Lymphocyte potency assay

Abstract

The present disclosure relates to methods and materials useful for measuring the anti-tumor efficacy of lymphocytes (eg, tumor-infiltrating lymphocytes).

Description

[Technical field]

[0001] Related Applications This application claims the benefit under 35 U.S.C. §119(e) of U.S. Provisional Application No. 63 / 241,768 (filed September 8, 2021), U.S. Provisional Application No. 63 / 291,655 (filed December 20, 2021), and U.S. Provisional Application No. 63 / 391,118 (filed July 21, 2021), each of which is incorporated by reference in its entirety into this specification.

[0002] Electronic sequence listing The contents of the electronic sequence listing (K071370018WO00-SEQ-HJD.xml, size: 21,568 bytes, created on September 7, 2022) are incorporated by reference in their entirety into this specification.

[0003] The present disclosure relates to methods and compositions useful for assessing the anti-tumor efficacy of lymphocytes (eg, tumor-infiltrating lymphocytes). [Background technology]

[0004] Lymphocytes are white blood cells essential to the immune system. Tumor-infiltrating lymphocytes (TILs) are white blood cells that have left the bloodstream and migrated toward tumors, including T cells and B cells. The presence of lymphocytes in tumors is often associated with improved clinical outcomes, and lymphocytes such as TILs are indeed involved in killing tumor cells. Lymphocytes are commonly used as adoptive cell therapy (ACT) for the treatment of certain types of cancer. For example, adoptive transfer of TILs is a powerful approach for the treatment of enlarged and refractory cancers, especially in patients with poor prognosis. In ACT, cells are expanded ex vivo and their efficacy must be characterized before being reinfused into the patient.

[0005] TIL potency assays measure significant direct or indirect biological activity specific to TILs, which is particularly important for ACT using TILs, given the wide heterogeneity of TIL / tumor specificity among patients. Furthermore, TIL potency assays are mandated by the US Food and Drug Administration (FDA) to ensure the quality of individual TIL products that may be used in ACT.

[0006] Importantly, not all TIL potency assays are considered biologically meaningful depending on the biological context of the assay or the assay endpoint. Increasing regulatory guidelines require that TIL potency assay values ​​correlate with in vivo functions (e.g., tumor recognition and cell death) to lead to clinical efficacy. Although assays may use non-cell-based TIL stimulation approaches and be based on T cell properties that are surrogates for cytotoxicity (e.g., using interferon-γ (IFN-γ) release assays to assess TIL potency), in vitro TIL potency assays based on tumor cell-mediated TIL activation may more accurately represent TIL potency, and when surrogate endpoints including cytotoxicity or IFN-γ release are used, this assay is considered in the art to be the most clearly correlated with clinical efficacy (see, e.g., de Wolf et al. Cytotherapy 2018 May;20(5):601-622). Currently, such biologically meaningful TIL potency assays are limited within the field. Summary of the Invention

[0007] The present disclosure provides lymphocyte potency assays (e.g., TIL potency assays (also referred to herein as TIL anti-tumor potency assays)) that can be used to evaluate the ability of lymphocytes to generate clinically relevant anti-tumor responses. In some embodiments, the present disclosure provides immortalized cells (e.g., tumor cells) that contain molecules that activate lymphocytes (e.g., molecules that activate T cells (e.g., molecules that bind to T cell antigens)). This interaction between immortalized cells (e.g., tumor cells) and lymphocytes can be used to evaluate the efficacy of lymphocytes as anti-tumor therapy, for example, against cancer. Prior to the assays described herein, the majority of lymphocyte (e.g., TIL) potency assays were based on non-cell-based lymphocyte activation and cytokine (e.g., IFN-γ) release assays as a measure of lymphocyte activity and could only be considered as physiologically irrelevant stimuli to examine cytolytic function.

[0008] The present disclosure provides data showing that tumor cells (e.g., human melanoma A375 cells) engineered to express membrane-associated anti-CD3 (OKT3) antibody can be used, for example, to activate the anti-tumor function of TIL. OKT3 is an activating antibody used to activate lymphocytes, and is in soluble form or bound to beads and tethered to magnetic beads. Unexpectedly, the method of reducing the affinity of A375-pKSQ367 cells to TIL by incorporating a mutation in the OKT3 antibody that reduces the affinity of the membrane-associated binding domain to TIL serves to improve the usefulness of the assay to evaluate the potency of TIL, for example, in a three-dimensional in vitro tumor spheroid functional assay.

[0009] The present disclosure also provides data showing that, in some embodiments, two-dimensional monolayer cell cultures are better suited for evaluating antitumor activity of lymphocytes, while in some embodiments, three-dimensional multi-layer spheroid cultures are better suited for evaluating the functional properties of different lymphocyte populations (e.g., edited and unedited TILs). The spheroid setting described herein enabled the identification and evaluation of multiple aspects of TIL function / biology, including cytotoxicity, cytokine production, proliferation, and phenotypic changes. On the target side, the spheroid dimensions provide a higher level of cell-cell contact and interaction that is closer to what occurs in vivo. Without being bound by theory, the potency assays provided herein provide a sophisticated yet complex cellular microenvironment to use for comparing and contrasting changes in morphological and other cellular properties.

[0010] Aspects of the present disclosure provide a method for assessing the efficacy of a lymphocyte (e.g., a T cell), comprising co-culturing a lymphocyte (e.g., a T cell) and an immortalized cell, where the immortalized cell comprises a molecule that activates the lymphocyte (e.g., a T cell), and assessing the efficacy of the lymphocyte. In some embodiments, the lymphocyte is not engineered (e.g., does not comprise a non-natural genomic modification).

[0011] Another aspect of the present disclosure provides a method for assessing efficacy of TILs, the method comprising co-culturing the TILs and engineered tumor cells, where the engineered tumor cells comprise a molecule that activates T cells, and assessing efficacy of the TILs.

[0012] Yet another aspect of the disclosure is a method for assessing efficacy of a polyclonal T cell, comprising co-culturing a polyclonal T cell and an immortalized cell, where the immortalized cell comprises a molecule that activates the T cell, and assessing efficacy of the polyclonal T cell.

[0013] In some embodiments, the molecule binds to a T cell antigen. In some embodiments, TILs express a T cell antigen. In some embodiments, polyclonal T cells express a T cell antigen. In some embodiments, the T cell antigen is a CD3 antigen. In some embodiments, immortalized cells express the molecule.

[0014] In some embodiments, the molecule is an antibody or an antibody fragment. For example, the antibody fragment may be selected from a single chain variable fragment (scFv), a F(ab')2 fragment, a Fab fragment, a Fab' fragment, and an Fv fragment. In some embodiments, the antibody fragment is an scFv. In some embodiments, the antibody or antibody fragment is an OKT3 antibody or an OKT3 antibody fragment, respectively. In some embodiments, the OKT3 antibody fragment is a membrane-bound OKT3 (mOKT3) scFv. For example, the mOKT3 scFv may be a low affinity mOKT3 scFv variant.

[0015] In some embodiments, the molecule binds to CD3 with a dissociation constant (KD) lower than the KD of mOKT3 scFv, where the KD of mOKT3 scFv is about 5×10 -10M. In some embodiments, the low affinity mOKT3 scFv variant comprises an amino acid sequence having mutations R55 and Y57 relative to the amino acid sequence of SEQ ID NO:2. In some embodiments, the low affinity mOKT3 scFv variant comprises an amino acid sequence having mutations R55M and Y57A relative to the amino acid sequence of SEQ ID NO:2. In some embodiments, the low affinity mOKT3 scFv variant binds to CD3 with a KD that is at least 250-fold lower than the dissociation constant KD of mOKT3 scFv. In some embodiments, the low affinity mOKT3 scFv variant comprises an amino acid sequence having mutations R55L and Y57T relative to the amino acid sequence of SEQ ID NO:2. In some embodiments, the low affinity mOKT3 scFv variant binds to CD3 with a KD that is at least 1000-fold lower than the dissociation constant KD of mOKT3 scFv.

[0016] In some embodiments, the molecule is selected from phytohemagglutinin (PHA) and concanavalin A (ConA). In some embodiments, the molecule is a bacterial superantigen, such as Staphylococcal enterotoxin B (SEB). In some embodiments, the molecule is a membrane-tethered molecule.

[0017] In some embodiments, the TILs are engineered TILs (eTILs). In some embodiments, the eTILs are edited eTILs. In some embodiments, the edited eTILs comprise a genomic modification.

[0018] In some embodiments, the polyclonal T cells comprise neo-antigen-specific T cells.

[0019] In some embodiments, the polyclonal T cells are derived from peripheral blood.

[0020] In some embodiments, the polyclonal T cells are derived from bone marrow.

[0021] In some embodiments, the immortalized cells comprise a clonal population of immortalized cells. In some embodiments, the immortalized cells are immortalized human cells. In some embodiments, the immortalized cells are engineered (e.g., human) cancer cells. In some embodiments, the engineered cancer cells are selected from engineered melanoma cells, engineered colon cancer cells, engineered cholangiocarcinoma cells, and engineered breast cancer cells.

[0022] In some embodiments, the co-culture is carried out for at least 4 hours (e.g., about 4-6 hours, about 4-8 hours, about 4-12 hours, about 4-18 hours, or about 4-24 hours). In some embodiments, the co-culture is carried out for at least 12 hours. In some embodiments, the co-culture is carried out for at least 24 hours, at least 48 hours, or at least 72 hours. In some embodiments, the co-culture is carried out for about 1 day, about 1-3 days, about 1-4 days, about 1-5 days, about 1-6 days, or about 1-7 days.

[0023] In some embodiments, assessing efficacy involves measuring surrogate markers of TIL responsiveness to the tumor, including release of effector cytokines (e.g., IFN-γ) or expression of CD107a. In some embodiments, assessing efficacy involves measuring growth of the immortalized cells. In some embodiments, assessing efficacy involves measuring cell death and / or viability of the immortalized cells.

[0024] In some embodiments, the measuring comprises performing a cell viability assay. In some embodiments, the measuring comprises performing a cytotoxicity assay. In some embodiments, the measuring comprises performing an assay selected from a real-time cell viability assay, an ATP cell viability assay, a live cell protease viability assay, a tetrazolium reduction cell viability assay, a resazurin reduction cell viability assay, a dead cell protease release cytotoxicity assay, a lactate dehydrogenase release cytotoxicity assay, and a DNA dye cytotoxicity assay.

[0025] A further aspect of the present disclosure provides a method for assessing efficacy of tumor infiltrating lymphocytes (TILs), comprising co-culturing a clonal population of TILs and engineered cancer cells, where the engineered cancer cells express an anti-CD3 antibody or an anti-CD3 antibody fragment, and assessing killing and / or survival of the engineered cancer cells.

[0026] In some embodiments, the TILs express the CD3 antigen.

[0027] Yet another aspect of the present disclosure provides a method for assessing efficacy of polyclonal T cells, comprising co-culturing a clonal population of polyclonal T cells and engineered cancer cells, where the engineered cancer cells express an anti-CD3 antibody or an anti-CD3 antibody fragment, and assessing killing and / or viability of the engineered cancer cells.

[0028] In some embodiments, the polyclonal T cells express the CD3 antigen.

[0029] In some embodiments, the engineered cancer cell expresses an anti-CD3 antibody fragment. For example, the anti-CD3 antibody fragment can be an anti-CD3 single chain variable fragment (scFv). In some embodiments, the anti-CD3 scFv is mOKT3 scFv. In some embodiments, the mOKT3 scFv is a low affinity mOKT3 scFv variant.

[0030] In some embodiments, the low affinity mOKT3 scFv variant binds to CD3 with a dissociation constant (KD) lower than the KD of mOKT3 scFv, where the KD of mOKT3 scFv is about 5×10 -10M. In some embodiments, the low affinity mOKT3 scFv variant binds to CD3 with a KD that is at least 1000-fold lower than the dissociation constant KD of mOKT3 scFv. In some embodiments, the low affinity mOKT3 scFv variant comprises an amino acid sequence having the mutations R55L and Y57T relative to the amino acid sequence of SEQ ID NO:2.

[0031] In some embodiments, the anti-CD3 antibody or anti-CD3 antibody fragment is a membrane-tethered anti-CD3 antibody or membrane-tethered anti-CD3 antibody fragment, respectively.

[0032] In some embodiments, the TILs are engineered TILs (eTILs). In some embodiments, the eTILs are edited eTILs. In some embodiments, the edited eTILs comprise a genomic modification.

[0033] In some embodiments, the engineered cancer cells are selected from engineered melanoma cells, engineered colon cancer cells, engineered cholangiocarcinoma cells, and engineered breast cancer cells, hi some embodiments, the engineered cancer cells are engineered melanoma cells.

[0034] In some embodiments, the co-cultivation is carried out for at least 24 hours, for example, about 24 to 72 hours.

[0035] In some embodiments, the measuring comprises performing an assay selected from a real-time cell viability assay, an ATP cell viability assay, a live cell protease viability assay, a tetrazolium reduction cell viability assay, a resazurin reduction cell viability assay, a dead cell protease release cytotoxicity assay, a lactate dehydrogenase release cytotoxicity assay, and a DNA dye cytotoxicity assay.

