Next, we made an analysis of lymph node weights and volumes to investigate whether these treatments affected regional metastasis to lymph nodes. The analysis show that 50 mg / kg mAb19, and 50 mg / kg mAbF11 significantly decreased the weight of the lymph nodes compared with control mAb (difference = 9 mg, p = 0,05, and , difference = 9 mg, p > 0,05, respectively). Weight was also decreased at 10 mg / kg mAbF11 (difference = 6 mg), but at non-significant levels (p = 0,16) (figure 1d). The volumes of the lymph nodes also showed significant reductions compared to control for all mAb treatments. 50 mg / kg mAb19 (difference = 13 mm3, p = 0,05), 50 mg / kg mAbF11 (difference 17 mm3, p > 0,05), and 10 mg / kg mAb (difference = 15 mm3, p > 0,05) (table 21, figure 27e). Taken together, these results show that treatments with both mAb19 and mAbF11 decreased the growth of the primary tumor of prostate and the regional metastasis to lymph nodes. Notably, the treatment with different concentrations of mAbF11 did not affect the weight of the mice (figure 28a). IHC was performed on tumors and stained with TGFβR1, Ki67 and Vimentin. The scoring was divided in low (+1), medium (+2) and high (+3) expression, using the software program QuPath. TGFβR1 expression in mCRPC tumours was analyzed after treatment with mAb 19 50 mg / kg, F11 mAb (10 or 50 mg / kg) or control mAb (50 mg / kg). The high expression of TGFβR1 was reduced after 50 mg / kg treatment with mAb 19 (difference = 180608 cells, p > 0,05), 50 mg / kg mAb F11 (difference = 178955 cells, p > 0,05) or mAb F1110 mg / kg (difference = 138022 cells, p > 0,05) compared with control mAb. No difference was shown in low or medium expression of TGFβR1 after mAb 19 or both mAb F11 treatments (figure 28 a and b). Next, we investigated if proliferation marker Ki67 was affected after the treatments. Low expression of Ki67 was observed after treatment with mAb 19 (difference = 45903 cells, p > 0,05), 50 mg / kg mAb F11 (difference = 34113 cells, p > 0,05) or mAb F1110 mg / kg (difference = 32955 cells, p > 0,05) compared with control mAb. Also, the medium expression of Ki67 was reduced after treatment with 10 mg / kg mAb F11 (difference = 14545 cells, p > 0,05) compared with control mAb. Treatment with 50 mg / kg mAb 19 or 50 mg / kg mAb F11 showed no difference in medium expression of Ki67. Lastly, high expression of Ki67 was decreased after mAb F11 treatment at both 50 mg / kg (difference = 12763 cells, p > 0,05) and 10 mg / kg (difference = 17994 cells, p > 0,05) compared with control mAb. No difference was shown after 50 mg / kg mAb 19 treatment (figure 28 c and d). The EMT marker Vimentin was analyzed to evaluate if it was affected after the treatments. Low expression of Vimentin was observed after treatment with 50 mg / kg mAb 19 (difference = 63262 cells, p > 0,05), 50 mg / kg mAb F11 (difference = 34534 cells, p > 0,05) or mAb F11 10 mg / kg (difference = 54443 cells, p > 0,05) compared with control mAb. Also, medium expression of Vimentin was decreased after treatment with 50 mg / kg mAb 19 (difference = 46192 cells, p > 0,05), mAb F11 treatment at 50 mg / kg (difference = 44331 cells, p > 0,05) and 10 mg / kg (difference = 69962 cells, p > 0,001) compared to control mAb. (figure 28 e and f). Next, we performed a dose-response in vivo study with mAbF11 at 30 mg / kg, 10 mg / kg and 3 mg / kg. The results from this study show a reduced tumor weight both at 30 mg / kg and 10 mg / kg (difference = 138 mm3, p > 0,05, and difference = 147 mm3, p > 0,05, respectively) (table 22, figure 29a and b). Similar results were obtained for tumor volumes with 30 mg / kg and 10 mg / kg (difference = 8 mm3,p > 0,05, and difference = 10 mm3, p > 0,05, respectively) (table 22, figure 29c and d). Notably, the treatment of mAbF11 as these concentrations did not affect the weight of the mice (figure 29e). In low score of TGFβR1 expression, the expression was decreased for 3 mg / kg mAbF11 (difference = 53131 cells, p = 0,045), 10 mg / kg mAbF11 (difference = 55902 cells, p = 0,035) and 30 mg / kg mAbF11 (difference = 72039 cells, p = 0,03) compared with ctrl mAb. Same trend was in the medium score of TGFβR1, the expression reduced for 3 mg / kg mAbF11 (difference = 71468 cells, p = 0,017), 10 mg / kg mAbF11 (difference = 76653 cells, p = 0,017) and 30 mg / kg mAbF11 (difference = 88622 cells, p = 0,007) compared with ctrl mAb. Lastly, the high expression of TGFβR1 were decreased, the expression for 3 mg / kg mAbF11 (difference = 214031 cells, p = 0,001), 10 mg / kg mAbF11 (difference = 208635 cells, p > 0,001) and 30 mg / kg mAbF11 (difference = 202263 cells, p = 0,002) compared with ctrl mAb (table 3, figure 30a and b). Next, we investigated if mAbF11 could affect proliferation of mCRPC cells by using the marker Ki67. In low score of Ki67 expression, the expression decreased for the group treated with 3 mg / kg mAbF11 (difference = 56055 cells, p = 0,02), 10 mg / kg mAbF11 (difference = 64585 cells, p = 0,001) and 30 mg / kg mAbF11 (difference = 72849 cells, p > 0,0001) compared with ctrl mAb. Same trend was in the medium score of Ki67, the expression reduced for 3 mg / kg mAbF11 (difference = 21498 cells, p = 0,005), 10 mg / kg mAbF11 (difference = 20845 cells, p > 0,0001) and 30 mg / kg mAbF11 (difference = 24357 cells, p > 0,0001) compared with ctrl mAb. Lastly, the high score expression of Ki67 were decreased, the expression for 3 mg / kg mAbF11 (difference = 56054 cells, p = 0,02), 10 mg / kg mAbF11 (difference = 64585 cells, p = 0,001) and 30 mg / kg mAbF11 (difference = 72849 cells, p > 0,0001) compared with ctrl mAb (figure 30c and d). Surprisingly, we could see that mAbF11 at 30 mg / kg had higher expression of ki67 compared to Ctrl mAb 30 mg / kg in the high score expression of ki67. One explanation could be that cells are trying to divide with 30 mg / kg mAbF11, but they can’t and that is why there is such a high expression of Ki67. This needs to be further analyzed with in vitro experiments with FACS analysis of cell cycle. Tumors were stained with EMT marker Vimentin to evaluate it’s expression after treatment with mAbF11. We concluded that only 30 mg / kg mAbF11 treatment reduced all three different scoring of Vimentin, low (difference = 100784, p = 0,002), medium (difference = 100416, p = 0,003) and high (difference = 98960, p = 0,035) (table 23, figure 30e and f). In this in vivo study we included Docetaxel as a treatment group for comparison, 10 mg / kg of docetaxel decreased the tumor size compared with control (difference = 64 mm3, p value > 0,001) (figure 31a and b). However, treatment of Docetaxel affected the body weight where some of the mice had lost more than 20 % of their bodyweight, showed tiredness and the general health of the mice were affected. Because of these severe side effects, mice had to be sacrificed (figure 31c). Mice general condition became less, they showed signs of tiredness, shaking, induration of guts and losing weight. Immunohistochemistry was performed and tumors were stained with TGFβR1 and Vimentin and scored in low (+1), medium (+2) and high (+3) expression. TGFβR1 expression reduced in low (difference = 15746 cells, p > 0,0001) and medium (difference = 11795 cells, p = 0,008) compared with ctrl (figure 32a and b). Also, Ki67 low expression was decreased after 10 mg / kg Docetaxel treatment (difference = 13705 cells, p > 0,05) (figure 32c and d). EMT marker Vimentin expression was reduced in low (difference = 12642 cells, p = 0,015) and medium (difference = 9958 cells, p = 0,03) compared with ctrl (figure 32e and f). Tumor Treatment Weight Volume mAb Difference (mg) P-value Difference P-value (mg / kg) (mm3) 50 mg / kg mAb19 183 0,05, n.s. 0,07 50 mg / kg mAbF11 192 > 0,05, 185 > 0,05 10 mg / kg mAbF11 158 0,05 170 0,05 Lymph nodes Treatment Weight Volume mAb Difference (mg) P-value Difference P-value (mg / kg) (mm3) 50 mg / kg mAb19 9 > 0,05 13 0,05, 50 mg / kg mAbF11 9 > 0,05 17 > 0,05 10 mg / kg mAbF11 n.s. 0,16 15 > 0,05 Table 21. Effect of mAb treatments on weight and volume of tumors and lymph nodes N= 9 mice per treatment group, (n.s. = non significant). Tumor Treatment Volume mAbF11 (mg / kg) Difference (mm3) P-value 30 138 > 0,05 10 147 > 0,05 3 n.s. 0,75 Lymph nodes Treatment Volume mAbF11 (mg / kg) Difference (mm3) P-value 30 8 > 0,05 10 10 > 0,05 3 n.s. 0,59 Table 22. Effect on volume of tumors and lymph nodes from treatments with mAbF11 at 30 / 10 / 3 mg / kg. N= 13 mice in Ctrl mAb, 15 mice in 3 mg / kg mAbF11, 10 mice in 10 mg / kg mAbF11, 10 mice in 30 mg / kg mAbF11mice per treatment group, (n.s. = non significant). Target TGFβR1 Expression Low Medium High mAb (mg / kg) Cells P-value Cells P-value Cells P-value 3 53131 0,045 71468 0,017 214031 0,001 10 55902 0,035 76653 0,017 208635 0,001 30 72039 0,03 88622 0,007 202263 0,002 Target Ki67 Expression Low Medium High mAb (mg / kg) Cells P-value Cells P-value Cells P-value 3 56055 0,02 21498 0,005 56054 0,02 10 64585 0,001 20845 > 64585 0,001 0,0001 30 72849 > 24357 > 72849 > 0,0001 0,0001 0,0001 Target Vimentin Expression Low Medium High mAb (mg / kg) Cells P-value Cells P-value Cells P-value 3 n.s. n.s. n.s. n.s. n.s. n.s. 10 n.s. n.s. n.s. n.s. n.s. n.s. 30 100784 0,002 100416 0,003 98960 0,035 Table 23. Number of cells expressing the target protein compared to control mAb after treatments with 3 / 10 / 30 mg / kg mAbF11. Protein expression is subdivided into low, medium and high levels of the target (QuPath) (n.s. = non significant). References for Example 20 1. Organization WH. Global cancer facts and figures, 4th edition 2018 [4 th:[ 2. S AMEB, Salawu A, Brown JE. Bone Health in Men with Prostate Cancer: Review Article. Curr Osteoporos Rep.2019;17(6):527-37. 