2-Amino-5,5-dimethylhexanoic acid derivatives as sortilin modulators for use in the treatment of diseases of the central nervous system
Patent Information
- Application Number
- JP2024514096
- Authority / Receiving Office
- JP · JP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2021-09-03
- Filing Date
- 2022-09-02
- Publication Date
- 2025-09-09
AI Technical Summary
Current treatments for diseases of the central nervous system face challenges due to the inability of therapeutic agents to cross the blood-brain barrier effectively, limiting their efficacy in addressing conditions such as neurodegenerative and psychiatric disorders.
Development of compounds that bind to and modulate sortilin activity, with a blood-to-brain partition coefficient (Kpuu) greater than 0.1, enabling them to cross the blood-brain barrier and treat or prevent diseases of the central nervous system.
These compounds effectively target sortilin in the brain, providing therapeutic benefits for neurodegenerative disorders, psychiatric disorders, and other CNS-related conditions by enhancing drug delivery across the blood-brain barrier.
Smart Images

Figure 2023031440000001 
Figure 2023031440000002 
Figure 2023031440000003
Abstract
Description
[Technical field]
[0001] The present invention relates to compounds that bind to and modulate the activity of Sortilin, as well as pharmaceutical compositions comprising these compounds.The present invention also relates to their use in the treatment or prevention of medical conditions in which modulation of Sortilin activity is beneficial.In particular, the present invention relates to compounds that can cross the blood-brain barrier and are useful in the treatment of diseases of the central nervous system. [Background technology]
[0002] Sortilin is a type I transmembrane protein that acts as a receptor for several ligands (Petersen et al., 1997). Sortilin is abundantly expressed in neurons and microglia of the nervous system, the inner ear, and some peripheral tissues involved in metabolic control (Tauris et al., 2020;Goettsch et al., 2017;Willnow et al., 2011;Kjolby et al., 2010). Besides acting as a receptor involved in signal transduction, sortilin mediates the sorting of select cargo between the cell surface trans-Golgi network and the endosomal pathway (Nykjaer & Willnow, 2012; Willnow, Petersen, & Nykjaer, 2008). Sortilin harbors a large extracellular domain designated VPS10 that defines a family of receptors named sortilin or VS10p domain receptors. The VPS10P domain in sortilin is homologous to yeast VPS10P and is composed of a 10-bladed beta-propeller structure and a cysteine-rich 10CC module (Nykjaer & Willnow, 2012; Zheng, Brady, Meng, Mao, & Hu, 2011).
[0003] Sortilin binds to multiple ligands, including pro-nerve growth factor (pro-NGF), pro-BDNF, pro-neurotrophin-3, neurotensin, and ApoB (Chen et al., 2005;Kjolby et al., 2010;Mazella et al., 1998;Nykjaer et al., 2004;Quistgaard et al., 2009;Yano, Torkin, Martin, Chao, & Teng, 2009). Furthermore, sortilin binds to progranulin (PGRN), a secreted protein involved in many cellular functions, including securing lysosomal processes, anti-inflammatory responses, and neurotrophic stimulation (Galimberti, Fenoglio, & Scarpini, 2018). Sortilin targets PGRN for rapid endocytosis and degradation, and it is now well established that sortilin is the most important clearance receptor for PGRN (Hu et al., 2010). Therefore, sortilin negatively regulates the extracellular levels of PGRN in the brain as well as in the periphery. Indeed, lack or blockade of the receptor increases plasma PGRN levels in both mice and humans (Carrasquillo et al., 2010; Gass, Prudencio, Stetler, & Petrucelli, 2012; Hu et al., 2010; Lee et al., 2014; Miyakawa et al., 2020; Pottier et al., 2018).
[0004] Frontotemporal dementia is a highly heritable dementia, and haploinsufficiency of the PGRN gene accounts for up to 25% of all cases (Gijselinck, Van Broeckhoven, & Cruts, 2008). Heterozygous loss-of-function mutations in PGRN Patients with PGRN have a >50% reduction in extracellular levels of the protein and invariably develop FTD, implicating PGRN as the causative gene for the disease (Baker et al., 2006; Carecchio et al., 2011; Cruts & Van Broeckhoven, 2008; Galimberti et al., 2010). Additionally, PGRN mutant alleles have been identified in Alzheimer's disease (AD) patients (Brouwers et al., 2008; Sheng, Su, Xu, & Chen, 2014), and high levels of extracellular PGRN are protective in models of ALS, Parkinson's disease, stroke, arthritis, and atherosclerosis (Egashira et al., 2013; Laird et al., 2010; Martens et al., 2012; Tang et al., 2011; Tao, Ji, Wang, Liu, & Zhu, 2012; Van Kampen, Baranowski, & Kay, 2014).