[0036] A further aspect of the present disclosure provides a method for evaluating the efficacy of TILs, comprising co-culturing TILs, immortalized cells, and a bispecific molecule that activates T cells and binds to the immortalized cells, and evaluating the efficacy of the TILs. In some embodiments, the TILs express the CD3 antigen. In some embodiments, the bispecific molecule comprises a molecule that binds to CD3.

[0037] In some embodiments, the TILs are engineered TILs (eTILs). In some embodiments, the eTILs are edited eTILs. In some embodiments, the edited eTILs comprise a genomic modification.

[0038] Another aspect of the disclosure provides a method for evaluating the efficacy of polyclonal T cells, comprising co-culturing polyclonal T cells, immortalized cells, and a bispecific molecule that activates the T cells and binds to the immortalized cells, and evaluating the efficacy of the polyclonal T cells. In some embodiments, the polyclonal T cells express the CD3 antigen. In some embodiments, the bispecific molecule comprises a molecule that binds to CD3.

[0039] In some embodiments, the immortalized cells comprise a clonal population of immortalized cells. In some embodiments, the immortalized cells are human cells. In some embodiments, the immortalized cells are (e.g., human) cancer cells. In some embodiments, the cancer cells are selected from melanoma cells, colon cancer cells, cholangiocarcinoma cells, and breast cancer cells.

[0040] In some embodiments, the bispecific molecule comprises a molecule that binds to CD19. In some embodiments, the bispecific molecule comprises a molecule that binds to CD3. In some embodiments, the bispecific molecule comprises a molecule that binds to CD19 and CD3.

[0041] In some embodiments, the bispecific molecule is a CD19-CD3 BiTE®.

[0042] In some embodiments, the co-cultivation is carried out for at least 24 hours, for example, about 24 to 72 hours.

[0043] In some embodiments, the measuring comprises performing a cell viability assay. In some embodiments, the measuring comprises performing a cytotoxicity assay. In some embodiments, the measuring comprises performing an assay selected from a real-time cell viability assay, an ATP cell viability assay, a live cell protease viability assay, a tetrazolium reduction cell viability assay, a resazurin reduction cell viability assay, a dead cell protease release cytotoxicity assay, a lactate dehydrogenase release cytotoxicity assay, and a DNA dye cytotoxicity assay.

[0044] The above and other features and advantages of the present disclosure will be more fully understood from the following detailed description of illustrative embodiments taken in conjunction with the accompanying drawings. [Brief description of the drawings]

[0045] [Figure 1] Figure 1 shows A375 cells transduced with 0, 25, 50, 100, 200, 400, or 800 μL of pKSQ366 or pKSQ367 lentivirus encoding mOKT3 were cocultured overnight with human pan-CD3+ T cells. The following day, CD69 activation was assessed by flow cytometry. A375 cells transduced with various amounts of pKSQ366 virus were found to result in similar levels of CD69 activation, except in the case of 25 μL of virus. A375 cells transduced with pKSQ367 resulted in slightly higher levels of CD69 activation, and similar levels of activation were observed using various amounts of virus. [Diagram 2] Figure 1 shows that A375-pKSQ367 and non-transduced cells were stained with goat anti-mouse antibody to confirm mOKT3 surface expression. 99.2% of A375-pKSQ367 were found to express mOKT3. [Figure 3A]Pre-REP TILs were co-cultured with A375-pKSQ367 for 3 days at various effector:target cell ratios (E:T). Killing of A375 by pre-REP TILs is not observed except at 10:1 with D2777. At all E:Ts, increased recognition and subsequent killing of A375-pKSQ367 by TILs is observed. [Figure 3B] Pre-REP TILs were co-cultured with A375-pKSQ367 for 3 days at various effector:target cell ratios (E:T). Killing of A375 by pre-REP TILs is not observed except at 10:1 with D2777. At all E:Ts, increased recognition and subsequent killing of A375-pKSQ367 by TILs is observed. [Figure 3C] Pre-REP TILs were co-cultured with A375-pKSQ367 for 3 days at various effector:target cell ratios (E:T). Killing of A375 by pre-REP TILs is not observed except at 10:1 with D2777. At all E:Ts, increased recognition and subsequent killing of A375-pKSQ367 by TILs is observed. [Figure 4] We show that constructs with various membrane anchors, signal peptides, and scFv linkers all robustly activate T cells. K562 cells carrying the indicated constructs were co-cultured with pan T cells. After 24 hours, T cells were stained for CD8 and CD69 surface expression and measured by flow cytometry. CD69 expression was elevated after co-culture with K562 cells expressing mOKT3, regardless of the anchor tethered to the cell membrane of K562 cells. [Diagram 5] 1 shows that the high affinity A375 pKSQ367 exhibits higher mOKT3 marker expression compared to the A375 parental cell line from which it was derived. [Figure 6] Figure 2 shows that the low affinity strain A375 pKSQ397 shows high mOKT3 marker expression. Increasing the amount of virus used for transduction does not increase the expression of mOKT3 on the surface of these cells. [Figure 7]Figure 2 shows that the low affinity strain A375 pKSQ398 displays intermediate levels of mOKT3 marker expression. Increasing the amount of virus used for transduction does not increase the expression of mOKT3 on the surface of these cells. [Figure 8] We show that pan T cells show increased cell surface CD69 expression after co-culture with A375 pKSQ367 target cells, indicating recognition of the target cells (A375 pSKQ367) and activation of the pan T cells. In contrast, pan T cells show little CD69 expression after co-culture with A375 parental cells, demonstrating a lack of recognition of the pan T cells and therefore no increased activation. As a control, pan T cells cultured alone show a lack of basal CD69 expression. [Figure 9] We show that pan T cells exhibit reduced cell surface CD69 expression after co-culture with A375 pKSQ396 target cells, with expression levels comparable to pan T cells co-cultured with A375 parental cells (Figure 8), demonstrating a lack of target cell recognition by pan T cells and therefore no increased activation. [Figure 10] We show that pan T cells show expression of CD69 on the cell surface after co-culture with A375 pKSQ397 target cells. This expression level indicates recognition of target cells (A375 pSKQ397) and activation of pan T cells. Target cells transduced with higher amounts of virus appear to have the ability to slightly increase activation of pan T cells. [Figure 11] We show that pan T cells show expression of CD69 on the cell surface after co-culture with A375 pKSQ398 target cells. This expression level indicates recognition of target cells (A375 pSKQ398) and activation of pan T cells. Target cells transduced with higher amounts of virus appear to have the ability to slightly increase activation of pan T cells. [Figure 12]Figure 1 shows that A375 parental cells were co-cultured as a monolayer with gene target-edited TILs (no EP, OLFR, SOCS1, CBLB) derived from TIL donor 3239. Due to the lack of surface expression of mOKT3, no reduction or difference in growth of the target A375 cells was observed. [Figure 13] We show that A375 pKSQ367 cells were co-cultured as monolayers with gene target-edited TILs (no EP, OLFR, SOCS1, CBLB) derived from TIL donor 3239. The previously observed high levels of mOKT3 surface expression demonstrated a significant reduction in growth of the targeted A375 pKSQ367 cells. [Figure 14] Figure 1 shows A375 pKSQ398 cells were co-cultured as monolayers with gene-targeted edited TILs (no EP, OLFR, SOCS1, CBLB) from TIL donor 3239. pKSQ398 has reduced affinity for CD3 compared to pKSQ367, which reduced the kinetics of TIL killing of targeted A375 pKSQ398 cells. All groups had similar activity against this cell line, suggesting that the lower affinity of OKT3 makes it more difficult for TILs to kill. [Figure 15] 10,000 A375-pKSQ367 or A375-pKSQ398 cells were plated onto ultra-low attachment plates and imaged over 10 days to observe spheroid morphology. [Figure 16] 10,000 A375-pKSQ367 or A375-pKSQ398 were plated on ultra-low attachment plates. No electroporation (No EP) and SOCS1 edited TILs were added 4 days later at various E:T ratios. Imaging was continued throughout the period of spheroid formation and co-culture. Such images were collected after 36 hours for A375-pKSQ367 and 72 hours for A375-pKSQ398. [Figure 17]Shown are 10,000 A375-pKSQ367 or A375-pKSQ398 cells plated on ultra-low attachment plates. No electroporation (No EP) and SOCS1 edited TILs were added 4 days later at various E:T ratios. Imaging was continued throughout the period of spheroid formation and co-culture. Such images were collected 72 hours after co-culture. [Figure 18] Shown are 10,000 A375-pKSQ367 cells plated on ultra-low attachment plates. No electroporation (No EP) and SOCS1 edited TILs were added 4 days later at various E:T ratios. Imaging was continued throughout the period of spheroid formation and co-culture. These images were collected 5 days after co-culture. [Figure 19] Shown are 5,000 or 10,000 A375-pKSQ398 cells plated on ultra-low attachment plates. No electroporation (No EP) and SOCS1 edited TILs were added after 4 days at various E:T ratios. Imaging was continued throughout the period of spheroid formation and co-culture. These images were collected after 5 days of co-culture. [Figure 20] Figure 1 shows the cytotoxicity of SOCS1-edited and control unedited TILs against A375-OKT3lt spheroids at different effector:target (E:T) ratios over 72 hours. In monolayer culture, SOCS1-edited cells were no different from unedited cells in killing A375-pKSQA367 and A375-pKSQ368 cells (Figure 13 and Figure 14). In a 3D spheroid setting, SOCS1-edited cells showed enhanced cytotoxicity compared to the control, suggesting that the assay has a different sensitivity in the spheroid setting. [Figure 21] Shown is IFNγ produced by SOCS1-edited and control unedited TILs against A375-OKT3lt spheroids at 24 hours and different effector:target (E:T) ratios. [Figure 22]Shows IL-6 production by SOCS1 edited and control unedited TILs against A375-OKT3lt spheroids at 24 hours and different effector:target (E:T) ratios. [Diagram 23] Luminescence levels detected in supernatants after 24 hours of TIL-spheroid co-culture are shown. [Figure 24] Calculated LDH levels in the supernatant after 24 hours of TIL-spheroid co-culture are shown. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0046] The present disclosure provides, in some aspects, methods and compositions useful for measuring the anti-tumor efficacy of tumor infiltrating lymphocytes (TILs). In some embodiments, these methods include, for example, co-culturing TILs and immortalized cells, and assessing the efficacy of TILs using approaches that include co-culturing TILs, immortalized cells, and bispecific molecules.

[0047] Many TIL potency assays currently used to monitor T cell function focus on the use of cytokine (e.g., IFN-γ or IL-2) release assays. For example, T cell activation can be quantified by measuring IFN-γ secretion after a short co-culture period with non-cell-based T cell activation reagents (including anti-CD3 / anti-CD28 antibody-coated beads). Cytokine secretion is associated with increased expression of CD8 T cells, as cytokines (e.g., IFN-γ) enhance expression of MHC I and Fas on target cells. + It correlates with the cytolytic activity of T cells. For example, TILs can be considered potent if interferon gamma (IFN-γ) release upon TCR stimulation is greater than 50 pg / ml, greater than 100 pg / ml, greater than 150 pg / ml, or greater than 200 pg / ml.

[0048] However, activation and direct killing by target tumor cells, which requires that TILs are at least capable of interacting with target cells and producing / releasing death-inducing mediators such as degranulation of cytolytic granules including granzyme B and perforin, is an equally important indicator of clinical efficacy that is not measured by currently available cytokine release assays driven by non-cell-based TIL activation methods. The TIL potency assay provided herein improves upon existing TIL potency assays (e.g., cytokine release assays) by activating TILs through relevant tumor cell-based interactions. This provides the opportunity to directly measure cell death and / or viability of target cells (e.g., immortalized cells such as cancer cells), or surrogate degranulation markers (e.g., CD107a), or production of effector cytokines / chemokines (e.g., inflammatory cytokines / chemokines) (e.g., IFN-γ, IL-6, IL_2, and TNFα) in a more physiologically relevant TIL / tumor cell co-culture setting.

[0049] "TIL potency assay" refers to an assay used to characterize (e.g., quantitate) the anti-tumor activity of TILs (e.g., cytokine production, TIL degranulation, tumor growth inhibition). TIL potency assays can be used to evaluate the anti-tumor activity of TILs before and / or after rapid expansion of TILs and before clinical application, such as adoptive cellular therapy (ACT).

[0050] Tumor-infiltrating lymphocytes Tumor infiltrating lymphocytes (TILs), including engineered and / or edited TILs, can be characterized based on the efficacy of their anti-tumor activity (e.g., inhibition of tumor cell growth).

[0051] The term "tumor infiltrating lymphocytes" or "TILs" refers to a population of lymphocytes that have left the bloodstream of a subject and migrated into a tumor. TILs include, but are not limited to, CD8+ cytotoxic T cells, CD4+ T cells (including Th1 and Th17 CD4+ T cells), natural killer T cells, and natural killer (NK) cells. TILs include primary TILs and secondary TILs. "Primary TILs" refer to those obtained from a patient tissue sample as outlined herein (sometimes referred to as "freshly harvested"), and "secondary TILs" refer to any TIL cell population that has been expanded or grown, including, but not limited to, bulk TILs and expanded TILs ("REP TILs" or "post-REP TILs"). In some embodiments, primary TILs include tumor-reactive T cells obtained from the peripheral blood of a patient. TIL cell populations can include genetically modified or otherwise engineered TILs. "TIL" also refers to a population of lymphocytes that leave a subject's bloodstream, migrate into a tumor, and then leave again and enter the bloodstream.