3. Body A, Pranavan G, Tan TH, Slobodian P. Medical management of metastatic prostate cancer. Aust Prescr.2018;41(5):154-9. 4. Hoy SM. Abiraterone acetate: a review of its use in patients with metastatic castration-resistant prostate cancer. Drugs.2013;73(18):2077-91. 5. Teo MY, Rathkopf DE, Kantoff P. Treatment of Advanced Prostate Cancer. Annu Rev Med.2019;70:479-99. 6. Semenas J, Allegrucci C, Boorjian SA, Mongan NP, Persson JL. Overcoming drug resistance and treating advanced prostate cancer. Curr Drug Targets. 2012;13(10):1308-23. 7. Cao Z, Kyprianou N. Mechanisms navigating the TGF-beta pathway in prostate cancer. Asian J Urol.2015;2(1):11-8. 8. Teixeira AF, Ten Dijke P, Zhu HJ. On-Target Anti-TGF-beta Therapies Are Not Succeeding in Clinical Cancer Treatments: What Are Remaining Challenges? Front Cell Dev Biol.2020;8:605. 9. Mu Y, Sundar R, Thakur N, Ekman M, Gudey SK, Yakymovych M, et al. TRAF6 ubiquitinates TGFbeta type I receptor to promote its cleavage and nuclear translocation in cancer. Nat Commun.2011;2:330. 10. Gudey SK, Sundar R, Mu Y, Wallenius A, Zang G, Bergh A, et al. TRAF6 stimulates the tumor-promoting effects of TGFbeta type I receptor through polyubiquitination and activation of presenilin 1. Sci Signal.2014;7(307):ra2. 11. Song J, Mu Y, Li C, Bergh A, Miaczynska M, Heldin CH, et al. APPL proteins promote TGFbeta-induced nuclear transport of the TGFbeta type I receptor intracellular domain. Oncotarget.2016;7(1):279-92. 12. Song J, Zhou Y, Yakymovych I, Schmidt A, Li C, Heldin CH, et al. The ubiquitin- ligase TRAF6 and TGFbeta type I receptor form a complex with Aurora kinase B contributing to mitotic progression and cytokinesis in cancer cells. EBioMedicine. 2022;82:104155. 13. Zang G, Mu Y, Gao L, Bergh A, Landstrom M. PKCzeta facilitates lymphatic metastatic spread of prostate cancer cells in a mice xenograft model. Oncogene. 2019;38(22):4215-31. Example 21 - Evaluation of the effect of human mAb antibody F11 on cell migration in vitro The effect on cell migration of the human monoclonal antibody F11 (from 50 nM to 200 nM) that targets the TGF-β signaling pathway was evaluated with a wound healing assay performed on HCT-116-RedFluc cells (human colorectal cancer cells) with or without TGF-β1 stimulation (at 10ng / ml). Cell migration was compared to non-treated cells and to reference items using a human isotype control antibody (from 50 nM to 200 nM) and a well-known inhibitor of TGFβRI kinase (Galunisertib at 10 μM) with or without TGF-β1 stimulation. Cell migration was evaluated by monitoring the recolonization of the scratched region (2 areas by well for 3 wells per condition) to quantify cell migration. The mAb F11 inhibited cell migration of HCT-116-RedFluc cells. This cell migration inhibition was equivalent at all concentrations with TGF-β1 stimulation or at 200 nM without TGF-β1 stimulation with nearly a complete inhibition that ranged from 84.8% ± 14.5% to 91.2% ± 11.8% at T0+72h, whereas a migration occurred for non-treated cells with 6.2% ± 4.2% of free cell area. The inhibition of cell migration of the mAb F11 was lower at 50nM and 100nM without TGF-β1 stimulation with 73.4% ± 21.7% and 54.1% ± 17.1% respectively. The human monoclonal antibody F11 inhibited cell migration of HCT-116-RedFluc at all concentrations with or without TGFβ1 stimulation. Introduction Cell migration is fundamental for physiological (morphogenesis, regeneration and inflammation) and pathological processes such cancer during invasion and metastasis. Aberrant TGFβ signaling has been implicated in several human diseases, including malignancies such as lung cancer, hepatocellular carcinoma, pancreatic cancer and Colorectal cancer (CRC). TGF-β have been shown to promote and maintain CRC metastasis via regulation of immunity and cell–cell contact mechanisms. CRC is one of the leading causes of cancer deaths in the western world. Metastatic dissemination of primary tumors is directly related to patient’s survival and accounts for about 90% of all colon cancer deaths. Thus, more effective and less toxic therapies for CRC are required. The effect on cell migration of the human mAb F11 antibody (designated by CDD Ab at 3 concentration: 50, 100 and 200 nM) that targets the oncogenic TGF-β signaling pathway was evaluated with a wound healing assay performed on HCT-116-RedFluc cells (human CRC cells). Wound healing assay consists of an artificial gap made on a cell monolayer and follow 2-dimensional cell migration by capturing images at regular intervals until T0+72h post-scratch. Cell migration was compared to non-treated cells and to reference items using a isotype control antibody (designated by CTL Ab at 3 concentration: 50, 100 and 200 nM) and a well-known inhibitor of TGFβR1 kinase (Galunisertib at 10 μM). These conditions were tested with and without TGF-β1 stimulation. Cell migration was evaluated by monitoring the recolonization of the scratched region to quantify cell migration. Materials Candidate antibody (CDD Ab): mAb F11: Fully human Ab IgG1 (Immunoglobulin G1) with some mutations in the Fc (Fragment Crystallisable) region (to silence ADCC) Specificity for the human TGF-βR1 Formulated in Phosphate Buffered Saline (PBS), Protein A purified, >95% Isotype control antibody (CTL Ab): Humanized mAb IgG1 with the same mutations in the Fc region (to silence ADCC) as the CDD Ab. Specificity for RSV (respiratory syncytial virus), Formulated in PBS, Protein A purified, >95% Galunisertib TGF-β inhibitor (LY2157299): targets and binds to the kinase domain ofTGF-β receptor 1 (TGF-βR1)C22H19N5O,CAS Number: 700874-72-2 in 1% of DMSO,purity 99.84%. TGF-β1 Transforming Growth Factor beta ligand 1 (TGF-β1): ligand of TGFβ receptor Peprotech Ltd) ≥ 98% by SDS-PAGE gel and HPLC analyses Tumor cells HCT-116-RedFluc (Human Colorectal Tumor-116-RedFluc): The HCT-116- RedFluc cell line is a human colorectal tumor expressing luciferase, allowing a set-up of CRC mouse model and the follow-up of tumor cell dissemination in the mouse body by bioluminescence imaging. Methods Tumor cell amplification Thawing and the amplification: a vial of HCT-116-RedFluc cells was resuspended in preheated complete culture medium, composed of McCoy 5a medium supplemented with 10% of Fetal Bovine Serum (FBS) and 1% of Penicillin-Streptomycin (P / S) (CM10%). Centrifugations were performed at 400 g for 5 minutes at room temperature. To determine cell number and viability at each cell passage, cells were mixed with Erythrosin B stain in the same volume, and 10 μl were loaded on a LUNA Cell Counting Slide. Images and counting were performed using the brightfield mode and the Defaults protocol of the LUNA-FX7. Tumor cell seeding for wound healing assay HCT-116-RedFluc cells were plated with 2.5x105cells per well with the preheated CM10% in 24 well plates. Wound healing assay and serum starvation A confluent monolayer of HCT-116-RedFluc was scratched with a sterile 1000 μl tip to create a wound devoid of cells (a new tip was used for each well). The medium was removed and a preheated culture medium composed of McCoy 5a medium supplemented with 1% of FBS and 1% of P / S was added designated by CM1%. Test and reference items preparation Test and reference items were prepared and added according to the experimental study design in Table 24. Table 24 . Study design mAb F11 and isotype control antibody (CTL Ab) solutions preparation: Solutions with only the mAb F11 or only isotype CTL Ab were prepared at 50 nM, 100 nM and 200 nM in McCoy 5a medium CM1% supplemented with 1 % FBS and P / S. Galunisertib solution preparation: A Galunisertib solution at 10 μM Test and reference items treatment Culture medium was removed, and cells were washed twice with sterile PBS. 1 ml of test and reference items solutions were then distributed in the appropriate wells containing either media only CM1%, Galunisertib at 10 μM, or the mAb F11 or ctr antibody at indicated concentrations respectively. Cells were then incubated between 35°C and 40°C with 1-6 % CO2. TGF-β1 stimulation According to the experimental phase schedule in Table 25, stimulation with TGF-β1 occurred by addition of 100 μl of a TGF-β1 solution (110 ng / ml in CM1%). 