[0005] Sortilin, however, is not required for PGRN to induce its function; therefore, neurons lacking sortilin expression are equally responsive to PGRN-induced neuronal outgrowth (De Muynck et al., 2013; Gass, Lee, et al., 2012). Moreover, PGRN was successfully delivered to neuronal lysosomes in sortilin-deficient cells, suggesting the existence of an alternative trafficking pathway. Indeed, PGRN can bind to the lysosomal protein, prosaposin (PSAP). When PSAP binds to its cognate receptors, the cation-independent mannose-6-phosphate receptor and LRP1, it carries PGRN to lysosomes (Zhou et al., 2015). Finally, in a phase II clinical trial with a monoclonal anti-sortilin antibody, markers of lysosomal integrity were normal (NCT03987295).
[0006] A functional PGRN receptor remains to be identified, however, studies suggest that PGRN promotes neuronal survival, reduces inflammation, and increases Aβ endocytosis by microglia (Martens et al., 2012; Pickford et al., 2011; Yin et al., 2010).
[0007] Binding of PGRN to sortilin requires three amino acids (QLL in humans and PLL in mice) at the C-terminus of PGRN, and a peptide derived from the last 24 amino acids of PGRN binds with an affinity similar to the full-length protein (Zheng et al., 2011). This mode of binding is similar to that of neurotensin binding (Zheng et al., 2012). It has been proposed that the NTIS1 binding site of sortilin is structurally similar to that of the NTIS1 binding site of sortilin (Andersen et al., 2011), and there has been a successful small molecule screen done in collaboration with Aarhus University that identified blockers of neurotensin binding to sortilin (Andersen et al., 2014; Schroder et al., 2014).
[0008] Sortilin exists as a full-length and sorting-competent receptor, but also has the ability to form multimeric signaling receptor-ligands. Parts of Sortilin can also be released from the plasma membrane to scavenge ligands (NTs in pain) and control the activity of ligands. For example, Sortilin is involved in synaptic plasticity by controlling the rate of conversion of pro-BDNF to BDNF. This may also be applied to other pro-neurotrophins.
[0009] Finally, the receptor ligand, the propeptide of sortilin, also named spadin, mediates the function of the membrane transporter β-amyloides (AM) which is a target in major depression, among other disorders. It has been demonstrated to regulate the activity of TREK-1. Structurally, sortilin has the amino acid sequence set forth in SEQ ID NO: 1, and includes a signal peptide, a propeptide, a Vps10p domain, a 10cc domain (10CCa+10CCb), a transmembrane domain, and a cytoplasmic tail. The luminal domain of sortilin has six potential N-linked glycosylation sites, and the cytoplasmic tail allows for the recruitment of various adaptor proteins.
[0010] Sortilin binds to a vast number of ligands and membrane receptors, and as a result participates in functions known to be important in cell signaling and sorting. For example, sortilin is involved in signaling by the pro-forms of proneurotrophins: nerve growth factor (pro-NGF), brain-derived neurotrophic factor (pro-BDNF), and neurotrophin-3 (pro-NT3), respectively. In complex with the protein p75NTR (p75 neurotrophin receptor), sortilin has been reported to form a receptor for proneurotrophin-mediated apoptotic effects that lead to degeneration and cell death in cells and animal models (Jansen et al., 2007; Tenk et al., 2005; Nykjaer et al., 2004).
[0011] Previous studies have suggested a role for sortilin in cell sorting and signaling associated with diseases such as diabetes and obesity (Huang et al., 2013). Sortilin promotes translocation of GLUT4 to the plasma membrane and rescues it from degradation in lysosomes (Pan et al., 2017). Sortilin levels have been shown to be modulated by the levels of inflammation associated with these diseases. The pro-inflammatory cytokine, TNFα, reduces both sortilin mRNA and protein levels in cultured mouse and human adipocytes as well as in vivo when injected into mice (Kaddai et al., 2009). Sortilin can also affect cytokine secretion, and targeting sortilin in immune cells has been proposed to attenuate inflammation and reduce atherosclerosis disease progression (Mortensen et al., 2014). Additionally, US Patent Publication No. 2016 / 0331746 describes various scaffolds of small molecules capable of binding to the active site of sortilin, which is involved in the regulation of glucose uptake (Shi & Kandror. 2005) and the development of lipid disorder diseases (Gao et al., 2017).
[0012] Furthermore, it has been reported that plasma sortilin levels are a potential biomarker for identifying patients with either coronary heart disease or diabetes (Oh et al., 2017; Moller et al., 2021). Patients who showed increased sortilin levels in plasma and thus could be identified as suffering from the above conditions also showed enhanced glucose levels, suggesting sortilin as a therapeutic target for treating these conditions. Soluble sortilin has also been proposed as a treatment for type II diabetes (WO2021116290 A1, 2021).