[0052] As generally outlined herein, TILs are typically harvested from patient samples and engineered to expand their numbers prior to transplantation into patients. In some embodiments, TILs can be genetically engineered as described below. Generally, TILs are first obtained from a patient's tumor sample ("primary TILs"), then expanded into larger populations for further manipulation, optionally cryopreserved and restimulated, as described herein, and optionally evaluated for phenotypic and metabolic parameters as indicators of TIL health.

[0053] The terms "subject" and "patient" refer to a human. In some embodiments, the human may be a patient in need of immunotherapy involving an expanded population of the patient's own TILs. In other embodiments, the human may be a patient in need of immunotherapy involving an expanded population of another patient's own TILs.

[0054] In general, TILs can be defined biochemically using cell surface markers or functionally by their ability to infiltrate tumors and provide therapy. In general, TILs can be classified as expressing one or more of the following biomarkers: CD4, CD8, TCRαβ, TCRgd, CD27, CD28, CD56, CCR7, CD45RA, CD45RO, CD95, PD-1, and CD25. Additionally and alternatively, TILs can be defined functionally by their ability to infiltrate solid tumors when reintroduced into the patient.

[0055] Adoptive cell therapy utilizing ex vivo cultured TILs by conventional TIL manufacturing process involves at least two steps, namely a pre-REP step followed by at least one rapid expansion protocol (REP) step. Adoptive cell therapy has become a successful post-host immunosuppression therapy in melanoma patients. Current infusion tolerance parameters depend on the indicated measurements of TIL composition (e.g., CD28, CD8, or CD4 positivity) and the numerical fold expansion and viability of the REP product.

[0056] The term "cell population" or "TIL population" refers to multiple cells or TILs that share a common trait. Generally, a TIL population may number between 1×10 6 ~1×10 10 , with different TIL populations containing different numbers. For example, primary TILs initially grown in the presence of IL-2 produce approximately 1 × 10 7 A bulk TIL population of cells can be obtained. Generally, REP expansion requires 1.5 x 10 cells for infusion. 9 ~1.5×10 10This is carried out to provide a population of cells. In some embodiments, the cell population is monoclonal. In other embodiments, the cell population is polyclonal. In some embodiments, when the cell population is polyclonal, the cells still share one or more common traits. Monoclonal T cell populations have a single TCR gene rearrangement pattern that predominates. In contrast, polyclonal T cell populations have a variety of TCR gene rearrangement patterns, which may be more effective in certain situations.

[0057] In some embodiments, TILs are genetically engineered to contain additional functions, including but not limited to, a high affinity T cell receptor (TCR), such as a TCR that targets a tumor-associated antigen (e.g., MAGE-1, HER2, or NY-ESO-1), or a chimeric antigen receptor (CAR) that binds to a tumor-associated cell surface molecule (e.g., mesothelin) or a lineage-restricted cell surface molecule (e.g., EGFR, CD19, or HER2).

[0058] The term "engineered TILs" or "eTILs" encompasses TILs that contain one or more genomic modifications brought about by non-natural means that result in reduced expression and / or function of one or more endogenous target genes, as well as TILs that contain a non-naturally occurring gene regulatory system that can reduce expression and / or function of one or more endogenous target genes. "Unmodified TILs" or "control TILs" refers to a TIL or TIL population whose genome has not been modified by non-natural means and does not contain a non-naturally occurring gene regulatory system or contains a control gene regulatory system (e.g., an empty vector control, a non-targeting gRNA, a scrambled siRNA, etc.). Naturally occurring TILs that have reduced expression and / or function of one or more endogenous genes are included in the term unmodified TILs or control TILs.

[0059] In some embodiments, the engineered TILs produced by the methods described herein contain one or more modifications (e.g., one or more nucleic acid insertions, deletions, or mutations) in the genomic DNA sequence of the endogenous target gene that result in reduced expression and / or function of the endogenous gene. In some embodiments, the modifications in the genomic DNA sequence reduce or inhibit mRNA transcription, thereby reducing the expression levels of the encoded mRNA transcript and protein. In some embodiments, the modifications in the genomic DNA sequence reduce or inhibit mRNA translation, thereby reducing the expression levels of the encoded protein. In some embodiments, the modifications in the genomic DNA sequence encode a modified endogenous protein with reduced or altered function compared to the unmodified (i.e., wild-type) version of the endogenous protein (e.g., a dominant negative mutant, as described below).

[0060] In some embodiments, the modified TIL further comprises an engineered antigen-specific receptor that recognizes a protein target expressed by the target cell (e.g., a tumor cell or an antigen-presenting cell (APC)). The term "engineered antigen receptor" refers to a non-naturally occurring antigen-specific receptor (e.g., a chimeric antigen receptor (CAR) or a recombinant T cell receptor (TCR)). In some embodiments, the engineered antigen receptor is a CAR that comprises an extracellular antigen-binding domain fused to a cytoplasmic domain that comprises a signaling domain via a hinge and transmembrane domain. In some embodiments, the CAR extracellular domain binds to an antigen expressed by the target cell in an MHC-independent manner, resulting in activation and proliferation of the RE cell. In some embodiments, the extracellular domain of the CAR recognizes a tag fused to an antibody or antigen-binding fragment thereof. In such embodiments, the antigen specificity of the CAR depends on the antigen specificity of the labeled antibody, so that a single CAR construct can be used to target multiple different antigens by replacing one antibody with another. In some embodiments, the extracellular domain of the CAR can comprise an antigen-binding fragment derived from an antibody. Antigen binding domains useful in the present disclosure include, for example, scFvs, antibodies, antigen binding regions of antibodies, heavy / light chain variable regions, and single chain antibodies.

[0061] In some embodiments, the intracellular signaling domain of the CAR may be derived from the TCR complex zeta chain (e.g., CD3ξ signaling domain), FcγRIII, FcεRI, or lymphocyte activation domain. In some embodiments, the intracellular signaling domain of the CAR further comprises a costimulatory domain, e.g., 4-1BB, CD28, CD40, MyD88, or CD70 domain. In some embodiments, the intracellular signaling domain of the CAR comprises two costimulatory domains, e.g., any two of the 4-1BB, CD28, CD40, MyD88, or CD70 domains. Exemplary CAR structures and intracellular signaling domains are known in the art (see, e.g., WO2009 / 091826; US20130287748; WO2015 / 142675; WO2014 / 055657; and WO2015 / 090229, which are incorporated herein by reference).

[0062] CARs specific for various tumor antigens are known in the art, for example, CD171-specific CAR (Park et al., Mol Ther (2007) 15(4):825-833), EGFRvIII-specific CAR (Morgan et al., Hum Gene Ther (2012) 23(10):1043-1053), EGF-R-specific CAR (Kobold et al., J Natl Cancer Inst (2014) 107(1):364), carbonic anhydrase K-specific CAR (Lamers et al., Biochem Soc Trans (2016) 44(3):951-959), FR-α-specific CAR (Kershaw et al., Clin Cancer Res (2006) 12(20):6106-6015), HER2-specific CAR (Ahmed et al., J Clin Oncol (2015) 33(15)1688-1696; Nakazawa et al., Mol Ther (2011) 19(12):2133-2143; Ahmed et al., Mol Ther (2009) 17(10):1779-1787; Luo et al., Cell Res (2016) 26(7):850-853; Morgan et al., Mol Ther (2010) 18(4):843-851; Grada et al., Mol Ther Nucleic Acids (2013) 9(2):32), CEA-specific CAR (Katz et al., Clin Cancer Res (2015) 21(14):3149-3159), IL13Rα2-specific CAR (Brown et al., Clin Cancer Res (2015) 21(18):4062-4072), GD2-specific CAR (Louis et al., Blood (2011) 118(23):6050-6056; Caruana et al., Nat Med (2015) 21(5):524-529), ErbB2-specific CAR (Wilkie et al., J Clin Immunol (2012) 32(5):1059-1070), VEGF-R-specific CAR (Chinnasamy et al., Cancer Res (2016) 22(2):436-447), FAP-specific CAR (Wang et al.,Cancer Immunol Res(2014)2(2):154-166), MSLN-specific CARs (Moon et al,Clin Cancer Res(2011)17(14):4719-30), NKG2D-specific CARs (VanSeggelen et al.,Mol Ther(2015)23(10):1600-1610), and CD19-specific CARs (axicabtagenecilloreucel (Yescarta®) and tisagenlecleucel (Kymriah®). See also 82 / 337 Li et al,J Hematol and Oncol(2018)11(22) (reviewing clinical trials of tumor-specific CARs).

[0063] As generally outlined herein, TILs are typically harvested from patient samples and engineered to expand their numbers prior to transplantation into the patient. In some embodiments, TILs can be genetically engineered as described below. Generally, TILs are first obtained from a patient's tumor sample ("primary TILs") and then expanded into larger populations for further manipulation, optionally cryopreserved and restimulated, and optionally evaluated for phenotypic and metabolic parameters as indicators of TIL health.

[0064] Patient tumor samples can be obtained using methods known in the art, generally via surgical resection, needle biopsy, or other means to obtain a sample containing a mixture of tumor and TIL cells. Generally, tumor samples can be derived from any solid tumor, including primary tumors, invasive tumors, or metastases. Tumor cells can be of any cancer type, including bladder cancer, brain cancer, breast cancer (including triple-negative breast cancer), cervical cancer, colon cancer, gastric cancer, endometrial cancer, kidney cancer, lip and oral cavity cancer, head and neck cancer (including, for example, head and neck squamous cell carcinoma (HNSCC)), glioblastoma, glioblastoma multiforme, neuroblastoma, liver cancer, mesothelioma, lung cancer (including non-small cell lung cancer (NSCLC) and small cell lung cancer), skin cancer (including, but not limited to, squamous cell carcinoma, basal cell carcinoma, non-melanoma skin cancer, and melanoma), ovarian cancer, uveal cancer, endometrial cancer, pancreatic cancer, prostate cancer, sarcoma, and thyroid cancer. In some embodiments, useful TILs are obtained from malignant melanoma tumors, as this tumor has been reported to have particularly high levels of TILs. Primary lung cancer (including non-small cell lung cancer (NSCLC)), bladder cancer, cervical cancer, melanoma tumors, or metastases thereof, can be used to obtain TILs.

[0065] Once obtained, the tumor sample is generally fragmented using sharp scraping into pieces of about 1 to about 8 mm. 3 Or about 0.5 to about 4 mm 3 Cut into small pieces (approximately 2-3 mm 3are particularly useful). TILs are cultured from these fragments using enzymatic tumor digests. Such tumor digests can be generated by incubation in enzyme medium (e.g., Roswell Park Memorial Institute (RPMI) 1640 buffer, 2 mM glutamic acid, 10 μg / ml gentamicin, 30 units / ml DNase, and 1.0 mg / ml collagenase) followed by mechanical dissociation (e.g., using a tissue dissociator). Tumor digests can be generated by placing the tumor in enzyme medium, mechanically dissociating the tumor for approximately 1 minute, then incubating at 37° C. in 5% CO2 for 30 minutes, and then repeating the cycle of mechanical dissociation and incubation under the above conditions until only small tissue fragments are present. At the end of this process, if the cell suspension contains a large number of red blood cells or dead cells, a density gradient separation using FICOLL branched hydrophilic polysaccharide can be performed to remove these cells. Alternative methods known in the art (e.g., U.S. Patent Application Publication No. 2012 / 0244133A1, the disclosure of which is incorporated herein by reference in its entirety) may also be used. Any of the foregoing methods can be used in any of the embodiments described herein for the methods of expanding TILs or treating cancer.

[0066] Generally, the harvested cell suspension is referred to as a "primary cell population" or a "freshly harvested" cell population. In some embodiments, fragmentation comprises physical fragmentation (e.g., dissection and digestion). In some embodiments, fragmentation is physical fragmentation. In some embodiments, fragmentation is dissection. In some embodiments, fragmentation is by digestion. In some embodiments, TILs can be initially cultured from enzymatic tumor digests and tumor fragments obtained from patients.

[0067] In some embodiments, TILs are obtained from tumor digests. In some embodiments, tumor digests are generated by incubating mechanically dissociated tumors in an enzyme medium (such as, but not limited to, RPMI1640, 2 mM GlutaMAX, 10 mg / ml gentamicin, 30 U / ml DNase, and 1.0 mg / ml collagenase) followed by mechanical dissociation (GentleMACS, Miltenyi Biotec, Auburn, Calif.). In some embodiments, mechanically dissociated tumors are approximately 1 mm 3 After placing the tumor in the enzyme medium, the tumor can be mechanically dissociated for approximately 1 minute. The solution can then be incubated at 37° C. in 5% CO2 for 30 minutes, and then mechanical disruption can be performed again for approximately 1 minute. After again incubating at 37° C. in 5% CO2 for 30 minutes, the tumor can be mechanically disrupted a third time for approximately 1 minute. In some embodiments, if large tissue fragments are present after the third mechanical separation, one or two additional mechanical separations can be applied to the sample, with or without incubation at 37° C. in 5% CO2 for 30 minutes. In some embodiments, if at the end of the final incubation, the cell suspension contains a large number of red blood cells or dead cells, density gradient separation using FICOLL can be performed to remove these cells.