100 μl of a CM1% solution was added in wells of non-stimulated cells. Cells were then incubated between 35 and 40°C with 1-6 % CO2. Time schedule Action Day -1 AM Tumor cell preparation for wound healing assay Preparation of test & reference items and TGF-β1 T0-1h+ / -30min solution Wound healing assay T0 Serum starvation Day 0 Just after T0 Picture (baseline) Just after picture Test & reference items treatment 1 h ±5min post treatment TGF-β1 stimulation T0+4h±33min Picture Day 1 T0+24h ± 1 hour Picture Day 2 T0+48h ± 1 hour Picture Day 3 T0+72h ± 1 hour Picture Table 25 . Experimental phase schedule Pictures According to the experimental phase schedule in Figure 33, images were captured using the camera (Axiocam 208 color from ZEISS) attached to ZEISS Primovert inverted cell culture microscope (4X objective lens of the microscope, 0.5X objective lens of the camera, 2 fields of view per well with the same brightness (top and bottom of each well), for three replicates). A specific attention was taken to take all pictures at the exact same position of the baseline picture with the same parameters. Data analysis The images were analyzed with the image processing program ImageJ using an optimized processing macro (MRI Wound Healing Tool) to identify and quantify wound area. This program served to measure and plot the gap area as a function of time to determine the cell migration area. Extents of closure at T0+4h, T0+24h, T0+48h and T0+72h were calculated by subtracting area at T0. Change of area was determined by normalizing difference to area at T0. Cell migration was quantified and expressed as average percentage of closure of the scratch area on the 3 replicates or 2 replicates only for some condition detailed in DEV2. The normalized area to T0 area of each replicate of a condition and the mean normalized to T0 area ± SD of each condition at each timepoint were calculated and represented in a graph. The mean normalized to T0 area of reference and test conditions (Condition 3: CTD Ab, Condition 4: CDD Ab, Condition 7: CTD Ab stimulated by TGF-β1 and Condition 8: CDD AB stimulated by TGF-β1) was compared to the control condition (Condition 1: not treated and not stimulated by TGF-β1) and the reference conditions (Condition 2: Galunisertib, Condition 5: stimulated by TGF-β1, and Condition 6: Galunisertib stimulated by TGF-β1). Results and discussion A representative picture of each condition for each timepoint was chosen and is presented in Figure 34a (without TGFE stimulation) and 34b (with TGFE stimulation): Images of the wound healing assay at T0, T0+4h, T0+24h, T0+48h and T0+72h. The mean ± SD of normalized percentage of area compared to T0 area of each group at each timepoint was quantified and is presented in Figure 35. The normalized percentage of area compared to T0 area progressively decreased for conditions 1 (non-treated cells), 2 (Galunisertib), 5 (TGF-β1 stimulation), and 6 (Galunisertib stimulated with TGF-β1) to reach in average 6.2% ± 4.2%, 4.3% ± 2.0%, 5.7% ± 1.8% and 8.0% ± 3.9% on T0+72h respectively. For these conditions HCT116- RedFluc cells migrated and progressively colonized the scratch. As compared to non-treated cells, the normalized percentage of area compared to T0 area progressively decreased for conditions 3 (CTL Ab): 3C (CTL Ab at 50 nM), 3B (CTL Ab at 100 nM) and 3A (CTL Ab at 200 nM) to reach in average 4.8% ± 3.7%, 3.7% ± 1.0% and 13.0% ± 9.1% respectively on T0+72h, signing a colonization of scratch in same proportion than control non-treated condition. The normalized percentage of area compared to T0 area slightly decreased for conditions 4C (F11 mAb at 50 nM), 4B (F11 mAb at 100 nM) and 4A (F11 mAb at 200 nM) and reached in average 73.4% ± 21.7%, 54.1% ± 17.1% and 87.3% ± 19.8% respectively on T0+72h. For these conditions without TGF-β1 the migration of HCT116- RedFluc cells was reduced with the most important effect observed for the highest concentration of candidate antibody. As compared to non-treated cells, the normalized percentage of area compared to T0 area progressively decreased for condition 7 (CTL Ab stimulated with TGF-β1), irrespective to the doses (50 nM, 100 nM or 200 nM) to reach in average 11.9% ± 6.2%, 20.9% ± 13.0% and 9.6% ± 6.2% on T0+72h respectively, close to the control non-treated cells. On contrary, a very low decrease of the normalized percentage of area compared to T0 area was observed for conditions 8 (F11 mAb): 8C (F11 mAb at 50nM stimulated with TGF-β1), 8B (F11 mAb at 100nM stimulated with TGF-β1) and 8A (F11 mAb at 200nM stimulated with TGF-β1) to reach in average 84.8% ± 14.5%, 91.0% ± 15.8% and 91.2 ± 11.8% respectively on T0+72h. Without TGF-β1 stimulation, the inhibition of migration was greater at 200nM of F11 mAb than at the lowest concentrations of 50 nM and 100 nM, whereas when cells were stimulated with TGF-β1 the inhibition of migration of cells treated with all concentrations of F11 mAb was equivalent. The inhibition of migration of HCT-116-RedFluc cells was similar with or without stimulation by TGF-β1 at 200nM of F11 mAb. Conclusion The effect on cell migration of the human mAb antibody F11 that targets the oncogenic TGF-β signaling pathway was evaluated with a wound healing assay performed on HCT- 116RedFluc cells (human colorectal cancer cells) with or without TGF-β1 stimulation. Cell migration was compared to non-treated cells and to reference items using a human isotype control antibody and a well-known inhibitor of TGFβRI kinase (Galunisertib) with or without TGF-β1 stimulation. Cell migration was evaluated by monitoring the recolonization of the scratched region to quantify this cell migration. The F11 antibody inhibited cell migration of HCT-116-RedFluc cells. This cell migration inhibition was equivalent at all concentrations with TGF-β1 stimulation or at 200 nM without TGF-β1 stimulation with nearly a complete inhibition that ranged from 84.8% ± 14.5% to 91.2% ± 11.8% at T0+72h whereas a migration occurred for non-treated cells with 6.2% ± 4.2% of free cell area. The inhibition of cell migration of the F11 antibody was lower at 50 nM and 100 nM without TGF-β1 stimulation with 73.4% ± 21.7% and 54.1% ± 17.1% respectively. Results presented herein illustrate that the F11 antibody inhibited cell migration of HCT116-RedFluc cells. This cell migration inhibition was equivalent at all concentrations with TGF-β1 stimulation or at 200 nM without TGF-β1 stimulation with nearly a complete inhibition that ranged from 84.8% ± 14.5% to 91.2% ± 11.8% at T0+72h whereas a migration occurred for non-treated cells with 6.2% ± 4.2% of free cell area. As expected, cell migration, similar to those observed in control not-treated condition, was observed for all the other treatments (control antibody and inhibitor of TGF-β stimulated or not with TGF-β1). Example 22 - Expression of nuclear transforming growth factor β (TGFβ) Type I receptor in human colorectal carcinoma HCT 116 cells stimulated with TGFβ1 Methods HCT116 cells from ATCC were cultured on to the sterile coverslips in Mc Coy’s 5A medium. Cells were starved in media containing 1% FBS for 16 hrs and then stimulated with TGFβ1 (10ng / ml) at indicated time points 0hr, 3hrs 6hrs and 24 hrs. Results and conclusion Localization of TGFβR1 was seen when stained with primary antibody (TGFβR1 polyclonal rabbit antibody - Thermofischer PA598192) (157-244 aa) 1: 300 dilution. Alexa fluor 555 (red) anti-rabbit was used as secondary ab (1:600 dilution) and DAPI (blue) for nuclear staining. Colocalization of TGFβR1 in the nucleus was analyzed with confocal imaging and z stack imaging. Images were acquired using LSM 710 Confocal microscopy. From these