[0013] TAR DNA-binding protein 43 (TDP-43) has been linked to various neurodegenerative diseases: for example, TDP-43 inclusions have been found in cases of amyotrophic lateral sclerosis (ALS), frontotemporal lobar degeneration (FTLD), and Alzheimer's disease (AD) ( Meneses et al., 2021 ).
[0014] TDP-43 regulates the splicing of several gene products, including sortilin. In humans, splicing involves the inclusion of cryptic exon 17b (between exons 17 and 18), which introduces a stop codon in the stalk potentially generating a non-membrane-bound fragment (Prudencio et al., 2012). Moreover, PGRN can reduce the levels of insoluble TDP-43 and slow axonal degeneration. It has been shown that sortilin inhibition can increase PGRN levels and thus be beneficial in the treatment of neurodegenerative diseases in which TDP 43 is implicated.
[0015] Sortilin has been implicated in a variety of conditions affecting the central nervous system (CNS). Some studies have suggested a role for circulating sortilin in patients with psychiatric disorders, such as depression, which may involve altering the activity of neurotrophic factors (Buttenshon et al. Sortilin has also been reported to play a role in brain aging, Alzheimer's disease and frontotemporal dementia (Xu et al., 2019). However, delivery of therapeutic agents with the ability to cross the blood-brain barrier and reach the CNS presents a major challenge.
[0016] The blood-brain barrier is a highly selective semi-permeable boundary of endothelial cells that prevents solutes in circulating blood from passing non-selectively into the extracellular fluid of the CNS where neurons reside. Treatment of neurological disorders is therefore limited due to restricted permeation of therapeutic agents across the blood-brain barrier.
[0017] Therapeutic agents for treating CNS diseases must therefore have the ability to cross the blood-brain barrier, in addition to which they must also have sufficient unbound drug concentrations in the brain, since the free drug hypothesis states that only unbound compounds can interact to elicit a pharmacological effect.
[0018] The non-binding ratio of the test compound (F ub The sample supernatant may be analyzed by methods such as liquid chromatography with tandem mass spectrometry (LC-MS / MS) to determine the unbound fraction. The unbound fraction is then calculated according to the following formula: F ub =C PBS / C plasma (In the formula, C PBS and C plasma are the analyte concentrations in PBS (receiver) and plasma (donor), respectively), may be calculated from the peak area ratios obtained for each matrix.
[0019] Recovery samples may be prepared without dialysis in each condition and are calculated according to the following formula: Recovery% = 100 × (V PBS ×C PBS +V plasma ×C plasma ) / V plasma ×C recovery (In the formula, V PBS is the volume in the receiver side (PBS) of the dialysis device, and V plasma is the volume at the donor site (plasma). C recovery is the analyte concentration measured from the recovered sample) may be used for assessment of recovery from dialysis experiments. Compounds such as propranolol or fluoxetine may be included in the experiment as controls.
[0020] Unbound fraction in the brain (F ub,brain ) is the value measured in the brain homogenate (F ub,meas) may be calculated from:
[0021]
number
[0022] (where D=dilution factor).
[0023] Brain / plasma unbound partition coefficient (K puu ) may be determined as the ratio between the free compound concentrations in plasma and brain:
[0024]
number
[0025] (In the formula, C u,brain = unbound concentration in brain (C × F ub,brain ) and; C = concentration at steady state; C ub,plasma = unbound concentration in plasma (C × F ub ) is.
[0026] For the treatment of CNS diseases, puu It is desirable for K to have the highest possible value above 0. A value of about 1 indicates that the free fraction compound freely permeates the blood-brain barrier; a value above 1 suggests that an active influx transport mechanism at the blood-brain barrier is involved; a value below 1 indicates that the free fraction compound is poorly permeable or is recognized by an active efflux mechanism to pass through the blood-brain barrier back to the plasma or CSF while reducing exposure in the CNS. A K of 0 or close to 0 puu The values indicate poorly permeable compounds or highly active efflux mechanisms, making in either case the likelihood of achieving meaningful exposure in the CNS of the desired active species very low.