[0068] In some embodiments, cells can be optionally frozen or cryopreserved after sampling and cryopreserved prior to the expansion step.

[0069] In some embodiments, the TILs are expanded for up to a total of 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 days from initial tumor fragmentation or dissociation. In some embodiments, the TILs are expanded for a total of 9-25 days, 9-21 days, or 9-14 days. In some embodiments, the TILs are expanded for up to a total of 9 days. In some embodiments, the TILs are expanded for up to a total of 10 days. In some embodiments, the TILs are expanded for up to a total of 11 days. In some embodiments, the TILs are expanded for up to a total of 12 days. In some embodiments, the TILs are expanded for up to a total of 13 days. In some embodiments, the TILs are expanded for up to a total of 14 days. In some embodiments, the TILs are expanded for up to a total of 15 days. In some embodiments, the TILs are expanded for up to a total of 16 days. In some embodiments, the TIL is expanded for up to a total of 17 days. In some embodiments, the TIL is expanded for up to a total of 18 days. In some embodiments, the TIL is expanded for up to a total of 19 days. In some embodiments, the TIL is expanded for up to a total of 20 days. In some embodiments, the TIL is expanded for up to a total of 21 days. In some embodiments, the TIL is expanded for up to a total of 22 days. In some embodiments, the TIL is expanded for up to a total of 23 days. In some embodiments, the TIL is expanded for up to a total of 24 days. In some embodiments, the TIL is expanded for up to a total of 25 days. In some embodiments, the TIL is expanded for up to a total of 26 days. In some embodiments, the TIL is expanded for up to a total of 27 days. In some embodiments, the TIL is expanded for up to a total of 28 days.

[0070] In some embodiments, the expanded TILs are analyzed for expression of a number of phenotypic markers, including those described herein. In some embodiments, the markers are selected from TCRα / β, CD57, CD28, CD4, CD27, CD56, CD8a, CD45RA, CD45RO, CD8a, CCR7, CD4, CD3, CD38, and HLA-DR. In some embodiments, the expression of one or more regulatory markers is measured, i.e., one or more regulatory markers from the group of CD137, CD8a, Lag3, CD4, CD3, PD-1, TIM-3, CD69, CD8a, TIGIT, CD4, CD3, KLRG1, and CD154.

[0071] In some embodiments, the memory marker is CCR7 or CD62L. In embodiments, the restimulated TILs are assessed for cytokine release using a cytokine release assay. In some embodiments, the TILs are assessed for secretion of interferon-gamma (IFN-γ) in response to stimulation with either OKT3 or co-culture with autologous tumor digest. In some embodiments, the TILs are assessed for IL-6 secretion in response to stimulation with either OKT3 or co-culture with autologous tumor digest. Additional effector cytokines that may be measured include, but are not limited to, IL-1, IL-2, IL-12, IL-17, IL-18, granulocyte macrophage colony stimulating factor (GM-CSF), and tumor necrosis factor-α (TNFα). Chemokines such as CXCL10, CXCL13, CCL1, CCL3, CCL4, CCL5, CCL9 / 10, CCL17, CCL22, CCL23, XCL1 may also be assessed.

[0072] TILs are assessed for various regulatory markers (e.g., TCRα / β, CD56, CD27, CD28, CD57, CD45RA, CD45RO, CD25, CD127, CD95, IL-2R, CCR7, CD62L, KLRG1, and CD122).

[0073] immortalized cells Immortalized cells are cells that have been engineered to grow indefinitely and therefore can be cultured for extended periods of time. Typically, immortalized cell lines are derived from various sources (e.g., tumors) that have chromosomal abnormalities or mutations that allow for continued division. Thus, immortalized cells are considered to be "engineered." Immortalized cell populations may be heterogeneous populations or may be derived from a single immortalized clone (to form a clonal population). In some embodiments, immortalized cells comprise a heterogeneous immortalized cell population. In some embodiments, immortalized cells comprise a clonal population of immortalized cells.

[0074] The immortalized cells can be from various species and / or origins. For example, the immortalized cells can be immortalized animal cells or immortalized human cells, or a combination thereof. In some embodiments, the immortalized cells are immortalized human cells.

[0075] In some embodiments, the immortalized cells are cancer cells. For example, cancer cells include, but are not limited to, melanoma cells, colon cancer cells, cholangiocarcinoma cells, and breast cancer cells. In some embodiments, the cancer cells are selected from melanoma cells, colon cancer cells, cholangiocarcinoma cells, and breast cancer cells.

[0076] Immortalized cells that may be engineered for use in the TIL potency assays described herein include, but are not limited to, A375 melanoma cells (e.g., ATCC® CRL-1619™), K562 multipotent hematopoietic malignant cells, primary cells (e.g., ATCC® CCL-243™), human embryonic kidney (HEK) 293T cells (e.g., ATCC® CRL-1573), and Chinese hamster ovary (CHO) cells (e.g., ATCC® CCL-61™). In some embodiments, the immortalized cells are selected from A375 cells, K562 cells, primary cells, HEK293T cells, and CHO cells. It is understood that immortalized cells useful in the assays and methods described herein are not limited to the foregoing examples. Other immortalized cell lines are known in the art and can be used in accordance with the present disclosure.

[0077] It is also contemplated herein to use cell lines expressing immunosuppressive markers (e.g., PD-L1, PD-L2) that suppress T cell responses to test whether TILs are resistant to inhibitory signals. In some embodiments, immortalized cells that can be engineered for use in TIL potency assays include cell lines expressing immunosuppressive markers (e.g., PD-L1) that suppress T cell responses.

[0078] Cell lines expressing costimulatory markers to enhance T cell responses (e.g., CD80 / 86, OX40L, and / or 41BBL) can also be engineered for use in TIL potency assays. In some embodiments, immortalized cells that can be engineered for TIL potency assays include cell lines that can express costimulatory markers to enhance T cell responses (e.g., CD80 / 86).

[0079] The phrase "tumor cells" or "cancer cells" refers to cells that divide without control, forming solid tumors or flooding the blood with abnormal cells. Healthy cells stop dividing when there is no need for any more daughter cells, but tumor or cancer cells continue to produce copies. These cells can also spread from one part of the body to another, a process known as metastasis. Tumor cells can be isolated from multiple cancer types, including bladder cancer, brain cancer, breast cancer (including triple-negative breast cancer), cervical cancer, colon cancer, gastric cancer, endometrial cancer, kidney cancer, lip and oral cavity cancer, head and neck cancer (including, for example, head and neck squamous cell carcinoma (HNSCC)), glioblastoma, glioblastoma multiforme, neuroblastoma, liver cancer, mesothelioma, lung cancer (including non-small cell lung cancer (NSCLC) and small cell lung cancer), skin cancer (including, but not limited to, squamous cell carcinoma, basal cell carcinoma, non-melanoma skin cancer, and melanoma), ovarian cancer, uveal cancer, endometrial cancer, pancreatic cancer, prostate cancer, sarcoma, and thyroid cancer. In some embodiments, cancer cells are also isolated from lymphoma. Tumor cells can be isolated from primary tumors and metastases.

[0080] Although the immortalized cells are described throughout in the context of co-culture with TILs, it will be understood that the immortalized cells may be replaced with any tumor cell (e.g., cancer cell) that expresses, or has been engineered to express, a molecule that activates T cells (e.g., binds to a T cell antigen).

[0081] Molecules that activate lymphocytes The engineered immortalized cells of the present disclosure can contain or express a molecule that activates T cells.

[0082] "Lymphocyte-activating molecules" and "T cell-activating molecules" refer to non-endogenous stimuli that activate cells. In the endogenous process, for example, T cells become activated when peptide antigens are presented to MHC class II molecules expressed on the surface of antigen-presenting cells (APCs). Once activated, T cells rapidly divide and secrete cytokines that regulate or support the immune response. The endogenous T cell activation process involves at least (a) activation of the TCR complex with CD3 and (b) co-stimulation of CD28 or 4-1BB by proteins on the surface of APCs. It is known in the art that stimulation of T cells with CD3, CD28, or 4-1BB agonists (e.g., antibodies) can simulate endogenous activation of T cells. Thus, CD3, CD28, and / or 4-1BB can both activate T cells.

[0083] Activated T cells increase in number, or proliferate, and begin producing cytokines (activated TILs) to mount an immune response.

[0084] The immortalized cells can comprise and / or express a molecule that activates T cells by binding (e.g., directly binding) to a T cell antigen. In some embodiments, the TILs (e.g., engineered and / or edited TILs) express a T cell antigen. Non-limiting examples of T cell antigens include CD3, CD28, CD2, 41BB, OX40, GITR, ICOS, CD4, CD8. In some embodiments, the T cell antigen is CD3. In some embodiments, the T cell antigen is CD28. In some embodiments, the T cell antigen is CD2.

[0085] The term "CD3" refers to the CD3 (cluster of differentiation 3) T cell coreceptor, which aids in the activation of both cytotoxic T cells (CD8+ naive T cells) and T helper cells (CD4+ naive T cells). CD3 is a protein complex composed of six different polypeptide chains (two CD3 zeta chains, two CD3 epsilon chains, one CD3e gamma chain, and one CD3 delta chain). These chains associate with the alpha and beta chains (or gamma and delta chains) of the T cell receptor (TCR) to generate activation signals within T lymphocytes. The TCR alpha and beta chains (or gamma and delta chains) and the CD3 molecule together constitute the TCR complex. The human CD3E gene is identified by the National Center for Biotechnology Information (NCBI) gene ID 916. An exemplary nucleotide sequence of the human CD3E gene is the NCBI reference sequence: NG_007383.1.

[0086] The term "CD28" refers to Cluster of Differentiation 28, which is a protein expressed on T cells and provides a costimulatory signal required for T cell activation and survival. T cell stimulation through CD28 in addition to the T cell receptor (TCR) can provide a strong signal for the production of various cytokines (e.g., interleukins). CD28 is a receptor for CD80 and CD86 proteins. Upon activation by Toll-like receptor ligands, CD80 expression is upregulated in antigen-presenting cells (APCs). The human CD28 gene is identified by NCBI gene ID 940. An exemplary nucleotide sequence of the human CD28 gene is NCBI Reference Sequence: NG_029618.1. The amino acid sequence of an exemplary human CD28 polypeptide is: MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (sequence number 19).

[0087] The term "CD2" refers to cluster of differentiation 2, which is a cell adhesion molecule found on the surface of T cells and natural killer (NK) cells. CD2 interacts with other adhesion molecules to function as a costimulatory molecule for T cells and NK cells. The human CD2 gene is identified by NCBI gene ID 914. An exemplary nucleotide sequence of the human CD2 gene is NCBI Reference Sequence: NG_050908.1. The amino acid sequence of an exemplary human CD2 polypeptide is: MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN (sequence number 20).

[0088] In some embodiments, the immortalized cells comprise a molecule that activates T cells by binding (e.g., specifically binding) to a T cell antigen. In some embodiments, the immortalized cells comprise a molecule that activates T cells by binding to a CD3 antigen. In some embodiments, the immortalized cells comprise a molecule that activates T cells by binding to a CD28 antigen. In some embodiments, the immortalized cells comprise a molecule that activates T cells by binding to a CD2 antigen.

[0089] The term "specifically binds" refers to a molecule (e.g., an antibody) interacting with a particular antigen (e.g., a T cell antigen) with high specificity relative to other antigens with which the complex associates with lower affinity. The specific binding interaction may be mediated by ionic bonds, hydrogen bonds, or other types of chemical or physical bonds. In some embodiments, a molecule specifically binds to a particular antigen upon recognizing a target antigen in a complex mixture of proteins and / or macromolecules. In some embodiments, a molecule that activates T cells is approximately 10 -5 Less than m, e.g., about 10 -6 Less than M, 10 -7 Less than M, 10 -8 Less than M, 10 -9 Less than M, 10 -10 It binds to T cell antigens with an affinity (KD) less than M or even lower.

[0090] In some embodiments, the molecule that activates T cells is a T cell agonist. The term "agonist" refers to a chemical, molecule, macromolecule, molecular complex, or macromolecular complex that binds to a target on the cell surface or in soluble form. In certain embodiments, when an agonist binds to a target on the cell surface, the agonist activates the target to produce a biological response. Agonists include hormones, neurotransmitters, antibodies, and antibody fragments.

[0091] Non-limiting examples of molecules that activate T cells include, but are not limited to, antibodies (e.g., whole antibodies and / or antibody fragments), NANOBODY® binders, AFFIMER® binders, and other molecular binders (e.g., ligands and receptors).