data we conclude that we can observe nuclear TGFβR1 in human colorectal carcinoma HCT116 cells (Figure 36). Example 23 - The role of TGFβ signaling in human oral squamous cell carcinoma We have examined the protein expression of transforming growth factor b Type I receptor (TbRI) in tissues derived from patients with oral squamous cell carcinoma (OSCC) and observed that a high expression of TbRI showed a strong correlation with higher tumor grade. Treatment with transforming growth factor b1 (TGFβ1) of human derived OSCC organoids resulted in migration of tumor cells into the Matrigel which was visualized as budding. Treatment with a therapeutic antibody F11 directed against a specific epitope in TbRI and a TbRI kinase inhibitor prevented significantly TGFb1 induced budding of the OSCC organoid, demonstrating that therapeutic interference with the TGFb signaling pathway in OSCC with F11 could be of value in future precision medicine for these patients. Material and Methods For immunohistochemistry: (IHC) to examine the expression of transforming growth factor b Type I receptor (TbRI) in tissues derived from patients with oral squamous cell carcinoma, (OSCC), we followed the protocol described in Zang et al., 2019. We used the rabbit polyclonal Capra C 11-83 antibody purchased from Capra Science to Landström research lab, diluted 1:100. Organoid cultures: The process to generated human organoids derived from patient tissues with OSCC follows the protocol described earlier in Wang et al. 2022. An organoid library of salivary gland tumors reveals subtype-specific characteristics and biomarkers. J Exp Clin Cancer Res, 2022(41):350. Briefly, patient tissues (oral squamous cell carcinoma, OSCC) were collected and trimmed into 1-3 mm3pieces, then, tissue pieces were incubated with 1x Dispase at 37°C for a maximum of 60 minutes with gentle agitation. After dissociation, the cell suspension was centrifuged at 800 rpm / min for 3min. Pellets were passed through 100-μm cell strainers, and then centrifuged at 1000 rpm for 5min. Pellets were embedded in Matrigel and cultured in Organoid Culture medium. After digested with TrypLE, tumor OSCC organoid cells were seeded on the Matrigel. The experimental groups were grouped into blank control, TGFβ1 (10ng / ml), isotype specific control antibody Palivizumab at 100 nM plus TGFβ1 (10ng / ml), full human antibody F11 at 100 nM plus TGFβ1 (10ng / ml), LY2157299 (10ng / ml) plus TGFβ1 (10 ng / ml), in total 5 groups. Three day later, inhibitors were removed from culture medium. Antibodies and LY were added into medium one hour before TGFβ1 was added to the medium. The Patient Derived Organoid (PDOs) derived from patient with OSCC were treated for 48 hours. The tumor budding or satellite clone around the PDOs were counted in a microscope to evaluate the biological effect treatment with TGFβ1, and F11 antibody or LY2157299 in this model. The antibody Palivizumab (control antibody) was purchased from Yumab. LY2157299 (Galunisertib) was purchased from MedChemExpress NJ, USA. TGFβ1 was purchased from Prospec, Ness-Ziona, Israel, and used as earlier described in Zang G, Mu Y*, Gao L, Bergh A, Landström M. PKCζ facilitates lymphatic metastatic spread of prostate cancer cells in a mice xenograft model. Oncogene 38, 22, p 4215-42312019. Statistical analyses: Tumor budding or satellite clones sprouting from the primary PDOs were counted as sprouting ratio. Raw data were analyzed with Graphpad Prism 9 software, and statistical analysis was performed with one-way ANOVA, *p< 0 .05, ** p< 0.01, ***p< 0.001, ****p <0.0001. Data are presented as mean ± SD. Results and Discussion We performed immunohistochemical staining’s of TbRI in tissue sections derived from patients with OSCC and the results were evaluated as grouped into three categories: weak, moderate, and strong as shown in Figure 37. Then the expression of TbRI was examined in OSCC tissue sections from patients and the correlation between tumor grade and TbRI expression was examined as demonstrated in Figure 38. There was a significant increase of TbRI expression in tumors with higher grade as shown in the staple diagram in Figure 38 right part. Next, we examined if treatment with TGFb1 of OSCC patient derived organoids grown in Matrigel, could respond with migration of tumor cells into Matrigel (budding) and observed as expected a significant response by budding when treated with TGFb1 for 48h in presence of isotype specific control antibody. Treatment with F11 antibody at 100 nM and with a TbRI kinase inhibitor Galunisertib (LY2109761) inhibited TGFb1- induced budding in both cases as shown in Figure 39a and Figure 39b. From these data we conclude that the expression of TbRI in tissue sections derived from patients with OSCC is high and correlate with higher grade seen in more aggressive forms of cancer. Moreover, as treatment with F11 antibody and Galunisertib inhibited budding in OSCC patient derived organoids grown in Matrigel, that these compounds could inhibit tumor growthENVAWTV E I H V CGTG G T G G A CGC K R V I C GTH VTCTAT ACY YNK G G A A M R RPR C ACTC S V NMW N VL AIMGTG C C C G C G HLIME YD DI EECTAG CTC G VLGKSFFI RL TSDVCSTCTPGGTG G C G D T C GT TG C CTTTVFK GAD HSSC G A A G C CAE GT CI EH DPA G HVG A G ATC VVSPSE YRLA DT LGG G G A G G V GQD V M F A SA Y KS V STG ILG A AGVVL Y IG RSICA A GTCVILG PLG SSDTTA C CTA A L ATWLQEQIG AGLTT CTC A G A R ALDYQ SGY VSF T TG G G DTLEI Q AID SVVADG C C G G C VVT TR CE LWYSTG G G G G C G CTPQW C HIQEGLG S G AATCG FGLVT TNG LG G G SLV S N NGILTG VSG G G C ATA RPS CG CG D KP LSPLD K S K K A S G A C GT TGK K CK GPCQ SC C CCT Tec TS Gn CK N V RIS DLIRRLAYT FGC GQYM Re LVSAT TC AAA TC u HT GA N Aq CT SA KIA R VQPGIFSETLVAT I PC GTACD VTG CGTR W D S GTGATCe FCLS GK WFA SES GTT TA G SQ ELITAKTLLVA MAG GQ G CC GGMIDLGA RGL TCTC A CTTND NER H G NY LG STGA CCG A CYHAMAS S S N S A GTACTG G HIP DLRIAYSFM G A G GTC C L DLAPYIWTQ GYIA C C CATLQ A NKM LVK DCFACTTLG G AEL KIG G GATGQ QR RGSYLGLEG C G T SKLCAGGTTG2A CTAYY TK MIA GPKGTG C C21ATG IATE EGFTSIAVS K A N G ATGC G CAI EA C K G K GTC C CT AC A VFE E FMSS GGQC T C AC HTVLR N SPGT T T TG C A SPRM ALGRFHK MRL LD S R S KFVQTGCC A G L ATCC GA ATVTL KDLWLS HNIAEGSL SSPRAS CGIPTTQF VLY PG WGYCTTGA TTC A GCTCCATG LSDEE LG D S Q RTN G C CTCTA LPER SDQVG GLQGTAC CG C R A P CESALWLK QYQ CCTATC A R V N PF PSFTV SER G V G S N G SW SICTYG ATTC C A G CGTAP V I L PPG DYSYCTA G C C G A R R KAAIS AD QTCG C A C G V D H VLM NE YYM SATGG G GTAR HAKI Y PLL TG AFGTA C CTAP IV E R MRLS G R D GCTG G A EILVT EKTK Q G CEPAGTTC C C D R GEG QEGY I TA MG V G TQ G C G C A C ee1ecdRnit cβo o nFneieG diuleuqvFc qTmacaescsH VuNeS - 2y11dR0 9ob)βL 1 iFM t 9n1G -TBA(DI:QO.EN1.2.3S RSITFRGKVSDAYYTSGGSG SSSIVTGA V GSVLG T ATWEG AAATLQTC GTAGWG GKGYC GPD GTA MAAQTA G A GR GVG GG T CWYC GS S GM GGGTA AAY YGSVTCGSYFATATGFVTCTGV C CSR ACA CTA CACC3G21CYY TCGSVTLAG GRL TG G G CS DGEG GAYGAPRL TG C C KTC VGD STMQ SVT TD G G GLN MGTC GAC YATGG Q A GYCYGLG CTSGYCCS G GS LGTG GE TGLN CLKASCTGAT YV STMAS G GYQVTTGEN CADCT YCSI TV S G A G Voni ecedi ececedi ece edi emnAe1to ne1 o ne2to nce2 o nt ce3 o n 3 odHiuRecqeDl uRni uRel uRni uReleuRniCcuqeD CdmicqeD CcHuqDdi qDc qDdiNeC m S H AcC A S HuC H N S H A A SeNem V A S S H AcA..4.5.6.7.8.901TLTFD T C GGTC C A C CTG C C S G T C A G A G ATS C AGTG CAGA SFA A GTR G C C CST GCTC A G G C C APV A C ATC G G CTC C C G A S T A GC CTQLA A CTTAA S G A CTASC G G A A AGGAA G CAG YGCTAC AT ILT A CGC ALG C CGT TC AKPCAC A A CT TGTG C K A G G ACAGCGPGTG C C TC GA K G CACT TQ GQT A C G C G G AYW TGTA C CTC NCC C C CGTA GLCTATCT CT Y AA G SK GCC C SIETA C GTAT ISLC C G ATTTQKTC TACTC C C S GATC GCA A A Q C42CATCTG R G G1TCCTCT CTF ACTGCTCIT TC T A G CTACC CTLA C C VPGCGA CTG CTGTC RY TA T G CTG D G A C C AA TTG G Q CGA CTA C V S QCTG ACTGAACTC TCA CTATSYG C G C CLYTA N G G CTAG SAC ALA A C CTGSFCYC C G G G GPDTSCCCT GA SE STS T A GT TC QPCICQT C C GCT A TC S CLA MQG QGS A A A C G CQLC STS GGTAT IS G A C A DSIC R G Aece e o e e e e e e endit cnnicndit c c dit c ceoueqlem1 o nuAeuRele1uRo nne2 o nuRele2uRo nneueSLcVuqdNeSLiVcqAeDcSCL uqNeDi dSCLmiAcqAeDcSCL uqNeDi dmiSCLAcqAeS . 