[0092] The term "antibody" generally refers to an immunoglobulin (Ig) molecule composed of four polypeptide chains, two heavy (H) chains and two light (L) chains, or a functional fragment, mutant, variant, or derivative thereof that retains the epitope binding function of an Ig molecule. Such fragment, mutant, variant, or derivative antibody formats are known in the art. In one embodiment of a full-length antibody, each heavy chain is composed of a heavy chain variable region (VH) and a heavy chain constant region (CH). The heavy chain variable region (domain) is also referred to in this disclosure as VDH. The CH is composed of three domains: CH1, CH2, and CH3. Each light chain is composed of a light chain variable region (VL) and a light chain constant region (CL). The CL is composed of a single CL domain. The light chain variable region (domain) is also referred to in this disclosure as VDL. VH and VL can be further subdivided into hypervariable regions called complementarity determining regions (CDRs) with conserved regions (called framework regions (FRs)) interspersed between them. Generally, each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2), or subclass.

[0093] In some embodiments, the immortalized cells express a molecule that is an antibody fragment. In some embodiments, the antibody fragment is selected from a single chain variable fragment (scFv), a F(ab')2 fragment, a Fab fragment, a Fab' fragment, and an Fv fragment.

[0094] The term "fragment" as used in relation to an agonist or antibody refers to a fragment of an agonist or antibody that retains the ability to specifically bind to an antigen. Examples of antibody fragments include (i) a Fab fragment, which is a monovalent fragment consisting of the VL, VH, CL, and CH1 domains; (ii) a F(ab')2 fragment, which is a bivalent fragment containing two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CH1 domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; (v) a dAb fragment containing a single variable domain; and (vi) an isolated complementarity determining region (CDR). Furthermore, although the two domains of an Fv fragment, VL and VH, are encoded by separate genes, they can be linked by a synthetic linker using recombinant methods. This synthetic linker allows these domains to be produced as a single protein chain (also known as single chain Fv (scFv)) in which the VL and VH regions pair to form a monovalent molecule. Such single chain antibodies are also intended to be encompassed by the term "antigen-binding portion" of an antibody. Other forms of single chain antibodies (e.g., diabodies) are also encompassed. Single chain antibodies also include "linear antibodies" that comprise a pair of tandem Fv segments (VH-CH1-VH-CH1), which together with complementary light chain polypeptides form a pair of antigen-binding regions.

[0095] The term "KD" refers to the dissociation equilibrium constant of a particular agonist-antigen interaction. Typically, the agonists described herein have a KD of mOKT3 scFv (approximately 1×10) when quantified using surface plasmon resonance (SPR) technology on a Biacore instrument, for example, with the agonist as the ligand and the target as the analyte. -9 M or 1×10 -10 In some embodiments, the agonists described herein (e.g., low affinity mOKT3 scFv variants) bind to a target with a dissociation equilibrium constant (KD) greater than 5×10-10 It binds to a target protein (e.g., CD3) with an affinity corresponding to a KD higher than M.

[0096] The term "koff" (sec-1) refers to the dissociation rate constant of a particular agonist-antigen interaction. This value is also referred to as the kd value.

[0097] The term "kon" (M-1 x sec-1) refers to the association rate constant of a particular agonist-antigen interaction.

[0098] The term "KD" (M) refers to the dissociation equilibrium constant of a particular agonist-antigen interaction.

[0099] "KA" (M -1 The term koff refers to the association equilibrium constant of a particular agonist-antigen interaction and is obtained by dividing koff by k.

[0100] The term "anti-CD28 antibody" refers to an antibody or variant thereof (e.g., a monoclonal antibody), including a human antibody, a humanized antibody, a chimeric antibody, or a murine antibody that is directed against the CD28 receptor within the T cell antigen receptor of mature T cells.

[0101] The term "anti-CD2 antibody" refers to an antibody or variant thereof (e.g., a monoclonal antibody), including a human antibody, a humanized antibody, a chimeric antibody, or a murine antibody that is directed against the CD2 receptor within the T cell antigen receptor of mature T cells.

[0102] The term "anti-CD3 antibody" refers to an antibody or variant thereof (e.g., monoclonal antibody), including human, humanized, chimeric, or murine antibodies directed against the CD3 receptor in the T cell antigen receptor of mature T cells (see, e.g., International Publication No. WO2013186613A1, incorporated herein by reference). Anti-CD3 antibodies include OKT3 (also known as muromonab). Anti-CD3 antibodies also include the UCHT1 clone (also known as T3 and CD3c). Other anti-CD3 antibodies include, for example, otelixizumab, teplizumab, and visilizumab. Muromonab-CD3 light chain QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAHFRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINRADTAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (SEQ ID NO: 17) Muromonab-CD3 heavy chain QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTT LTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 18)

[0103] The term "OKT3" refers to an anti-CD3 antibody produced by Miltenyi Biotech, Inc. (San Diego, Calif., USA), or a biosimilar or variant thereof (e.g., humanized, chimeric, or affinity matured variant). A hybridoma capable of producing OKT3 is available at the American Type Culture Collection and has been assigned ATCC accession number CRL8001. A hybridoma capable of producing OKT3 is available at the European Collection of Authenticated Cell Cultures (ECACC) and has been assigned catalog number 86022706.

[0104] In some embodiments, the antibody fragment is an OKT3 antibody (eg, an OKT3 antibody fragment). In some embodiments, the OKT3 antibody fragment is a membrane-bound OKT3 (mOKT3) scFv fragment.

[0105] The transmembrane domain can be used to fix mOKT3 scFv to the cell surface of immortalized cells. For example, the human CD8 transmembrane domain can be used to fix mOKT3 scFv to the cell surface of immortalized cells. It is also contemplated herein to use the CD8 transmembrane domain from other species, such as mouse (pKSQ366), or other transmembrane proteins, such as CD14 or CD28, to fix mOKT3 scFv to the cell surface of immortalized cells. In some embodiments, mOKT3 scFv is tethered and expressed on the cell surface of immortalized cells. In some embodiments, the human CD8 transmembrane domain is used to fix mOKT3 scFv to the cell surface of immortalized cells.

[0106] Many T cells respond to the very strong stimulation of mOKT3. The use of lower affinity T cell receptor binding allows for the resolution of small differences in T cell receptor signaling thresholds due to cell-to-cell variability and allows for more sensitive quality assessment of T cell therapy products prior to infusion into patients. Low affinity variants of mOKT3 fragments can be generated via site-directed mutagenesis to more closely model the affinity of native T cell receptors for their recognized antigens. The published affinities of native T cell receptors are in the μM KD range.

[0107] In some embodiments, a low affinity mOKT3 scFv variant is used. In some embodiments, the molecule binds to CD3 with a dissociation constant (KD) lower than the KD of mOKT3 scFv, where the KD of mOKT scFv is about 1×10 -9 ~Approx. 1×10 -11 , for example, about 5 x 10 -10M. In some embodiments, the low affinity mOKT3 scFv variant comprises an amino acid sequence having an R55 mutation relative to the amino acid sequence of SEQ ID NO:2. In some embodiments, the low affinity mOKT3 scFv variant comprises an amino acid sequence having an Y57 mutation relative to the amino acid sequence of SEQ ID NO:2. In some embodiments, the low affinity mOKT3 scFv variant comprises an amino acid sequence having an R55 and Y57 mutation relative to the amino acid sequence of SEQ ID NO:2. In some embodiments, the low affinity mOKT3 scFv variant comprises an amino acid sequence having an R55M and Y57A mutation relative to the amino acid sequence of SEQ ID NO:2. In some embodiments, the low affinity mOKT3 scFv variant comprises an amino acid sequence having an R55L and Y57T mutation relative to the amino acid sequence of SEQ ID NO:2.

[0108] In some embodiments, the low affinity mOKT3 scFv variant is about 1×10 -6 ~Approx. 5×10 -8 For example, the low affinity mOKT3 scFv variant binds to CD3 with a dissociation constant (KD) of approximately 1 × 10 -6 , 1×10 -7 , or 1 × 10 -8 In some embodiments, the low affinity mOKT3 scFv variant binds to CD3 with a KD of about 5×10 -7 It binds with a KD of

[0109] In some embodiments, the low affinity mOKT3 scFv variant has a KD for CD3 that is at least 10 fold lower, at least 20 fold lower, at least 30 fold lower, at least 40 fold lower, at least 50 fold lower, at least 60 fold lower, at least 70 fold lower, at least 80 fold lower, at least 90 fold lower, at least 100 fold lower, at least 110 fold lower, at least 120 fold lower, at least 130 fold lower, at least 140 fold lower, at least 150 fold lower, at least 160 fold lower, at least 170 fold lower, at least 180 fold lower, at least 190 fold lower, at least 200 fold lower, at least 210 fold lower, at least 220 fold lower, at least 230 fold lower, at least 240 fold lower, at least 250 fold lower, at least 260 fold lower, at least 270 fold lower, at least 280 fold lower, at least 290 fold lower, at least 300 fold lower, at least 310 fold lower, at least 320 fold lower, at least 330 fold lower, at least 340 fold lower, at least 350 fold lower, at least 360 fold lower, at least 370 fold lower, at least 380 fold lower, at least 390 fold lower, at least 400 fold lower, at least 410 fold lower, at least 420 fold lower, at least 430 fold lower, at least 440 fold lower, at least 450 fold lower, at least 460 fold lower, at least 470 fold lower, at least 480 fold lower, at least 490 fold lower, at least 500 fold lower, at least 190 times lower, at least 200 times lower, at least 210 times lower, at least 220 times lower, at least 230 times lower, at least 240 times lower, at least 250 times lower, at least 275 times lower, at least 300 times, at least 400 times, at least 500 times, at least 600 times, at least 700 times, at least 800 times, at least 900 times, at least 1000 times, at least 1100 times, at least 1200 times lower. In some embodiments, the low affinity mOKT3 scFv variant binds to CD3 with a KD at least 250 times lower than the dissociation constant KD of mOKT3 scFv. In some embodiments, the low affinity mOKT3 scFv variant binds to CD3 with a KD at least 1000 times lower than the dissociation constant KD of OKT3 scFv.

[0110] In some embodiments, the molecule that activates T cells is a membrane-tethered molecule. It is contemplated that other molecules, such as bacterial superantigens (e.g., SEB), phytohemagglutinin (PHA), or concanavalin A (ConA), which bind to and cluster the T cell receptor CD3 to activate T cells, will act similarly to the mOKT3 scFv tethered to the cell surface of immortalized cells. In some embodiments, the molecule that activates T cells is phytohemagglutinin (PHA). In some embodiments, the molecule that activates T cells is concanavalin A (ConA). It is contemplated that other monoclonal antibody scFv fragments that bind to the T cell receptor / CD3 component, such as the anti-CD3 antibody clone BC3, will also act similarly to the mOKT3 scFv tethered to the cell surface of immortalized cells. In some embodiments, the molecule that activates T cells is the anti-CD3 antibody clone BC3.

[0111] In some embodiments, the immortalized cells express Fc receptors. In such embodiments, an antibody that binds both an Fc receptor and a T cell antigen (e.g., CD3), such as a monoclonal anti-CD3 antibody, can be used to assess the efficacy of the TILs.

[0112] In other embodiments, the molecule that activates T cells is not expressed on immortalized cells. Rather, the molecule can be a bispecific molecule that can bind to both immortalized cells and T cells. Bispecific T cell engagers (e.g., blinatumomab) are one non-limiting example of molecules that bind to CD19 expressed by immortalized cells and CD3 expressed by T cells.

[0113] Co-culture conditions The methods provided herein, in some embodiments, comprise co-culturing lymphocytes (eg, TILs) and immortalized cells.

[0114] Immortalized cells can be cultured either as two-dimensional monolayers or as multi-layered three-dimensional spheroids, which are self-organizing multicellular aggregates that form in environments that prevent adhesion to flat surfaces.

[0115] Two-dimensional culture refers to adherent culture in which cells grow as a monolayer, for example in culture flasks, dishes, or multi-well plates with an adhesive surface. In comparison, three-dimensional spheroid culture is a non-adherent or low-adherent culture system in which cells grow as multi-layered spheroids, for example on non-adherent plates, in concentrated medium or gel-like substances, or in suspension culture on scaffolds.

[0116] In some embodiments, immortalized cells in a three-dimensional system are cultured on an ultra-low attachment (ULA) surface. An ultra-low attachment surface is a surface that includes a substance that inhibits specific and non-specific immobilization, forcing cells into a suspension state and allowing the formation of three-dimensional spheroids. In some embodiments, the ultra-low attachment surface includes a hydrophilic, neutrally charged coating. In some embodiments, a hydrophilic, neutrally charged hydrogel coating is covalently attached to the surface. In some embodiments, the surface includes polystyrene. Thus, in some embodiments, the ultra-low attachment surface is a polystyrene surface to which a hydrophilic, neutrally charged coating is covalently attached. As is known in the art, ultra-low attachment surfaces are generally stable, non-cytotoxic, biologically inert, and non-degradable.

[0117] In some embodiments, the immortalized cells in the three-dimensional system are cultured in ultra-low attachment multi-well plates (e.g., Corning®). In some embodiments, the ultra-low attachment surface of the multi-well plate (e.g., multi-well polystyrene plate) is a hydrophilic, neutrally charged covalently bonded hydrogel layer. A variety of multi-well formats are available, for example, 6-, 24-, or 96-well formats are available.

[0118] The culture conditions shown below can be used for both 2D and 3D co-culture.

[0119] In some embodiments, the co-culture of immortalized cells comprises 25,000 to 200,000 immortalized cells. For example, the co-culture of immortalized cells comprises 50,000 to 100,000 immortalized cells. In some embodiments, the co-culture of immortalized cells comprises 25,000, 30,000, 40,000, 50,000, 60,000, 70,000, 80,000, 90,000, or 10,000 immortalized cells.

[0120] In some embodiments, the immortalized cells are plated in a multi-well plate (e.g., a 96-well plate) containing, for example, culture medium (e.g., Dulbecco's Modified Eagle's Medium (DMEM)) that contains serum (e.g., fetal bovine serum (FBS)) and antibiotics (e.g., Pen / Strep).

[0121] In some embodiments, the immortalized cells are cultured in medium (e.g., in a multiwell plate having a ULA surface or in an adherent multiwell plate) for about 48 hours to about 96 hours (e.g., about 48 hours, about 60 hours, about 72 hours, about 84 hours, or about 96 hours) prior to addition of the TILs to form three-dimensional spheroids.

[0122] For example, to generate TILs (e.g., pre-REP TILs), prior to co-culture, in some embodiments, tumor digests (e.g., melanoma tumor digests) are thawed and plated (e.g., 1.5e6 cells / mL) in pre-REP medium in the presence of IL-2. Re-plating and feeding with IL-2 is repeated every 1-3 days in some embodiments, for example, until growth slows to less than 1.5-fold after 2 days.

[0123] The day before initiating co-culture, in some embodiments, pre-REP TILs are thawed and placed overnight in REP medium (eg, RPMI, AIM-V, 5% human AB serum, and IL-2).

[0124] In some embodiments, pan T cells are isolated from peripheral blood mononuclear cells (PBMCs) and co-cultured with immortalized cells.

[0125] In some embodiments, the co-culture is performed at an effector (T cell): target (immortalized cell) ratio (abbreviated as E:T) of 2:1. In some embodiments, the co-culture is performed at an E:T ratio of 1:1. In some embodiments, the co-culture is performed at an E:T ratio of 1:2. In some embodiments, the co-culture is performed at an E:T ratio of 3:1, 2:1, or 1:1. In some embodiments, the co-culture is performed at an E:T ratio of 5:1. In some embodiments, the co-culture is performed at an E:T ratio of 10:1. In some embodiments, the co-culture is performed at an E:T ratio of 20:1.

[0126] The duration of co-culture can vary. In some embodiments, the TILs and immortalized cells are co-cultured for at least 2 hours, at least 3 hours, or at least 4 hours. For example, the TILs and immortalized cells can be co-cultured for 2-72 hours, 2-48 hours, 2-36 hours, 2-24 hours, 2-12 hours, 4-72 hours, 4-48 hours, 4-36 hours, 4-24 hours, 4-12 hours, 12-72 hours, 8-72 hours, 8-48 hours, 8-36 hours, 8-24 hours, 8-12 hours, 12-72 hours, 12-48 hours, 12-36 hours, 12-24 hours, 24-72 hours, 24-48 hours, or 24-36 hours. In some embodiments, the TILs and the immortalized cells are co-cultured for about 2 hours, 4 hours, 6 hours, 8 hours, 12 hours, 18 hours, 24 hours, 36 hours, 48 ​​hours, or 72 hours. In some embodiments, the TILs and the immortalized cells are co-cultured for at least 12 hours, at least 24 hours, at least 48 hours, at least 36 hours, or at least 72 hours.

[0127] In some embodiments, the co-culture of TILs and immortalized cells contains interleukin-2 (IL-2), IL-15, or a combination thereof, for example, at a final concentration of about 5,000 U / ml to about 8,000 U / ml (e.g., 5,000 U / ml, 5,500 U / ml, 6,000 U / ml, 6,500 U / ml, 7,000 U / ml, 7,500 U / ml, or 8,000 U / ml).

[0128] IL-2 is an interleukin, a type of cytokine signaling molecule in the immune system. It is a 15.5-16 kDa protein that regulates the activity of white blood cells (leukocytes, often lymphocytes) involved in immunity. IL-2 is part of the body's natural response to microbial infections. IL-2 mediates its action by binding to the IL-2 receptor expressed by lymphocytes. The main sources of IL-2 are activated CD4+ T cells and activated CD8+ T cells.

[0129] IL-2 has an essential role in tolerance and immunity, key functions of the immune system, primarily through its direct action on T cells. In the thymus, where T cells mature, it prevents autoimmune diseases by promoting the differentiation of certain immature T cells into regulatory T cells, which suppress other T cells that are otherwise stimulated to attack normal healthy cells in the body. IL-2 promotes activation-induced cell death (AICD). It also promotes the differentiation of T cells into effector T cells, and memory T cells if the original T cells are also stimulated by antigen, helping the body fight off infections. IL-2, along with other polarizing cytokines, stimulates naive CD4+ T cells to differentiate into Th1 and Th2 lymphocytes, while preventing them from differentiating into Th17 and follicular Th lymphocytes. Its expression and secretion are tightly regulated and function as part of both transient positive and negative feedback loops in amplifying and dampening immune responses. IL-2 plays a role in sustaining cell-mediated immunity through its role in the generation of T cell immunological memory, which depends on the expansion in numbers and function of antigen-selected T cell clones.

[0130] IL-15 is a 14-15 kDa glycoprotein encoded in humans by a 34 kb region of chromosome 4q31. IL-15 is a cytokine structurally similar to IL-2. Like IL-2, IL-15 binds to and signals through a complex composed of the IL-2 / IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is constitutively expressed by many cell types and tissues, including monocytes, macrophages, dendritic cells (DCs), keratinocytes, fibroblasts, muscle cells, and neurons. As a pleiotropic cytokine, IL-15 plays an important role in innate and adaptive immunity. IL-15 regulates the activation and proliferation of T cells and natural killer (NK) cells. The survival signal that maintains memory T cells in the absence of antigen is provided by IL-15. This cytokine is also involved in the development of NK cells.

[0131] Evaluation of lymphocyte antitumor efficacy After co-culture of lymphocytes (e.g., TILs) and immortalized cells, the anti-tumor efficacy of the lymphocytes can be assessed, for example, by measuring degranulation (e.g., CD107a expression), cytokine production (e.g., IFN-γ), and / or cell death and / or viability of the immortalized cells over a period of time. For example, the period for assessing efficacy can be 12-72 hours. In some embodiments, the anti-tumor efficacy of lymphocytes (e.g., TILs) is assessed for 12-48 hours, 12-36 hours, 12-24 hours, 24-72 hours, 24-48 hours, or 24-36 hours. In some embodiments, the anti-tumor efficacy of lymphocytes (e.g., TILs) is assessed for 12 hours, 24 hours, 36 hours, 48 ​​hours, or 72 hours. In some embodiments, the anti-tumor efficacy of lymphocytes (eg, TILs) is assessed for at least 12 hours, at least 24 hours, at least 48 hours, at least 36 hours, or at least 72 hours.

[0132] Methods for measuring degranulation include, but are not limited to, cell surface staining of lysosomal associated membrane glycoproteins (LAMPs), such as CD107a or CD107b, using flow cytometry display measurements. LAMPs are found in the lipid bilayer of cytolytic granules and, upon release to mediate killing by TILs, fuse with the surface of TILs, serving as markers of degranulation and direct cytotoxicity.

[0133] Methods for measuring cytokine production include, but are not limited to, ELISA, Luminex, or MSD assays of cell culture supernatants following co-culture of mOKT3-A375 cell lines with TILs, or qRT-PCR analysis of cytokine transcripts in TILs following mOKT3-A375 co-culture.

[0134] Methods for measuring cell death and / or viability to assess efficacy include, but are not limited to, real-time cell viability assays, ATP cell viability assays, live cell protease viability assays, tetrazolium reduction cell viability assays, resazurin reduction cell viability assays, dead cell protease release cytotoxicity assays, lactate dehydrogenase release cytotoxicity assays, and DNA dye cytotoxicity assays. Other assays for measuring cell health, cell death, and / or cell viability known in the art are also contemplated herein. Non-limiting examples of such assays are provided below.

[0135] Cell viability assays use a variety of markers as indicators of metabolically active (living) cells. Examples of commonly used markers include measurement of ATP levels, measurement of substrate reduction capacity, and detection of enzyme / protease activities characteristic of living cells.

[0136] The RealTime-Glo™ MT Cell Viability Assay (Promega; Cat. No. G9711) measures cell viability in real time. In this assay, engineered luciferase and a pro-substrate (not a luciferase substrate) are added directly to the culture medium. The pro-substrate can penetrate the cell membrane and enter the cell. However, only metabolically active live cells can reduce the pro-substrate to a luciferase substrate. The substrate then exits the cell and is used by luciferase in the detection reagent to generate a luminescent signal. The same wells can be repeatedly measured for 3 days. The main advantages of this method are the convenient use of fewer plates and cells and kinetic monitoring to quantify dose response. In addition, because this method does not require cell lysis, the same cells can be used for further cell-based assays or downstream applications.

[0137] Since only viable cells can synthesize ATP, ATP can be used to measure cell viability. ATP can be measured using the CellTiter-Glo® Luminescent Cell Viability Assay (Promega; Catalog No. G7570) with a reagent that includes detergent, stabilized luciferase, and luciferin substrate. The detergent lyses viable cells and releases ATP into the medium. In the presence of ATP, luciferase uses luciferin to generate luminescence that can be detected within 10 minutes using a luminometer. The CellTiter-Glo® 2.0 Assay (Promega; Catalog No. G9241) is provided as a single solution, reducing reagent preparation time for ease of implementation and offering the convenience of room temperature storage. These ATP assays do not require long incubation times to convert the substrate to a colored product. They also have excellent sensitivity and a wide linear range, making them suitable for high-throughput applications where small numbers of cells are used. They are also less prone to artifacts than other methods.

[0138] Live cell protease activity is a useful marker for viable cells because it disappears rapidly after cell death. Using the CellTiter-Fluor™ Cell Viability Assay (Promega; Cat. No. G6080), live cell protease activity can be measured using a cell-permeable fluorescent protease substrate (GF-AFC). The substrate enters live cells where it is cleaved by live cell proteases to generate a fluorescent signal proportional to the number of live cells. The incubation time in this method is 0.5-1 h, which is shorter than the tetrazolium assay (1-4 h). Because this method does not lyse cells, it can be multiplexed with many other assays (including bioluminescent reporter cell-based assays) in the same sample well.

[0139] Tetrazolium compounds used for the detection of live cells fall into two basic categories.

[0140] A positively charged compound (MTT) that easily permeates live cells: Metabolically active viable cells can convert MTT to a purple formazan product. Thus, color formation can be a useful marker for viable cells. The CellTiter 96® Non-Radioactive Cell Proliferation Assay (MTT) (Promega; Cat. No. G4000) uses this chemistry. However, the incubation time for this method is long (usually 4 hours). Also, because the formazan product is insoluble, a solubilizing reagent must be added before the absorbance readings are recorded.

[0141] Negatively charged compounds that do not permeate cells (MTS, XTT, WST-1): When using the CellTiter 96® AQueous One Solution Cell Proliferation Assay (MTS) (Promega; Cat. No. G3582), negatively charged compounds must be coupled to an intermediate electron coupling reagent so that they can enter the cell, be reduced, and then exit the cell to convert the tetrazolium to a soluble formazan product. Incubation times for this method range from 1 to 4 hours. The resulting formazan is soluble, making it convenient without the need for the addition of a solubilizing reagent.

[0142] Resazurin is a deep blue cell-permeable indicator dye with weak intrinsic fluorescence. The CellTiter-Blue® Cell Viability Assay (Promega; Cat. No. G8080) uses resazurin to measure cell viability. Only metabolically active viable cells can reduce resazurin to pink, fluorescent resorufin. After 1-4 hours of incubation, the signal is quantified using a microplate spectrophotometer or fluorometer. This method is relatively inexpensive and more sensitive than the tetrazolium assay. However, fluorescence from the compound under test can interfere with the displayed value of resorufin.

[0143] The difficulty with all tetrazolium or resazurin reduction assays is that they rely on the accumulation of a colored or fluorescent product over time: since the signal increases slowly over time, any decrease in cell viability during this long incubation cannot be detected.

[0144] When cells die and lose membrane integrity, dead cell proteases are released. Dead cell protease activity can then be measured using luminogenic (CytoTox-Glo™ Cytotoxicity Assay; Promega; Cat. No. G9290) or fluorogenic (CytoTox-Fluor™ Cytotoxicity Assay; Promega; Cat. No. G9260) substrates. Because this substrate does not permeate cells, essentially no signal from this substrate is generated from intact live cells. Furthermore, because this assay is non-lytic, it can be multiplexed with other compatible assay chemistries.

[0145] Dead cells that have lost membrane integrity release lactate dehydrogenase (LDH), which catalyzes the conversion of lactate to pyruvate with the concomitant production of NADH. The released LDH activity can be measured by providing excess substrates (lactate and NAD+) to produce NADH, which can be measured using a variety of assay chemistries.