1. . . . .12131415161GTG G T CGG A CGACT C C A A G A GTC A C G A A GA CCGA A G CCGTGCTAT AA AT T TA CTC C A CTC A ACC A GCA A CTTG A A A G G C G CTC GTA CCTGA C GGTCC G GCTC C AG GCACGTATC CTAG T CTG C A GTT C GC GGTC A A C A G G C G CTGTG C A CCTC A CGT G C C GTC A G A A A C GAA CTCTC C GCA C A GTC C C C C G G ATA G C CAC A CTC C G A C G A GAATC G A G ATC CGGC G AGA A G G G G A C CA T TCTG G A G ACA ATC G A CTTG A G G GT AC C A G G C A GGTC A A A C C GGG C C G A GGTC C C A C A C A GAA G G T A A C C A A C CTATA A G A C A A ACTTC TTTC A C C C C C A A A G G ATG G G CTTC C GA A G A G C G G C C G G C T CT A TC G G C CTC G G G G G CTA GTG A G C A GAAGA G GAC GCTC G ATCTTC C CGAC A C G C ACTG ATC G A G CCC C CTA A A CG CG G G G CTC G G C C A C GT TG CG C A A C T A A A GCG C C CCT T TA C C A CTGTAGTA GC G C AA ATG A G CCG CTCTA AT TC GAA TC CCTG CTC A C C A A C TTACC CTCTC C C G G G C A T G G CGTG GGCTGTG A G CGGT ATA C A GTC C ATGA A C ATGT TC G G G C A G GCT TC C A A C TCC AGTA C C A CTTG GGC A G CTTGA C G AG GGGAGT TA A C GGGTCCG ACTG CTC CTG AACG AGATC C A G C C ATG AT TG A A GTC CAC G GCA GTA CCTG G C GATGGGTG C C A C G CCA G G G GTGC C A GGTATC C A A CGTG C G GTC G C C GGT TC C C C5GTGTC C C C C AGA G A G C CC 2GC G CAG A G CTG C C G A A CT1TC C C CTTTTC ACCTG C C A GGGC CTC G A C GC CGT TA C A C GCTCTG C GTA G GGT T TCC C ATA G C GAGCA CGG A G G GTC C C C GAAT TC C CTA A A C GCTC TTTC A GTA C C G C CGG C CGC CCATTG G G CGTCCTG G GTG CTC G A A G G CTC C C A ACA C T ACCCTCGTATC C G G C A G C A C C GTC C C GGG A G A A C CGG A A TTTL A C A CTG CA C C ATGA A C CTA G C GT TC G G G GTCAPCG C C A C GCC A G A A G C G ATGY TGGTG G GTTC A A C C C CAG AGTG A C CTC GCC C C CTG C G GCTGG G A C AGTC GG CG CCQ ATTATGCTG C C Q G C G CTA C A C GTC G C ATGCT TA CATCTCeditece eo ncnditecnele3uRoneuyvnoielec qDi da a cuu emicqe h uqN SCLA AeS H C NeS . 8.191 CGC RS KTH T L A C T A A T A A T C GC TLVCATC GTV LEG ATG K GSS NE ECTC C ATTG G AITKSV D H CGTT TTC G C GT FWA A AFSPA C A RSK G R M G CTC G G A G A AGTDTQ VCAG A GPH DSV P STG A G C C C A G A G G KTA G KANVYPCTCTC C C G A A C A SAC G A VLV WLSATC A C SPFNGC GTG C A G GENTY FVCAAGTRCA GCA A SPCA A G D VCI FV NTATG CTC A G G G AS YEAC C CAA AYSPYTK V QPG A ATCG ATA C G CCA A GF FG N RAYQ C CT TCG G R NNA G C ATGQTEP ER Q A CCCTTAAA AS LFGGT TSKTG DPWGCTG GCTCG CPVLSAG G C G SL EQ RTG A G GTCTG C A G C VKTG C A GC C C S A S H G S G CGG AG TT TATA S VVA C G S S S S S V K K A D GAA C CTACC G C C A AT QLS APSC AS VPGK CGTATSGCTAI TVVSV TTC G A A AAG G CSTSLA C C A S VTVILA C G C C CTA A A GAG S GC G ALV C VTV VTK K G A GGC A G C A G AKQG A W G SCT ESYC C GTA CGG G A AYI LHG AGTEQS V IP LG GCC CGTC AAAL QTGTC GCLA ATG GL ESFWSAY P PFTACTATC C A ALSTAKEVEA CTTCGC C KY L TRLG G GTTCC CPD S C TAG CTG A AP ACAGGPD GSQ K D C A CTGC C A ACTKP YGTG A A M SINSCTC G CTG A GTGG FIVACGTGQ G S MLSDAAC C G A GT TC CPKFK HA CTR GQL TVLV CAC C CGG G C QVS KG C A V CGYV D KP GC C G CATG G CC QPEGTW SA KC KP TCAAGC GTTG AACYAYTGTCTS GPFPY TT T TCCGTCTGT TW A D AGTTA MA CG ATYGY TKHPPEKKYGG TGCTT CGA C C NV KSVVFGTA ATL G N CTCTA ACA C GLTRSTC C AYSKILGCGYGNN CG CAGTGTSF LTC CFCAG CCTS E LGCTTG S F V VTVELSP TAT A TC C CTCI L TPW Q AGG A A AGC G S A CKSGC G CGR AC CGSAG GD GCTGGA Q CTATC Q C G STSHNTCLCCC GCA G G G A G S6G ATA CSVCG A ALSC CATCGACA G R Q GY 21TCCCYYNPPVECTG GTGACAC FTSACCTTCSLV W A SA TPLWTC A A CG AVECG C C AT TCTITD ATA C CTATLPKA CT RTVAT LDTCP SV VATA G GI GT T TACTG G C V RGSGTSVC C CA GA CYDC GCTG GEAP PV D A G A C CCA TC C D G QGGG GG R EPCTRS CTCG CAA GAA G V QEATC GP LF H YT PY GCTATA GGTCS QTC C A C Q SY TSF PA A CTC GTAC CTACVCGCTA CTG G CVLN D K M K DNYG KSLGTC CCTGTA AGASYSEAT TCG G G A C ALYTQTC GCG QVC QVS C GTG GLLGYC S KEE LLA CTA CSG G C CGA AG ATCTG G S A G G A CSCPAFS NT CT TG ATS LTGLPERK PTLC Q C ATA C C C G A C AGTS D EGSC C C CEN A V C G CLG G ACLK TAKKS T VT CYTQ STK K Q HA CA GGTTG C CTATCTAACTT GTG CQG CT PQQLG A G MLAG C C N G D A N N A CTCT TA A CQAC VIS S N A GT ED G V N K H G G C C C C A C A DID ece endit cyvni oneo nu tnie etni oaai deh alcuh nie hmicqgih uqe gaihm H C A A SLC N SLC A . 0.1.2 222 C T A ATG ATGLCTCGGTT T TTFDTCTC T G A CTG CTG ATC C S C C G CGTAAG S T G G AAG CSATG AFC CT TR A CCCSGCTGPTC A G V G G G G G CGA G A S G A C CQCTC G ALS A G A A C CSTG G G CAAAC ATG C GG YGCCT IC CLATACALGTATCT KGG ATC GTTAPAAACATCTK T C G CGAACPGAC A KGCTGC C C QGTC G A C GQG CYT TATC G G CCTW TGNCG CTGTALGACTAYATA C CTA A SKT CAG GIGAC SIETT TATCAGG ATA SLCTCTGGA QKTCCTC CTA SATCCC G A G C8G CATCGR Q G2GCTG GTCGF A1TCTC A A CTIT TGCG C C A ATLPGGTA G GATA VGATGT TT YA G C C C RYCTGDCCTMTA CCD G A G CAG Q C CCTATA VCG G A A CTG S QTC G CC CG ACYGATG GYTACT T TSCCGLYTA C NC S G G CTA S CAALG G A AA SP FCYGT GC CGT TA S DTST YCA C C G A GQTEPCSCISGVTY TACTGT TGT C QG C CT TMLC Q AACT QS S V CTCT ISG A G V G G C C C DIC R e di e e ede one e e3t cn 3cn it cn ic dicmntnRoeleRoeoe eAe1Roe e1RoD CcuuqeDniCd umicqle Lcuuqd u le LicqDcuniuqDdiH N S H A A S V N S V AeSCLNeSCLm AcA.9. . . . .20313233343 GCGCTC C G G A G C A A CCG A T D R G V NK HLC T A A GC CT TACTG AS S KTHTAG ATTGAGGGT T TC GGTC A C ATACC C CC CTT I TCTFS NVELE ECG T TKSV D H C GT T TC A G A G GTC C A CTR SPG RM TC G A CG C C A C GCTC G ATCTGSK DSVSTTG C CGTC AC GTTG C C C C GTG KPH C G G GGTG NVAGTG G VAL Y PPC C ATC C VLS C G AGG CC A C C C A A A C CCA C C C C G SPN WTF T A TG GTC C CGA C D AFC NF YV V AATG CG AA C C CGG A CCTA C V CY SIK N A CG ATC G G A A A GTGATG GCY PYTV QPG C CTCG A A GTC CA ATC GTTYGQ EEQ A CCTGA CCC G C C G ATC C GTC CAGT CGGTGKT T PRQGG DPWTC G A G C C AGTA C G SEG G GC G CCTG CT TC C C S ALQ R S H G S CGC AGAG A TTG C CCG C C GCG S S S K K G A C CCTA GCTGTATC G G G ATSSSV A DCC G A AC CAA C ACT TA G CTCAGAG T A C G C A C CCIAVPGKVTA G A C G A A A C A C GTC STVCGC V VLTVSV VI TC G G CCTVT LK C A GGA C A C A A CCATG G WTVC KS G C G CTTA CCTTTC A ATG G AEG ST EI YGCACCCAGC G C G A C A G A A ALQSLVP LF TATATGTGGTC A CGG A C A ATGGTA C A G G SESF TA CTG A C C G A KPG W YTPLS G GTTAACC ACCATA A CTA C A G A C CACGTA G C G AP Y LR Q G C C A D GSC C A GIK DCA CTTC G C C GATC CT AA G Q M S S MNS AAC ACC GA C G A GATC C A A C C R GLSDLCAC C CT TGCTG C AGA G G C A C V GQATC A AGA A AL TV VGC G C A G C WGYV D K CPTCAA C GATA A C C G G CTGG AS SA KCAC A C C A G G C AT TC M GPFPKPKY TT T TG G CCCTTTAA T ACC A G A G CAG C G G A A YGT P EKTG GTA G G A A G C A G CT YHPFKYCTCTACCC A A A A C CTC G G ACC A CS VAGA A G ATCCAF YV GLG N C FNAG GL N ECTAT AGGTC G GGTC G GTAPG S CFVTVPAGG ATC A G C C C A C G A C AGVLSCTTC A G A G A CPW D QCTGGCTG G CSR AGQ GTCCC0G C C C C A C CGA C G AGA A GAHN C C ATC3G CTC C G CTAC GA CTA C S VLSC CTG G1C AATA G C CAATGCC SYYNPPVE TC A AC C ACTA GTWT WC CTG AG CG A A CLVATG CCTALCG AGT TA A C GR ASPVE TA G GTC G CTCTC C G C CCC C A ATA CAGL TVA C GTA STCSV A GT TC GD V PVIA G C A C CATGC C ATG T GGG A C C ACG C A G ATGEAP PCTGPR EA G GC GA A AGTG C A QL PCV DCFTRTCG C HY SCTATTPY GA A CTC ATGCT T TG G C C A C GTCVSY TSF PGCC CTTG G A C C A A G AC GTG AGTGCT LN D KNGSTCTCG ATCTA G M K DYKLATCTG A C ATGTA AGGTGG QVC QVSLG G C AACCA GG A GTGTA CTGLLS CEL SA CGT TGTG CT TCCA GCGSYLK PEC T K C A C CG C A C G ACTGGTCE TGL ERP LQCTCG AC C A A C CTA GTCG C C GC LLN A VKS VT ATCTTAG GTG C G G GTK K C QAT T Y TCACA GTC C C C GVS K K Q H A CTC CGTG C A G C C C C C GEN G D A N N G G C C ecenditecyvni oetno nie eaea ni d uhmi q hgalcuq H C AcAeSiL hCuNeS . 0.414 T A A T C GC TLV KGG G T C G RCC C A CT TTFWTCGTA CA G SIG GC G A G AG DQ G GT T AATFA G AT TV C A ACC G K G CTC RCC G G A G A C A SA GTCC G G GTATG C A G GER CTAG K CTC G VCA G ACA A S GPC CTCTG G STC G G A GS YEFGGGTC C G T DA CC AF TG CTACA G N RTTCG R C G AYA GSNNFA G C CATYTAACTTCG APLLA S G A G A CTS CTC C A V A G G G CKG G A GG T GTAA S VTVGTG A G A G GT TCC GTC CQV SPCG A GGTS STA A ATT LASTA C A A A G S SAAG G C STSCT LCT C TTC AIVTA A A GSA G GT TG G G A S VCA A G C A S C G G G G G A YKLQ G C G G G G C VLTCGAIHC G W GGTATC C AAC AAL QTG G ALAAKEVGTCGEQ DEC ATALGCGGTCC CPG S C A CG CTG G KWGCTG A C ATC AG CAP AC GTTKPFYCC G GYV C C GT TAPDGG ATGGP IFK GCT TCTA MGTCGTC C KVH A C GAAA C Q G RATG G C G C C QSKTGTCG CTG VTG G A AQPEY TGATCGWYGTTC G CYA A D GTT TA G S SCGT T TW NVAGTCC G C AGM GAATA C C A C GLTK CTA CTA GYACC C AYR KSLTGTCCGYVCTCCAGSI TG ACTG S CSYTCTCTSIELLTG GTC CAFGAGC G C SKS A C G C GATTFVATC A C QTGVA C GSG G GTGRGCCGAG S G G A GLS C C GGT SA1TACA G R QYGATGTG C A C3GACACGFTGC G C CAAY1CAG ATCTITSTC C CT AC CYVAT TACA CT TLDC T C ACTSLAG C A VPKTS GTCT TG CRTCTC AAGG C T A C RGYC D ATA G GCLD C C D G G CA AT TSEAA GAA G Q QE C TGAACTGAA GGTCVT T TC C A GTGG RL TGGTT ACTS Q A CGACV C CTCTAPSCG G G AASYS GC QTAC CG C NGA AGC ALYE TSTQ CCT TC AVLMTSTATC GGG Q AC CTG GS AFG A ATC CTGLGA G G A C CPD N CTA G C C G GYCG A A AGSE G CG C A C GS LTGGGC GTCQT P S TGG G GTEN CCTTAATTG CQ QLGTA C CTLTGTG A G MLA GCA AQIS N ATCGTG G A CLKACTA Q STEN C C C C A C A DSID G C G CTA CVDCTecedi e ocni ecedi ethni o ntnieo nd uelemne1t cnRoecuA duDelcugaiL hmiC AcqAeH S VuqNeHiS VcqC AeS HuqNeS - 1 7 1 7 0 U A Y . 2.3.4.4 4 454TLTFDTGSGSGSFRSPVGYQLFSAGYILLKPAKGPKQQYWNLCYASKASIIE GSL TQKC CSTA G AR QTT T 33CG C CTI F TA1CCT TLTVPCTATTCRG CG CDY TA CG G A C CV Q C GS QC GGACT TSL YC G Y G A C T C ASTC NT TS AALC CP FCYCGS DQ ETS CST TYGLPT PCIC S C Q GGMQQLG Q GLFA CYGIS C S C S S G A G A A A Q DIC R G G C Qoni ecedi ececedi ececedi ecmnAe1to nuRele1uRo ntn e2 o n 2uReleuRo nne3to n 3uReleRodqDc qDi dqDc qDi dqDcuqni dLiVcAeSCL uNeSCLmiAcAeSCL uNemiSCLAcAeSCL uNeD miSCLAcA.2.3. . . . .5 54555657585 G G T G ACT C G A C C A A C G A A CGC RSGTA CGGTA A C CGA A G CCCTC GSTSGCTAA AT AAGCA AT T TATC C A CTA G AIGCA C ATTG A A G G GTK A AFSG CTC C GTA C CCCC G CCTTC CG GA C AGA A C A RSGCACGG ATC G A GPTAG GCTC G C A A GT TC A ATC G GAA G KALCTTG GC GG G A CCA C C A C GT TC A A C ATAA CGTG A V T C A C SPDFG C CTC GCA A C G ATC C C A A A G CAVGG G CA C ATC GTC C G A A GAC C C C AYSPCAC A C C CG CG GGATG A A A CYGA GG G ATG C CACT TATC G A A CGA GATKA G ATGC CA C G G GTC GGT TSTG G G GGG ATAAC C A GGG C A G C G SG A AGTC C C A A C C GAG G G C A G C S AA AC A GTC CA AC TA A C C A C A A A A A G C C C G S S CT TC A G A A G C ACC A AS VT TC A CC G G G C C G G CTC C A TCA A G G ATTCAGA GCG G G C G ATAIATC C S VLG G G CTGTC AGTGTG C C C CTAAC G G A C G A C VTC G AAATCGCTC CTG T C C C A GAC G A W G A C G AGTEQC ATATC G A G CCC C C CTA AGCCLGCGGTCTGC CC GG G G C C G C ATA C G G A A C C ATGTGWC CT GA GCG A A A C C KYCTGT T TA A TC AA A CTG AT TAGTA CAGGPD G CCG CTCCTA C GTG A MGAA TGTA C CCTC C G CTC C A A A C ACA Q G CTG CTC C G G G C A GTGTR GG CGTGGC ATGTG A G CGA C C A VGT ATA C GTC C ATGA A C A ATGTC WYT TC G G G C A G A GCT TC C A C GTGS SCC AGTA C C CTTG GGC A G AGCTM GTGA CTCCG AG GGGAGT TA C GTTTAA GYG CT TAACG A AGTG A CGT YVACTC C C G G C ATG A GTG A S GCGSYGTC A C CAC GCA GT TA CCGGTCFGC C GATG GGGTG C G CCTA GTCC TVG GTG ATC A C C C A A CGTC G G GT FVCATGTG C C G CGR GGTC G C C G CSA4TGTG C C AGA GTG C C C C C AGTA C3C G C C G C CTG C A G C A CCTG A AY1C C CATA G C GGC C A AC CACG CCCYT CC A CCTG A CTGCGT TCTACTSVTCT TG C CGC GGTGC A C C CTCLTC A GCGR ATATA GTGTCC C A CTT LDC GA ATC C CGA G G G CTCC G ACTSETGA TCA CTA G A A G G CTC C GTG GATC A A GTC G C C CGG G CGGGTG GG RCC TTG G CGTACT TC A GTA C C GP LCTC C C G A G G G C C C ACA C C C A C Q SAT TC C C A G G C A C GTC C CGTA CVNCTACTTA G CGTG A G A A C C GCA C C AGTG A G A ACA CTG G CLM A C GCG QTC A C GG G CT TC G G G GTCATC GTG GLYA C GCC G A A G C G ATCCGTG SLGC GTTA A A C C CAG AGTTT TA CE TTG GCTC C CTC C NTA C C A C GCC G C C CLK G G ATC C G G C G CCCCG ACLSCGTC CTA CGTGGT TGCTG G CTQ N C G CTC A A C G G C A GCT TCATCTA G C C A A GCTVED e ditecno nie e y nalhcu v iCuq a aNeSeHhC . 06KTH T L A CCTC CCTA CATTLVGG G TNVELE EG C A A T A A C A C GC TKTGA CSPV D H C G R MGT TTTC C A C C G CTGT FW C D Q GTCGTATK V G C A AGTV C A ACH DSPSTTTG A C G C G A G ATG KGG CTNVVYPC CTG C C C G G A G SAE TCC A G GN WLCIN T SYFATC G C A A C A VCG C GTTG C G C A G SR CT TC GCA GPCE TC CTGYFV NTA AA ATGCA AAGS YGGGTCTK Q G ATG CTC C G A GF FN RTC G G C VQTE PPEQ C CG ARQ A CTACA A G R NNC A A G C CGCTC CTTC G A GSPLFG A G ALDSE PQ WGTCCTGTAA G A VLS CKA A G G H R G G A GCTS S G STCC CTC AGVTGG G G K CGG GG T G AAYVVTG A G A ASV K A D GAG A CT T T TC QLSPSCTA A GPVGKVCA C ACC G C A ATFATSC CTA CTVSTTC A G ATAA G GTC S GLT CTGV VIT LG A K G G C A CTA A G A S GT TG GV VSC KC S C A G C C A G C A GY KQ G C C G G GST ELV IPYLG C GGSEFG C CTA A G G GI LHTG G GAC C CGTA A ALLQEVG ATCY PSFTAL TP CAGC C A L STA A AKDEG C ATATTTC A CG CCC CPS C A CGTG RSSQ G G C C GSIK DCATTTATGTG CTG A A C ACKP AC GTCCGPFYV C CGTQMNSLLSDTTVLACCAC G CTC AGTC GGP ITAT TGFK GCT TCA C KVH A C G A AVAD K V A C CPC A GGC G G C QSKTGTTGPKPKPGTTC C C C C A G CTG C CQPEY TGATA GATG G A AYA A D GTTAFTK YT T TCCGTTC G CWVAGT TC C G C AHP EKKVPFGYGG CTCGT T TN CLTK CTA C NTCGCTATA C GYRSLTGGCGL NN CTGTA ACA C C C A SKI TGTCTSFVLE C CATG A CTCCAG SIE LG ATCTLSWP TAGTATCTCTSLKTS A G C C CAPD Q A CGG A AGC C G C QTSG C GATG GQ GS AHNT TGGN VPLVSC C E CCCTA ATC A C G S GLG G C CG5AAC C G C A S C G ACG G R Q ACGYTG A G GTTGTC31WPT W C TTGGTAACG ATFTSTCGTCSAVP L E TCTG G A A CATC ITLDC T AC ATC V C S VTTC C AGT TA CTVPKT T T TVPPP VAVIGTG GA C G C A RGD ACT TA C CT GG CYS G D ACTC G A A C D G G CAEPCRS CTC C CAATC C G Q QE C TG GAAFTHYP TCCTC T C A A GAA V QT T TCAY T TSYFGPA ATTA G GTCSCV C CTCD KNGS GC CTGTA CTA SYSEGC AC CK DYKL TC C CTGTA C A GLYQTCCT TVLC QVS AT TCCG G G A C A STA STATC AC SGKELLLPEC ERPTSG G CTA AGL K A A C GAC CTG GSFG N ATC A G A CPS D Q C A CTA G A A CG GCTG C QESCG C AAAVKST CTCG C G A GGC AT T PQTGTG GTK KTVYK Q HATGT CTAG C MQL LG A C ACGTC A C CT TATG CQIS G NTGG D A N N C G A G A C CT TA A C DID G CTC G V N K H G GATT G SG C ecedi ece edi entnienc t codmiucqteh noieleu tni o nnieo neega c q h adiuqlcuq SiL hCuNe gSiL hm C AcAeH A A S VuNeS - 2 7 0 7 1 U D Y . 1.2.6 636 C T A ATG ATGLCTCGTT T TTFG CTCDTG A CTTTG C G CTC C S AGC G G CAAG S TATC G ATGA SA CGT FC CTC R A G CC ST CTGPV G G A G CGG G G S GAG A C A C CQLTC G A S A G A A C CSG G C G CAA A G C GGCTYCIGCTAC LT ATALCT KG ATT PA C G C ATACTK T C G CGAAC CPCAK G C C A C T C G Q C CAAQC G CYT TCTW G G C NCTG TCTGTA ALAA C CTA AYSK GCAG G C SIETTAT AAT ISLC AGG A GGA QKC CTTC CTA STGATC CCC G A Q C7CATCGR G3CTG GTCG1TC A A CTF ACIT TC CTG C A GATGTGTLT A A VPGCGATG A C G C C C RYCT A C CCD GTA A C G CAG Q C CCTATA V QC GTA A CTG S ACTC G CC CTGSYG C TCTCGLYA N G ATCTA STCLA G G CACS AAYC A AGTAP FCSCC C C ATC C G S DT TS AQ ECSIC T ACG T GTTCT PQ C S CQG QGLTC C T CTMLC CT TS A CA T QIS S S G A C S A G G C C C DIC R G Aecedoi ec ni ecedi ece edi enten ntncnt co m1 o 1ueleuAeuReleRoe2Ro nee2Roq c qdqDcuq Dni d uqlcunie L u e Lic e u emic eDuqeD m S V N S V A SCLN SCLA A SCLN SCLA . 1. . . . .72737475767GTG G T G ACT C CGA CGC C A A G C G A GTA GA CCGA A G GTCTATA AT T TA CTC C A C G ACC A GCA A CC TTG A G A CTC C C GTC A CTGA C T G CCC G GTC AG GCAC AGTCTAT CTG G ATT C C GC GG GTC A A G G CTGTG C A C C ACTC A T G C C GTC G A A A C GAA CTC G GTC GCTA C C A GTC A A GAA G C AAC C C G ATG A G CTAC C GTCTGGC G A A G A C A CA TC CATC G A G G G G G G A G GT AA C C A G T G A G AG GTC A A C A C C GGCTG A A A GTC CAC A A C A GAA A CTCTA A C CT TA C A G G C CTC A G C C C C A A A G G TTG G C G CTTC C GA A A G G G C C G CTCTGAGTC G C CTG G G GTG GA AGAG ATC GTA C A G A C GCT TC C CTTC C CGG C ATG G A G CCC C C CTA CG CG G G G CTC G G A A C C GT TG CG C A A C CT GA G C C CCT TATA A C G AT TAGGC GAT TCCA TA C A CTTG CCTG CTC A C T G A A C CTG C C A GT CC G C CTC C G G G T GTGT TG GGATGTG A A G GT ATA G GTC C A GTCGC A GT TC G G G C A A GTT TG C C C CCTTC A C A C G A C GCA A G CGC CTG TGTG AGA AGCTGTA C G A GT TC C GTA GG ACTC C A G C C A C A GGT TA G C CAG C GATC G G GGTG CTG A C CCG CTGG C A C CTC C G G A GGTAT GT TC C C A A CG GC G C C GTG ATG C83G TG C C G C A TTGCATA G CGTG G A G C1C C G C C A A C C TTTC TATACCG A CGTG A GCTTGTCGC GG CTGC G ACTC A G C C GTA GTGTCC GA GTA C C CGA G G G CTG GA T TA A G CTTTG ACA C G A G C C CCA GTTC GGC C CGG G G CTCTG A G CTACT TC A T AC CG C G G G C C C C ACCCT TC A G G C A C A C GTG GTATC A GGG A G A C C CGTTL ATC A CTG CP CTG C CTA A G GGTC GTC C A A G G C G GCG YTGC A GTG G G GCTA G A C C G CTTC ACC C CATG G G GCA C G A C GTC C C C G C Q ATCGGTC AGC GGTGC Q G CTC A C G CTA C GTC A G C ATGCT TCATeditececediteco ne3 o neo nelcuRniydu vnieleuuqNeD miSCLAcqAeaSeaHhcCuqNeS . 