[0146] 1. LDH-Glo™ Cytotoxicity Assay: In the LDH-Glo™ Cytotoxicity Assay (Cat. No. J2380), reductase uses NADH and a reductase substrate (proluciferin) to generate luciferin, which is measured using a proprietary luciferase and the light signal is proportional to the amount of LDH measured by a luminometer.

[0147] 2. CytoTox-ONE™ Homogeneous Membrane Integrity Assay: CytoTox-ONE™ Homogeneous Membrane Integrity Assay (Promega; Cat. No. G7890): Conversion of resazurin to the fluorescent resorufin product (measured using a fluorimeter).

[0148] 3. CytoTox 96® Non-Radioactive Cytotoxicity Assay: The CytoTox 96® Non-Radioactive Cytotoxicity Assay (Promega; Cat. No. G1780) detects the conversion of a tetrazolium salt (INT) to a red formazan product, measured by color absorbance.

[0149] Although some DNA-binding dyes are excluded from live cells, they can still enter and stain the DNA of permeable dead cells. Traditional dyes such as trypan blue often require manual counting of stained cells using a hemocytometer, which is laborious and not easily scalable. Another drawback of traditional dyes is that they can be toxic to cells and can only be used for endpoint measurements.

[0150] Newer dyes, such as CellTox™ Green dye, generate a fluorescent signal upon binding to DNA that is easily measured using a fluorometer. The dye can be diluted in culture medium and delivered directly to cells upon plating or treatment with test compounds, allowing real-time kinetic measurements. The CellTox™ Green Cytotoxicity Assay (Promega; Cat. No. G8741) is non-toxic, photostable, and easily scalable.

[0151] All references, patents, and patent applications disclosed herein are hereby incorporated by reference with respect to the subject matter for which each is cited, including in some cases the entire document.

[0152] As used in the specification and the claims, the indefinite articles "a" and "an" should be understood to mean "at least one," unless clearly indicated to the contrary.

[0153] Also, unless expressly indicated to the contrary, in any method including two or more steps or acts claimed in this specification, the order of the method steps or acts is not necessarily limited to the order in which the method steps or acts are recited.

[0154] In the claims and the above specification, all transitional phrases, such as "comprising," "including," "carrying," "having," "containing," "involving," "holding," "composed of," etc., are to be understood to be open-ended, i.e., to mean including, but not limited to, what follows. Only the transitional phrases "consisting of" and "consisting essentially of" shall be closed or semi-closed transitional phrases, respectively, as set forth in the U.S. Patent and Trademark Office Guidelines at Section 2111.03.

[0155] The terms "about" and "substantially" in front of a numerical value mean ±10% of the stated numerical value.

[0156] When a range of values ​​is given, each value between and including the upper and lower ends of the range is specifically contemplated and described herein. EXAMPLES

[0157] Example 1: Generation of the pan-T cell agonist protein mOKT3 and its low affinity variants A universal T cell agonist (referred to herein as membrane OKT3 (mOKT3) or pKSQ367) was generated by fusing the following amino acid sequences: Signal peptide from mouse IgG heavy chain: MERHWIFLLLLSVTAGVHS (SEQ ID NO: 1); scFv derived from mouse monoclonal anti-CD3e antibody clone OKT3: QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSGGGGSGGGGSGGGGSQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAHFRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEIN (SEQ ID NO: 2); and Transmembrane domain from human CD8: SHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV (SEQ ID NO: 12)

[0158] The codon-optimized cDNA encoding the mOKT3 protein was cloned into a lentiviral vector plasmid containing the EF1A promoter, followed by the T2A self-cleaving peptide (EGRGSLLTCGDVEENPGP (SEQ ID NO: 15)) and the blasticidin resistance gene (MAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTGVNVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPGIKAIVKDSDGQPTAVGIRELLPSGYVWEG* (SEQ ID NO: 16)). The final construct containing the OKT3-CD8 protein expressed by the EF1A promoter is also referred to herein as pKSQ367.

[0159] Low affinity variants of the mOKT3 protein were constructed by site-directed mutagenesis of the pKSQ367 lentiviral construct. Positions R55 and Y57 of the scFv were mutated to R55M and Y57A, respectively (alias mOKT3ma / pKSQ397), or to R55L and Y57T, respectively (alias mOKT3lt / pKSQ398), as described in Chen et al. doi.org / 10.3389 / fimmu.2017.00793. The published affinities of these scFv variants were lower than those of the parent OKT3 clone (KD of published affinity: 5×10 -10 M (Law et al., Reinhertz et al.)). The low affinity variants of mOKT3 more closely model the affinity of the natural T cell receptor (TCR) to its recognized antigen (published affinities in the μM KD range). Many T cells respond to very strong mOKT3 stimulation, while the low affinity TCR binding allows for the resolution of small differences in TCR signaling thresholds from cell to cell, potentially allowing for more sensitive quality assessment of T cell therapy products before infusion into patients.

[0160] The lentiviral construct was packaged by co-transfecting 293T cells with pCMV-VSV-G and psPax2 lentiviral packaging plasmids. The viral supernatant was transferred to A375 cells, and 48 hours after transduction, the medium was switched to medium containing blastidine to select cells with successfully transduced mOKT3 construct. The successfully transduced selected A375 cells are designated A375-pKSQ367 (also designated A375-mOKT3).

[0161] Example 2: Generation of mOKT3-A375 cells and demonstration that the cells activate T cells.

[0162] 50,000 or 100,000 A375-pKSQ367 cells were plated per well in a 96-well plate containing Dulbecco's modified Eagle's medium (DMEM), fetal bovine serum (FBS), and antibiotics. Pan T cells were isolated from peripheral blood mononuclear cells (PBMCs) and co-cultured with the previously plated A375-pKSQ367. Co-culture was performed at an effector:target ratio of 2:1 (abbreviated as E:T). The medium was removed from the previously plated A375-pKSQ367, and 100,000 or 200,000 T cells in hematopoietic serum-free medium containing IL-2 were added to wells containing 50,000 or 100,000 A375-pKSQ367, respectively. The supernatant was removed from the plate, and the cells were stained with anti-CD3 and anti-CD69 antibodies. Flow cytometry was performed to measure CD69 expression, and CD69 activation was observed in all transduced samples (Figure 1).

[0163] To verify the surface expression of mOKT3, A375-pKSQ367 cells were incubated with goat serum in cell staining buffer, after which the cells were washed with cell staining buffer and then incubated with 1:100 goat-anti-mouse antibody. The cells were washed and flow cytometry was performed to evaluate the expression. OKT3 expression was observed in 99.2% of the transduced cells (Figure 2).

[0164] Killing of mOKT3-A375 cells by tumor-infiltrating lymphocytes (TILs) To generate pre-REP TILs, melanoma tumor digest samples were thawed and plated at 1.5e6 cells / mL in pre-REP medium (containing heat-inactivated human AB serum, Pen / Step, HEPES buffer, Glutamax, β-mercaptoethanol, gentamicin, IL-2, and DNase (added only to D277 and D3291 cultures). IL-2 was then added to the cells. Cells were counted and replated at 1e6 cells / mL in pre-REP medium containing IL-2 (D277 and D3291) or 1:1 pre-REP TIL medium: hematopoietic serum-free medium and IL-2 (D5746). IL-2 replating and feeding was repeated until growth slowed to less than 1.5-fold after 2 days. D277, D3291, and D5746 were frozen after the culture period.

[0165] The day before initiating co-culture, pre-REP TILs from three donors were thawed and placed overnight in REP medium containing IL-2. The day before initiating co-culture, 6,000 A375-pKSQ367 cells were plated in a 96-well plate containing REP medium containing IL-2 and caspase 3 / 7 dye. The following day, medium was removed from the 96-well plate and TILs were added to the A375-pKSQ367 cells plated the day before at an E:T of 10:1, 3:1, 1:1, or 0.3:1. Plates were imaged every 2 hours for 3 days on an IncuCyte. We observed recognition and killing of A375-pKSQ367 cells by TILs across all E:Ts tested (Figures 3A-3C).

[0166] Alternative OKT3 Membrane Anchor Examples: The purpose of this experiment was to show that mOKT3 can be expressed on the cell surface using various signal peptides and membrane anchors, and that mOKT3 can be expressed by other cell types in addition to A375 cells. Two million K562 cells were transduced with lentiviruses encoding pKSQ328, pKSQ377, pKSQ378, pKSQ368, and pKSQ369 constructs containing OKT3 scFv fused to various signal peptides (e.g., mouse IgG, human CSF2R, and human CD5) and membrane anchor proteins (including mouse CD8a, human CD8a, human CD28, and human CD14). 48 hours after transduction, transduced K562 cells were selected for the plastidine resistance marker (if present). Eight days after transduction, K562 stable cell lines were plated at 100,00 cells / well in the presence of 100,000 pan T cells isolated from donor PBMCs in IL-2-containing medium. 24 hours after plating, cells were stained with anti-CD8 and anti-CD69 antibodies. Flow cytometry was performed to quantify surface expression of CD69 (a marker of T cell activation) on CD8+ T cells compared to unstimulated controls. It was observed that the combination of multiple signal peptides and membrane anchors used in the construction of the mOKT3 construct drove T cell activation (Figure 4).

[0167] Example 3: Characterization: Expression of mOKT3, co-culture with pan T cells, and CD69 induction A375 parental cells (containing NucLightRed, a red fluorescent nuclear reporter) were transduced with pKSQ367, pKSQ396, pKSQ397, or pKSQ398. The "low affinity" constructs pKSQ396, pKSQ397, and pKSQ398 were transduced with three different viruses to ensure transduction.

[0168] To assess the transduction and efficacy of the constructs, several assays were performed. 1. mOKT3 expression on the cell surface. 2. Activation of pan T cells expressing CD69 after co-culture with A375-transduced target cells. 3. Reduced growth of A375-transduced cells after co-culture with patient-derived melanoma TILs (an indication of recognition by TILs).

[0169] A375 cells (both A375 parental and transduced lines) were resuspended in cell culture medium at 1.5e6 / mL and plated in 96-well V-bottom plates at 0.75e5 / 50μL / well and incubated overnight. The next day, plated cells were blocked with goat serum in cell staining buffer and incubated in the dark. Subsequently, cells were stained with (1:100) goat anti-mouse IgG2a polyclonal, Alexa647 in cell staining buffer and incubated. After washing, cells were resuspended in cell staining buffer and acquired on a BD Fortessa (Figures 5-7).

[0170] A375 cells (both A375 parental and transduced lines) were resuspended in cell culture medium at 1.5e6 / mL and plated in 96-well V-bottom plates at 0.75e5 / 50μL / well and incubated overnight. The next day, PBMCs (donor no. 148192) were thawed and pan T cells were isolated following the manufacturer's protocol. Isolated pan T cells were counted and resuspended at 1.5e6 / mL. 0.75e5 of isolated pan T cells were added (50μL per well) to plated A375 target cells and incubated overnight. Plated cells were washed with cell staining buffer and stained with anti-CD69 Ab BV785 in cell staining buffer and incubated. After washing, cells were resuspended in cell staining buffer and acquired on a BD Fortessa (Figures 8-11).

[0171] Example 4: Two-dimensional A375-pKSQ367 co-culture model A375 cells (both A375 parental and transduced lines) were resuspended in cell culture medium at 1.2e5 / mL and plated at 6e3 / 50μL / well in 96-well flat-bottom plates and incubated overnight. The next day, 6e3 / 50μL / well of each TIL condition in REP medium (AIMV, RPMI, human AB serum) was added on top of the plated A375 target cells. One REP medium containing IL-2 was added to each co-culture well. Co-culture plates were incubated at room temperature and then moved to the IncuCyte. Co-culture plates were incubated in the IncuCyte for an additional period after which image collection began. Images were acquired every 2 hours for a total of 72 hours (read phase and red with a 10x objective). IncuCyte images were quantified by the total area of ​​red fluorescence detected in each well and then normalized back to 0 hours to identify changes in target cell expansion / reduction over time (Figures 12-14).

[0172] In Figures 13 and 14, A375 pKSQ367 and A375 pKSQ398 cells were cultured as monolayers, respectively. Unedited and gene-edited TILs were added to the cultures, and TIL cytotoxicity was measured by the change in tumor cell area through imaging. When A375 pKSQ367 was used as the tumor target, neither SOCS1 nor CBLB gene-edited TILs showed better tumor control than unedited TILs (Figure 13). When A375 pKSQ398 was used as the tumor target, neither TILs were able to control tumor growth (Figure 14). Thus, in the setting of culturing tumor targets as monolayers, the efficacy of unedited and edited TILs cannot be distinguished.

[0173] Example 5: Three-dimensional A375-pKSQ367 spheroid co-culture model Because 3D tumor spheroids can provide a more challenging target and complex microenvironment than a monolayer of target cells, we explored using A375-pKSQ367 spheroids as target cells in co-culture assays, which may allow us to confirm subtle differences in potency between edited and unedited TILs.

[0174] High affinity (pKSQ367) and low affinity (pKSQ398) A375 strains generated from a single clone were used for spheroid-based coculture.

[0175] High and low affinity clones of A375-pKSQ367 were maintained in DMEM (supplemented with heat-inactivated FBS and antibiotics). A375-pKSQ367 high affinity single cell clone 20 was used for the high affinity spheroid co-culture assay, and A375-pKSQ367 low affinity single cell clone 6 was used for the low affinity spheroid co-culture assay.