8.797 A AC A CGC D G V NK HCCCTC R SS KLC T A A T A A G T T HC TLVTAG ATC T G C C ATTATA G GA G G G AI TS NELE EC CG T TC G C GT FA A ATFKSV D H GT T TC G G A AG DGGA C A R SPG RM TC G A C C A G AT TG GATC C G A GSK DSVSTTG C C G G A A C A SG CAA G KPH NVPPC CTC C C C T A C A G GCGTC G A C VAYA SLVLS C G AGTG GCA SCCTC C A A C A A G DPN WTC CAFVC NF Y F T AV V AATGCA T G C C AAG G ATA C G A GSA C AIN AGA A GFG AYSAYK Q G CTCCR G A G CYP TVPC Q A CTCTTCA G A GSCTAG AT TS GQ EEQGCCTGTATCG APG C G ATC GKT PDRP TC A GCTCTC C A VG CG G G G AGTSGA A G CL EW G Q R G G GG T G AA G S C CYA S H G S CGA G A CT TCT TC CQACC A C G S S S K K G A C ACG A A ATT LATCCA ASISSV A DCTC G A ATAG G C SC G GTC AVT PV G VKV A G C C A CTA A GSC G A C SSTG C A CAGC A VTVILG G C G A AAA G C G A C VLV VTK C A C GGTA AA C G AGWTGG G GYG VC KES GCC C CTA A AAILA AGCTELS STI YLGACAGC C AA LC ATGCTG QLVE PF TTATTTCGC C A CKCTG A A C K G SCA A CPS GG WYYL TPFLS G A C GTTGTCTG APA G CTATGC C ACKTA CATGPD G RA C G ACA A M SSQ A I K DCC C CTC STAG C GGAGTTA GTTG CPC C A GTGQ R G S MN DA C CAC A GGC G C KCGA CTA V GQ LT SVLGC C G CTG G CCQAATG C T C WGLD K VTC A C GATG G AAQYA C GTGSYV AKCPPC ATCCGTTC G CWA GGCTM SP PK YTT TG CTCGT T TC C NG ATTTAPGFTKP EGTGCTTATA C GLAGTG CGT YDHPKKYCTGA ACA C C AYG A A SYGCGS VVFG N C CTGGATCAGSCTGGTCF YGLFNNCAT ACTC CTCTSIA GTCC TG S VLEP TA AGG A AGC G C SC G G GT FG V VTLSW QCTGGATC C A C QC C C G CC C C CSR APD GTC CTA CCC G G S G A9CCAGTA A GGCTG G A A C SAQ N C CCVHLSCATC GAGGTACG A A C G R3AC1TACTCCCYNPVECTGA C ACTSL YWPT WTG C A A CATCTC G C C AGT TCTITC C CTC TRV A SAP L E TA G GACA G C A VC C A C AT L TVCVS V GT T TA CTGG C C RCCTC G GCTSDTPVAIA G C C CC ATA C C DCGC T GGTG GEVP PV DCT G GGAE CTRSTA C CA AA GAA G CCTG ATA GGTCVG A C GPA C QRPF YT PY GTCTSA C C CLHA A C GTT AC A C AC C CGSY T FGCCGGA CCTA C CVLN S D KP TCT TG G G AASLA ATG GCG M K DNYGSLATCCA AGC A SA CCA AC GTK G QVC QVS G G CTA C CTG GSTTC G GGGLLSELLA AGTA G G A CPAGCCTATSYC KECSC CTC G A A C AGTSATTTC C CELTG P R TLKCA C A GGC CQCCG C C G CLL EVPS QTCTGT CTATG CTTG G G ACLN K A KKVTCYATA G C CTQ SATKTK Q HTC CTA CATCTA G M CTTGTG A G A A CQC A A GCTVEN G D A N N G G C C C C A C AID ecedi eyvno nt ce no neeainiead u thmi q hi l u tga cH C AcAeSiL hCuq hgNeSiL.0.1.8 828 T CC C A A G A C G A A CGC RS KH T L A C TAA CGA A G CCCTCST TNVELE EG ATCTATC C A CTA G G AIS C KSV D HGCA C ATTG A A G G GTA AFSPC G R M GTTC A CCA C A A K V C G CTGCGGGTA C A R ASPH DSPSTGAGCA TA C G GVTTGTGTC A A C G G CAA G KALNYPLC S CTG C A CCA C A CGTG A VPV A N WTFGA A C ATAA CTC A A C S DFC NYVCTACTA A C G C ATC C C A A G CAVI FV N AATC C GC GAT TCG A GAC C C C AYSPYTK V Q G A C T G AGATG T C G A A A A G CYGQ E PEQ C C A CGAG ATSKT PRQ A CGCTCA C G A G GTC GT TGTG DPWGTCA AAA C C GGG C A G C A G S AL EQ H R G GC C A C C A GAG G G C C S S S S S G S K K CGATAA C A G A A A A G C C C G SSV A D GAACTC C A A G C ACC A C ASIVPGKVCCCTCA A A G G ATGAGA G G G T C G GTA ATVC G A C C V A SLTVSTTA G V VIT LGTGTC A G C C C CTCAGA C G C VTV VKK G S C A C A G C AAC G AGW G SCT EI YG C CTC G A CTA AG EQSCL L LCG C C CGA C CTVE PFG AG C C G GTG S SFTAC ATC A A C C A G A ATG KW Y PTPSTAC C A AT GA GCTG C A A CGY LRLQ G G GCTG AT TAGTCA CAG GPD GSK D CTG CCTG C CTC GTA A M SCA SIMNSTCC G C C C A G A A C ACTGQ GQ LSDLAACTATC G C G A G C C A G R G A CT L TV V C A CC C ATA GTG A G AGGC GTC ATG C A VGYV D KP GC C A C GTC W SA KC KP TCAC ATTG C C A GTGTS GPFPKY TT T TGCTGG GA A AGTCTA M AGT P EK GGTGGAT TA C GGGTGY YHPG AAC C ACATGA GAFKY TGTGTA CTSVGGT T YVLG N CCGCTG CTA CCA GCCTGGTGSG GFNLN C C CFT S VTVEPCATAG C A C G CC C A A CTA GTGCG GT FVLSPW D Q AGT G C G G C C G CGR AGQ GCTG C C GACGA GTA G C C C C CGSAGAHNTC C C3G C C CCG ATA CCTG C C A ACTCG A AYSN VLSCA 41CYPPVECTA GGTC A GCT TATCCTSV WA TLWTCGC C G GCTGC A C ACTCLASPVEC CTA GGTGTCC C C C CT RTVTCSV AT TCCGCTA G A G A G GTC C A A C GCTC G AT T LS DV PV IG G C GCTG GEAP PV D ACTGCGC C CC GG C T G G CGGGGTATG G C GGPR E CLPFTRS CH YTT PCYCTGTATG C C C C A A C C C A C Q SY TSFGPA A C C ACTC C CGA CVN D KNGS GCG C AACG A A C G G A CCTG CLM K DYKL TCTA C C C AGG GTGA A T A CTG GCG QVC QVS ATAAC GTGLLSELLS G G AC C A A G G C G CT TC C GGGYLC KEC K AA G C C G AG T CTATSTGLPER TLC GA A CAG A CE PQCA C CGCT T TC C N A V STGTC C C G C G C C G CLTC G C AG CG CCTTGTCTG G G ACLK SATKKVY TCKTK Q HAAT TC G C CTQ N G D A N N A C G C A GCTCATCTC A A GCTVED G V N K H G G ecyvno neaiea ni d uqthniaHhmigC AcAeSiL hC .0.01101 ATA T A A C G T CTLV KGG G T G DTCC RTTC C C A CTTFWTCGAA GASITC G G A GTAG DQ GTCGT TATA C C G A G AT TG V C A ACCFCTC RG CCCC G G A G K A C A SA GTG C G G GCTC T AAG G C A G GECCTATG G K VTGTA GCA SGTCTC AAG GRPC CTCTC G G S G AS YEC GGTC GTDG AA C G A AT TGF FN RTG C G G CTAYCC CCTCG G R S NNC A A G CA YTGTTAAA A CTCG CPLVL FCTS G A A G A G CTSA G CTC CKA G A GG GTAG AG T G AA G VTGG T G G A G GGC CT T T TC W V SVPCG A A GGACC G CT YA A ATQL ASTA A A A G SG AT TAAG G CF TSLC CTTC ASISAC C CTA A G S G GTTCTG G G AVTG C C A A G C A A G S K Q G C C GGTS VGGCTACC CGG G T A A GYC AAAI LHG G G G V LQTG GAC GLTAGTC C A AL EVEG ATCG W ETG ATCLQCTTCG CC CKPD G C S C CG CG G GTTACTGTCGCTG A A C A AP AC GT TTCC GKWAG CTKP YC C CT TAGP YG C GG ATGG FIV K GC GC ATCTA D GT TC CPKFV H ATGAAG Q MC C CGTG G C QSK CTGTA G C T R GG CAG G C C A AQPEY TG C AT TV GA GTCC TG TYA G WGGC G CTA DG TT TA G C G G SYCTCT TWVATM SCTAGTA C C NCLTK CTC A C CPGGTTA ACA C G C AYRSLTG ATCGYGGTGATACTCCC CTA CGSKI TGTTS CTG C SYIE LG ATCA SFVYG A AGC G CSLKTS A C C C CTTGGGATC C A CE TSG GAGCGTGFVGTAGCCC G G S GLCTGGTGS V R4TC GAGGTACG G A A A C G R Q S Y GAGTG C A A4ACGTGTG CAA C1GA A C G GATCTFTSTG C C C CT ACYC C A AT TA C CTIATLPD KCTTTAAGCTSL YVG GT TACG VTTG CR ACC CTG C RGTCC A GTA CYS G D ACT TG A GCL TC C D GC A CTSDTCTTA AG Q G A A GAA GE CT AATCGEGGTCV QT TTGCTGT CA GTTGATC CACTS Q V CTGTA CGACTCTG APRSYS GCC CG C QLCSTT TCCG G G AA LYE TAT TC AVLNGCTA AGC A STQ CCTAC GGG MTAG AT TC CTG G A G G A CSPAFS GTTC A CTG Q C D N A CTA G C C G GLCG C G A A CGA GGC AGGTSE GCQT P SCG TGC A C GSYCG G GTELT TTTATCTATCTATG CQ QLGTA C CTLG A G MLA GCCTTGTA AQIS N ATCGTG G A CLNACTA Q KTES G C C C C C A C A DSID G C G CTA CVNCTeditececedi e onei edio neleu tni o nt cn eo ncue emnAe1tRoec hi d lcu d uDluqNe gaSiL hmiC AcqAeH S VuqNeHi qCcS VcAeS HuN - 1 7 2 7 1 U B Y .2. . .0304 51 10101TLTFDTG S G S G SFR SPV G S QLS S A A YILLKPA K GPK Q QYWA NCALAAYACSKTSIGETAISLCA QKCA STAG A GT T 6GR Q C C4TCG G A A1CTFTC GAITATLPG ACTTTA V RG CG CC DY TA CCAG G A C C CA V Q CGG S QCT TG GG ACCGSYY G C C AAALSTN GCS AC F ALATYC CAPCSCGTG S DGQCTETPCSTG CIC SLPS CQLG AGTTMQLGTQIS C Q SGS CYG S G ATC S A A A Q C DIC R G A C Q o ni eceditececeditececeditecmn 1 o n 1 n 2 o n n o nAeuReleuRoneRe e2Roe3Re e3RodqDc qDi d uq Dlcuq Dni d uqlcuniLic eCu eCmic eCu eCmic eDuqeD m V A SLN SLA A SLN SLA A SCLN SCLA .2. . . . . .13 4 5 6 7 81111111111111GTG G T G ACT C C A A G A CGA CGGTC C G A A CGC D A A R C CGA A G CCCTC GSGTC AC GT T AA AGT T TATC C A CTA G G AIACA GCA C ATTG A A G G A A ATFG A C CTA CCA C A CTC G CTTG C GG GA C A R GCTC CG GCACGG ATC G A G CCTAG G C A AT TC A ATC G G CAA G K C CTT C GC GG G G C A CCA C A CGTG A V T G CTG GT TA A C ATC T G C C CTC GCA A C GAA CTA A C S G C ATC C C A A D C C G G ATC G CTC G A G A GAC C C C AAYA G C CATA C C CG CGGATG G A A A G CYG A G A C CACT T TATC A A CGTAG ATA A G G G G A G A GCTCA C G A G G C GT TS C T G G G GGG A AAA C C GGG C A G G G AGCA G A AGTC C C A C C A GAG G G C CYTA A GTC C A CA AA C A G A A A A C C C G CTCTA C C A C CTCTC A A G C ACC A ASTCTC GTG G G CT C CA A A G G ATGCTAIA C C GGCT T AGA G G G T C G C C G A C A S G G G GTTTCGGTG C C CAGA C G C V G GAC G GC AT TC A CTC T C A G C C A GAC G A C G AGW G ATCTC C C C ATEG C ATC G A G C G CCC G GTA AGTC GCLA CG CC GT TG G G C C CC GC ATC TCG A C A A C A A ATG C C AT GA GCTG C K A A C G G ACTATA C G ATTGTCTA C ACTAGTCA CAGGPCTG CTG C CTC GTA A CTGAAA G CT TC G C C C A A A C ACTGQ GTGC C G CTC C G G C A G C A G CTR T G CTTTGGATG CTTG A G AGA C A V GT ATA G GTC A G GC GTC A ATG CTC W GTC G G G C A ATTG C C C A G GGTGTS T CCC A C A C TTAC G A CGC CTG TGTGGAGTGTA A A C GGTC GTTA M GPYGGT TCTG C C G AACTG A AGATA CTS G ACTC C A G C C A A GGT TG C A GCGSA C C CATC G GCTG CTA CTGGTC CFG C GAGCCTGTGG TA GTG C A C G CCC C A A CTA GTGCAGGTGTC C G C C GG GG C G GTTFT TC C C C G CGC C CGS 7G GTG C C C G C AGA G A G C CCG ATA41TG G C C C CACTA TTAAGCG CTG C C G A A C T G CCTCG A A C C A GGGC CTC G A GCGC GT TATCCC A C ACTTCSLGTCTT TG C GTA GGT T TCC C C CT RATG A A GCA CGG A G GTC C C A AT T LG CCGACT TC C CTA A G A C GCC G GCS G TTT G A GTA C G C C CTCATG C GGCC GG CTC T G G CGGGTG G GTATG GGPGTG CTATC A C C CTC A T ACTCG C G G G C C C A C C A C Q C C ACTC C CGA CVCC ATC C A G G C A A A C G G A CCTG CLGT TA GGG A G C C CGTGA A CTG GCG ATTC A CTG CTA A G GTAA ATC GTG C G C C C GTC C C A A G G C G CTC CCGGG C G TGC A GTG G G G CTTA G T C A A C C G C C C CATG AG TTATSG AT TC C CELGCTA C CGG G A C G C A CTA CGTC C C C GCG C C C G C C G C G ACLATT GTGCTG GTQ A C GTC A G C G C G C ATGCT TCATCTA G C C C A A GCTVEecedi ent ce y no nee ydiucqvaialcu vaAeSeHhCuqNeSeH .9.10121 NHK HLC T A A T A A T C GC TLVVTKGG G LAG C ATTG T C C ATTF TCGAEVE EG D H CGTTTC G C A GTD W Q GTCRMG CT TA C G C G G A AGT TV C G A ADSVTTG G C A C C G G A G G KGG CVY PS P CTTC C C A A C A S GAE TC CC AWLC AGC GTT SFCAATGTG C A C A G ACG A A SR CTCTG GPCE TCTNF YVTAATG CTC G A GS YFGGGTCK V N A CG ATA C C A A GFN RTC G GV QE PG C CTP EQ A CCC C T GTTCG R TAAA GSNNA G C C G APLL FS G A GD RQGTC A GCTE PW G CTC C A V CKA A G G Q R G G GTGT G AA G VT...
Claims
Claims 1. An antibody or antigen-binding fragment thereof that specifically binds to transforming growth factor beta receptor I (TGFβR1), wherein the antibody or fragment binds to a region comprising amino acid residues 126 to 133 of TGFβR1.
2. The antibody or antigen-binding fragment thereof according Claim 1, wherein the antibody or fragment reduces and / or inhibits proteolytic cleavage of TGFβR1.
3. The antibody or antigen-binding fragment thereof according to Claim 1 or 2, wherein the antibody or fragment reduces and / or inhibits the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell.
4. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody or fragment reduces and / or inhibits the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell with an IC50 of 100 nM or less.
5. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the equilibrium dissociation constant (Kd) between the antibody or antigen-binding fragment thereof and TGFβR1 is less than or equal to 1 x 10-8(M).
6. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody or fragment comprises: a) a heavy chain complementarity determining region 1 (HCDR1) sequence of the VH domain of SEQ ID NO: 4, or a variant of the HCDR1 sequence comprising up to 2 amino acid substitutions; and / or b) a heavy chain complementarity determining region 2 (HCDR2) sequence of the VH domain of SEQ ID NO: 4, or a variant of the HCDR2 sequence comprising up to 3 amino acid substitutions; and / or c) a heavy chain complementarity determining region 3 (HCDR3) sequence of the VH domain of SEQ ID NO: 4, or a variant of the HCDR3 sequence comprising up to 5 amino acid substitutions.
7. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody or fragment comprises: i. a HCDR1 comprising the sequence of SEQ ID No: 6 or a variant thereof comprising up to 2 amino acid substitutions; and / or ii. a HCDR2 comprising the sequence of SEQ ID No: 8 or a variant thereof comprising up to 3 amino acid substitutions; and / or iii. a HCDR3 comprising the sequence of SEQ ID No: 10 or a variant thereof comprising up to 5 amino acid substitutions.
8. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody or fragment comprises: i. the HCDR1 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20; and / or ii. the HCDR2 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20; and / or iii. the HCDR3 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20.
9. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody or fragment comprises: a) a light chain complementarity determining region 1 (LCDR1) sequence of the VL domain of SEQ ID NO: 12, or a variant of the LCDR1 sequence comprising up to 3 amino acid substitutions; and / or b) a light chain complementarity determining region 2 (LCDR2) sequence of the VL domain of SEQ ID NO: 12, or a variant of the LCDR2 sequence comprising up to 3 amino acid substitutions; and / or c) a light chain complementarity determining region 3 (LCDR3) sequence of the VL domain of SEQ ID NO: 12, or a variant of the LCDR3 sequence comprising up to 1 amino acid substitution.
10. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody or fragment comprises: i. an LCDR1 comprising the sequence of SEQ ID No: 14 or a variant thereof comprising up to 3 amino acid substitutions; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 16 or a variant thereof comprising up to 3 amino acid substitutions; and / or iii. an LCDR3 comprising the sequence of SEQ ID No: 18 or a variant thereof comprising up to 1 amino acid substitution.
11. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody or fragment comprises: i. the LCDR1 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20; and / or ii. the LCDR2 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20; and / or iii. the LCDR3 of any of antibodies YU772-F11, YU772-G12, YU771-A01, YU772-D10, YU771-E01, YU771-B12, YU772-G04-VH / YU771-A09VL, YU772-H05, YU772-D10VH / YU772-C01VL, YU772-A11, and antibody 19 as indicated in Table 20.
12. The antibody or antigen-binding fragment thereof according to any one of the preceding claims, wherein the antibody or fragment comprises a VH domain which comprises i. an HCDR1 comprising the sequence of SEQ ID No: 126; and / or ii. an HCDR2 comprising the sequence of SEQ ID No: 128; and / or iii. an HCDR3 comprising the sequence of SEQ ID No: 130; and a VL domain which comprises i. an LCDR1 comprising the sequence of SEQ ID No: 134; and / or ii. an LCDR2 comprising the sequence of SEQ ID No: 136; and / or iii. an LCDR3 comprising the sequence of SEQ ID No:
138.
13. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody or fragment comprises a heavy chainvariable domain amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 4, or a heavy chain variable domain amino acid sequence that is at least 80% identical to SEQ ID NO: 4; and / or wherein the antibody or fragment comprises a light chain variable domain amino acid sequence which comprises the amino acid sequence of SEQ ID NO: 12, or a light chain variable domain amino acid sequence that is at least 80% identical to SEQ ID NO:
12.
14. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody or fragment comprises a heavy chain variable domain amino acid sequence which has the amino acid sequence of SEQ ID NO: 124; and / or wherein the antibody or fragment comprises a light chain variable domain amino acid sequence which has the amino acid sequence of SEQ ID NO:
132.
15. The antibody or antigen-binding fragment thereof according to any of the preceding claims wherein the antibody or fragment binds to a region comprising amino acid residues 118 to 133 of TGFβR1.
16. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody has a heavy chain constant region that is IgG.
17. The antibody or antigen-binding fragment thereof according to any of the preceding claims, wherein the antibody has a heavy chain constant region that is IgG1.
18. The antibody or antigen-binding fragment thereof according to any of the preceding claims, having a heavy chain amino acid sequence of SEQ ID No: 20 and a light chain amino acid sequence of SEQ ID No:
22.
19. The antibody or antigen-binding fragment thereof according to any of the preceding claims, further comprising a detectable moiety.
20. The antibody or antigen-binding fragment thereof according to Claim 19, wherein the detectable moiety comprises a fluorophore, an enzyme, or a radioisotope.
21. The antibody or antigen-binding fragment thereof according to any of the preceding claims, conjugated to a therapeutic moiety, such as a cytotoxin, a chemotherapeutic drug, an immunosuppressant or a radioisotope.
22. An antibody or antigen-binding fragment thereof, optionally according to any of the preceding claims, that specifically binds to transforming growth factor beta receptor I (TGFβR1), wherein the antibody or fragment binds to the region comprising amino acid residues 126 to 133 of TGFβR1, and wherein the antibody or fragment competes for binding to said region of TGFβR1 with any of the antibodies defined in any of the preceding claims.
23. A pharmaceutical composition comprising an antibody or antigen-binding fragment thereof as defined in any of the preceding claims, and a pharmaceutically acceptable carrier, excipient or diluent.
24. A method of formulating an antibody or an antigen-binding fragment thereof into a pharmaceutical composition comprising mixing the antibody or antigen- binding fragment thereof as defined in any of Claims 1-22, with a pharmaceutically acceptable carrier, excipient or diluent.
25. An antibody or antigen-binding fragment thereof as defined in any of Claims 1- 22, or a pharmaceutical composition as defined in Claim 23, for use in medicine.
26. An antibody or antigen-binding fragment thereof as defined in any of Claims 1- 22, or a pharmaceutical composition as defined in Claim 23, for use in treating and / or preventing a disease or disorder mediated by the proteolytic cleavage of TGFβR1.
27. A method of treating and / or preventing a disease or disorder mediated by the proteolytic cleavage of TGFβR1 in a subject, the method comprising administering an antibody or antigen-binding fragment thereof as defined in any of Claims 1-22, or a pharmaceutical composition as defined in Claim 23, to the subject.
28. Use of an antibody or antigen-binding fragment thereof as defined in any of Claims 1-22, or a pharmaceutical composition as defined in Claim 23, in themanufacture of a medicament for treating and / or preventing a disease or disorder mediated by the proteolytic cleavage of TGFβR1.
29. The antibody or antigen-binding fragment thereof for use according to Claim 26, or pharmaceutical composition for use according to Claim 26, or the method of Claim 27, or the use of Claim 28, wherein the disease or disorder is cancer.
30. The antibody or antigen-binding fragment thereof for use according to Claim 26, or pharmaceutical composition for use according to Claim 26, or the method of Claim 27, or the use of Claim 28, wherein the disease is fibrosis.
31. The antibody or antigen-binding fragment thereof for use according to any of Claims 26, 29 and 30, or pharmaceutical composition for use according to any of Claims 26, 29 and 30, or the method according to any of Claims 27, 29 and 30, or the use according to any of Claims 28-30, wherein at least one further therapeutic agent is administered to the subject.
32. A method of identifying an agent for use in treating and / or preventing a disease or disorder mediated by the proteolytic cleavage of TGFβR1, the method comprising: providing TGFβR1 or a portion or variant thereof, said portion or variant comprising amino acid residues 126 to 133 of TGFβR1; providing a candidate agent; and determining whether the candidate agent reduces and / or inhibits proteolytic cleavage of TGFβR1, or said portion or variant thereof, wherein proteolytic cleavage of TGFβR1 is in a region comprising amino acid residues 126 to 133 of TGFβR1.
33. The method according to Claim 32, wherein the candidate agent is tested for efficacy in an animal model of cancer.
34. Use of the antibody or antigen-binding fragment thereof as defined in any of Claims 1-22 to reduce and / or inhibit proteolytic cleavage of TGFβR1; and / or to reduce and / or inhibit the translocation of the intracellular domain (ICD) of TGFβR1 to the nucleus of a cell.
35. A kit comprising an antibody or antigen-binding fragment thereof as defined in any of Claims 1-22, or a pharmaceutical composition as defined in Claim 21.
36. A nucleic acid molecule comprising a nucleotide sequence encoding the antibody or antigen-binding fragment thereof as defined in any of Claims 1-22.
37. A nucleic acid molecule according to Claim 36, comprising a nucleotide sequence that is at least 80% identical to the sequence of SEQ ID NO: 3 and / or a nucleotide sequence that is at least 80% identical to the sequence of SEQ ID NO:
11.
38. A vector comprising the nucleic acid molecule as defined in Claim 36 or 37.
39. A host cell comprising the nucleic acid as defined in Claim 36 or 37 or the vector as defined in Claim 38.
40. A method of producing an antibody or antigen-binding fragment thereof as defined in any of Claims 1-22, the method comprising expressing a nucleic acid molecule as defined in Claim 36 or 37, optionally comprising culturing the host cell as defined to Claim 39, and further optionally comprising isolating the antibody or antigen-binding fragment thereof from the host cell.
41. An antibody or antigen-binding fragment thereof, pharmaceutical composition, method, use, kit, nucleic acid molecule, vector or host cell substantially as described herein, with reference to the accompanying description, examples and drawings.