[0176] For A375-pKSQ367 spheroid coculture, a common protocol was followed. Day -4: A375-pKSQ367 were passaged in RPMI supplemented with FBS and antibiotics and plated at a density of 5,000-10,000 viable cells / well. Plates were transferred to an Incucyte Imaging System in a 37°C, 5% CO2 incubator and incubated to promote spheroid formation. Images were taken once every few hours at 4x magnification in phase and red channels. Day -1: Cryopreserved TILs from 4 donors (donor 1: D4267, NSCLC; donor 2: D4397, NSCLC; donor 3: D6164, melanoma; donor 4: D6481, melanoma) were thawed, washed, counted, and resuspended in TIL medium (RPMI1640, supplemented with AIM V and human AB serum) at 3e^6 viable cells / mL. IL-2 was added. Cells were placed in appropriately sized flasks and placed in a 37°C, 5% CO2 incubator overnight. Day 0: TILs were filtered through a cell strainer into an appropriately sized conical tube, centrifuged, and counted. The plate with A375-pKSQ367 spheroids was removed from the Incucyte. TILs were added to the A375-pKSQ367 spheroids at effector:target cell (E:T) ratios ranging from 10:1 to 0.625:1. E:T ratios were calculated based on live TIL (effector) counts on day 0 and the initial seeding density of A375-pKSQ367 (target). Some wells did not receive TILs and served as growth controls. The plate was transferred to the Incucyte imaging system in a 37°C, 5% CO2 incubator, and imaging continued as on day 4. Day 6: Imaging was stopped and analysis was performed by visual evaluation of images collected by Incucyte.

[0177] In this case, analysis was performed by converting the images to black and white and comparing the area of ​​spheroids (black) remaining in the wells at a given time point. The data was also analyzed by assessing the fluorescence intensity of the spheroids. A reduction in the level of fluorescence was used as an indicator of spheroid death. This assay can also be designed to assess target cell apoptosis by reading out chromium release or caspase 3 expression.

[0178] The morphology of A375-pKSQ367 spheroids was assessed in wells where no TILs were added. Differences in morphology of high and low affinity spheroids were observed. Specifically, at the same plating density (10,000 cells / well), the high affinity strain (labeled "A375-pKSQ367" in the figures) formed much "larger" / "looser" spheroids than the low affinity strain (labeled "A375-OKT3lt" in the figures). The difference in morphology was observable during the period of spheroid coculture (4-10 days after A375-OKT3 seeding). Morphological differences may also exist between clones of the same lineage, and such morphological differences may provide another opportunity to elucidate subtle differences between T cells (Figure 15).

[0179] Cytotoxicity of TILs against A375-pKSQ367 spheroids was assessed by comparing the effect of increasing E:T ratios at the same time points. When TILs and A375-pKSQ367 spheroids were co-cultured, dose-dependent killing of both high affinity spheroids (labeled "A375-OKT3" in the figures) (donors 1 and 2) and low affinity spheroids (labeled "A375-OKT3lt" in the figures) (donors 1, 2, 3, and 4) by both EP-free and SOCS1-edited TILs was observed (Figure 16).

[0180] The difference in cytotoxicity kinetics of TILs against high affinity spheroids of A375-pKSQ367 (indicated as "A375-pKSQ367" in the figures) and low affinity spheroids (indicated as "A375-pKSQ367A375-pKSQ398" in the figures) was evaluated by comparing the size of remaining high affinity and low affinity spheroids at the same time point. It was observed that high affinity spheroids died more quickly than low affinity spheroids from donors 1 and 2 (Figure 17).

[0181] In Figure 17, when A375 pKSQ367 (A375-OKT3) tumor cells were grown as 3D tumor spheroids for 4 days before adding TILs, SOCS1-edited TILs showed higher tumor killing ability than unedited control (no EP), with a ratio of 1.25:1 showing complete tumor clearance by SOCS1-edited TILs, whereas residual tumor was observed in unedited control wells. Enhanced efficacy of SOCS1-edited TILs was also observed when A375 pKSQ398 (A375-OKT3lt) cells were grown as 3D tumor spheroids, but this difference was observed at a higher E:T ratio (5:1).

[0182] We assessed whether SOCS1-edited TILs increased killing of high affinity A375-pKSQ367 spheroids at the same E:T. Increased cytotoxicity against high affinity A375-pKSQ367 spheroids by SOCS1-edited TILs was observed in the case of donor 2. These images were taken 5 days after co-culture, indicating that A375-pKSQ367 can distinguish TILs with different antitumor potency (Figure 18).

[0183] We assessed whether SOCS1-edited TILs increased killing of low affinity A375-pKSQ367 spheroids. For donors 2, 3, and 4, we observed increased potency against A375-pKSQ367 low affinity spheroids from SOCS1-edited TILs. These results indicate that A375-pKSQ367 low affinity spheroids increase the sensitivity of distinguishing TIL populations of different potencies (Figure 19).

[0184] Whether SOCS1-edited TILs increased killing of low affinity A375-pKSQ367 spheroids was assessed by spheroid fluorescence. A375-OKT3lt cells were plated in 96-well ultra-low attachment plates and cultured for 4 days to form spheroids. On day 4, SOCS1-edited TILs or control (e.g., unedited) TILs were thawed and added to the spheroid cultures at various effector:target (E:T) ratios. Spheroid cytotoxicity by SOCS1-edited TILs or control (e.g., unedited) TILs was monitored by InCucyte as a function of changes in spheroid fluorescence levels. SOCS1-edited TILs showed increased killing of low affinity A375-pKSQ367 spheroids with increasing E:T ratios (Figure 20).

[0185] Example 6: Use of the A375-pKSQ367 model to assess TIL potency based on IFN-γ and / or IL-6 cytokine release TIL potency can also be measured from the supernatant based on cytotoxicity and / or cytokine release. Low affinity A375-pKSQ367 cell three-dimensional (3D) spheroids were used as target cells in co-culture assays to assess cytotoxicity and effector cytokine release. High (pKSQ367) lines generated from single clones could also be used as described below.

[0186] High and low affinity clones of A375-pKSQ367 were maintained in DMEM (supplemented with heat-inactivated FBS and antibiotics) for single-cell suspension and 3D spheroid co-culture assays.

[0187] A similar protocol was followed for A375-pKSQ367 3D spheroid coculture. Day -4 (3D spheroid co-culture only): A375-pKSQ367 were passaged in RPMI (supplemented with FBS and antibiotics) and plated at a density of 5,000-10,000 viable cells / well. Plates were transferred to an Incucyte imaging system in a 37°C, 5% CO2 incubator and incubated to promote spheroid formation. Images were taken once every few hours at 4x magnification in phase and red channels. Day -1: Cryopreserved TILs were thawed, washed once, counted, and resuspended in TIL medium (1:1 mix of RPMI1640 and AIM V, supplemented with human AB serum) at 3e6 viable cells / mL. IL-2 was added. Cells were placed in an appropriately sized flask and placed in a 37°C, 5% CO2 incubator overnight. For single cell suspension assays, A375-pKSQ367 cells were plated at a viable cell density of 5,000-10,000 cells / well. Plates were transferred to a 37°C, 5% CO2 incubator overnight before adding TILs. Day 0: TILs were filtered through a cell strainer into an appropriately sized conical tube, centrifuged, and counted. Plates containing A375-pKSQ367 spheroids and / or A375-pKSQ367 single cell suspensions were removed from the incubator. TILs were added at effector:target cell (E:T) ratios ranging from 20:1 to 0.625:1. E:T ratios were calculated based on live TIL (effector) counts on day 0 and the initial seeding density of A375-pKSQ367 (target). Some wells did not receive TILs and served as growth controls. Plates were transferred to a 37°C 5% CO2 incubator or to an Incucyte imaging system in a 37°C 5% CO2 incubator appropriate for the assay and imaging continued. ● 3D spheroid assay: Imaging was stopped between days 1 and 2 after TIL addition and analysis was performed by visual evaluation of images collected by Incucyte. Cytotoxicity of TILs towards A375-pKSQ367 spheroids was assessed by comparing the effect of increasing E:T ratio at this time point with supernatants harvested in parallel. IFNγ and / or IL-6 production as well as the presence of other cytokines were detected directly in the supernatant. As an alternative approach to assess TIL cytotoxicity, the levels of lactate dehydrogenase, which is rapidly released into the supernatant upon lysis of target cells, were also measured in the supernatant using the LDH-Glo™ Cytotoxicity Assay (Promega).

[0188] TILs with increased potency were predicted to result in greater IFNγ and IL-6 cytokine production in single-cell suspension or spheroid coculture assays, as assessed by ELISA, MSD, or Luminex assays, and / or exhibit greater cytotoxicity, as reflected by increased measurements of lactate dehydrogenase in the supernatant.

[0189] We assessed whether the potency of IFNγ and / or IL-6 of SOCS1-edited TILs grown in co-culture with low affinity A375-pKSQ367 spheroids was increased. Increasing the E:T ratio of SOCS1-edited TILs co-cultured with low affinity A375-pKSQ367 spheroids showed increased secretion of both IFNγ (Figure 21) and IL-6 (Figure 22). SOCS1-edited TILs produced higher levels of both cytokines at all E:T ratios.

[0190] Supernatants from co-cultures of SOCS1-edited TILs and low-affinity A375-pKSQ367 also showed higher levels of lactate dehydrogenase than those from co-cultures with control TILs, consistent with enhanced cytotoxicity resulting in greater A375-KSQ367 cell death and release of lactate dehydrogenase (Figures 23 and 24). [Table 1-1] [Table 1-2] [Table 1-3] [Table 1-4] [Table 1-5] [Table 1-6] [Table 1-7] [Table 1-8] [Table 1-9] [Table 1-10]

Table 1-11

Claims

1. A method for evaluating the potency of tumor-infiltrating lymphocytes (TILs), comprising: co-culturing the TILs and immortalized cells, wherein the immortalized cells contain molecules that activate T cells, and said co-culturing; evaluating the potency of the TILs. The method as described above.

2. The method according to claim 1, wherein the molecule binds to a T cell antigen.

3. The method according to claim 2, wherein the TILs express a T cell antigen.

4. The method according to claim 2, wherein the T cell antigen is a CD3 antigen.

5. The method according to claim 1, wherein the immortalized cells express the molecule.

6. The method according to claim 1, wherein the molecule is an antibody or an antibody fragment.

7. The method according to claim 6, wherein the antibody fragment is selected from single-chain variable fragments (scFv), F(ab’)2 fragments, Fab fragments, Fab’ fragments, and Fv fragments.

8. The method according to claim 1, wherein the antibody or the antibody fragment is an OKT3 antibody or an OKT3 antibody fragment, respectively.

9. The method according to claim 8, wherein the OKT3 antibody fragment is a membrane-bound OKT3 (mOKT3) scFv.

10. The method according to claim 1, wherein the molecule is selected from bacterial superantigens, optionally staphylococcal enterotoxin B (SEB), phytohemagglutinin (PHA), and concanavalin A (ConA).

11. The method according to claim 1, wherein the TILs are engineered TILs (eTILs).

12. The method according to claim 11, wherein the engineered eTILs involve genome modification.

13. The method according to claim 1, wherein the immortalized cells include a clonal population of immortalized cells.

14. The method according to claim 1, wherein the immortalized cells are immortalized human cells.

15. The method according to claim 14, wherein the immortalized cells are engineered cancer cells.

16. The method according to claim 1, wherein evaluating the potency includes measuring cytokine release from the immortalized cells, optionally IFN-γ, IL-2, TNFα, and / or IL-6 release, cell death and / or survival rate of the immortalized cells.

17. The method according to claim 1, wherein evaluating the potency includes measuring the growth, cell death, and / or survival rate of the immortalized cells.

18. The method according to claim 1, wherein the measurement comprises performing an assay selected from a real-time cell viability assay, an ATP cell viability assay, a live cell protease viability assay, a tetrazolium reduction cell viability assay, a resazurin reduction cell viability assay, a dead cell protease release cytotoxicity assay, a lactate dehydrogenase release cytotoxicity assay, and a DNA dye cytotoxicity assay.

19. A method for evaluating the efficacy of tumor infiltrating lymphocytes (TIL), comprising: co-culturing a clonal population of TIL and engineered cancer cells, wherein the engineered cancer cells express an anti-CD3 antibody or an anti-CD3 antibody fragment, said co-culturing, and evaluating the death and / or viability of the engineered cancer cells; or co-culturing TIL, immortalized cells, and a bispecific molecule that activates T cells and binds to the immortalized cells, and evaluating the efficacy of the TIL The method comprising the above.

20. A method for evaluating the efficacy of polyclonal T cells, comprising: co-culturing polyclonal T cells and immortalized cells, wherein the immortalized cells contain a molecule that activates T cells, said co-culturing, and evaluating the efficacy of the polyclonal T cells; or co-culturing polyclonal T cells, immortalized cells, and a bispecific molecule that activates T cells and binds to the immortalized cells, and evaluating the efficacy of the polyclonal T cells The method comprising the above.

Images