[0027] In view of the above, a compound having the ability to cross the blood-brain barrier and a K value greater than 0.1 for use in treating diseases of the central nervous system is provided. puu There is an unmet need for sortilin modulators having the following properties: Diseases of the central nervous system include neurodegenerative disorders selected from motor neuron disease, frontotemporal lobar degeneration (FTLD), frontotemporal dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, prion diseases, such as Creutzfeldt-Jakob disease (CJD), acute brain injury, spinal cord injury, and stroke; psychiatric disorders selected from bipolar disorder, major depression, post-traumatic stress disorder, and anxiety disorder; hearing loss selected from noise-induced hearing loss, ototoxic hearing loss, age-related hearing loss, idiopathic hearing loss, tinnitus, and sudden hearing loss; brain tumors (e.g., glioblastoma), retinopathy, glaucoma, neuroinflammation, chronic pain, and diseases characterized by misfolded tau.
[0028] There is also an unmet need for new compounds that can be used in the treatment and prevention of medical conditions in which modulation of sortilin is beneficial, such as neurodegenerative disorders, psychiatric disorders, inflammatory disorders, cancer, pain, diabetes, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, kidney disease, psoriasis, inherited eye conditions, hearing loss or diseases characterized by misfolded tau. The neurodegenerative disorder may be selected from motor neuron disease, frontotemporal lobar degeneration (FTLD), frontotemporal dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, prion diseases such as Creutzfeldt-Jakob disease (CJD), acute brain injury, spinal cord injury and stroke; the psychiatric disorder may be selected from bipolar disorder, major depression, post-traumatic stress disorder and anxiety disorder; the inflammatory disorder may be selected from inflammatory disease and neuroinflammation; the cancer may be selected from breast cancer, lung cancer, ovarian cancer, prostate cancer, thyroid cancer, pancreatic cancer, glioblastoma and colorectal cancer; the cardiovascular disease may be selected from atherosclerosis, cardiomyopathy, heart attack, arrhythmia, heart failure and ischemic heart disease; and the hearing loss may be selected from noise-induced hearing loss, ototoxic hearing loss, age-related hearing loss, idiopathic hearing loss, tinnitus and sudden hearing loss. Summary of the Invention
[0029] The present invention provides compounds that bind to and modulate the activity of sortilin, and have a blood-to-brain K greater than 0.1. puu The present invention relates to compounds having the formula: Sortilin modulators are capable of crossing the blood-brain barrier and can be used in the treatment or prevention of diseases of the central nervous system. Diseases of the central nervous system may be selected from neurodegenerative disorders including motor neuron diseases, frontotemporal lobar degeneration (FTLD), frontotemporal dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, prion diseases such as Creutzfeldt-Jakob disease (CJD), acute brain injury, spinal cord injury, and stroke; psychiatric disorders including bipolar disorder, major depression, post-traumatic stress disorder, and anxiety disorder; hearing loss selected from noise-induced hearing loss, ototoxic hearing loss, age-related hearing loss, idiopathic hearing loss, tinnitus, and sudden hearing loss; brain tumors (e.g. glioblastoma), retinopathy, glaucoma, neuroinflammation, chronic pain, and diseases characterized by misfolded tau.
[0030] The present invention also relates to compounds of formula (I), pharmaceutical compositions comprising these compounds and the use of these compounds in the treatment or prevention of medical conditions in which modulation of sortilin activity is beneficial, including neurodegenerative disorders, psychiatric disorders, inflammatory disorders, cancer, pain, diabetes, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, kidney disease, psoriasis, inherited eye conditions, hearing loss or diseases characterized by misfolded tau. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0031] Detailed Description The inventors have surprisingly found that the compounds of the present invention are not only effective sortilin inhibitors, but are also able to cross the blood-brain barrier, a property not previously seen in inhibitors of sortilin, providing an opportunity for the development of more effective treatments for diseases of the central nervous system.
[0032] Thus, in a first aspect, the present invention provides compounds that bind to and modulate the activity of sortilin, the compounds having a blood-to-brain K greater than 0.1. puu The present invention provides a compound having the formula:
[0033] The compounds therefore have the ability to cross the blood-brain barrier and are suitable for use in the treatment of diseases of the central nervous system, as described herein.
[0034] The present invention provides a pharmaceutical composition comprising a compound according to the first aspect and a pharma- ceutically acceptable carrier, excipient and / or diluent.
[0035] The compound or pharmaceutical composition according to the first aspect may be used in the treatment or prevention of diseases of the central nervous system. The diseases may be selected from neurodegenerative disorders selected from motor neuron diseases, frontotemporal lobar degeneration (FTLD), frontotemporal dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, prion diseases such as Creutzfeldt-Jakob disease (CJD), acute brain injury, spinal cord injury and stroke; psychiatric disorders selected from bipolar disorder, major depression, post-traumatic stress disorder and anxiety disorder; hearing loss selected from noise-induced hearing loss, ototoxic hearing loss, age-related hearing loss, idiopathic hearing loss, tinnitus and sudden hearing loss; brain tumors, retinopathy, glaucoma, neuroinflammation, chronic pain and diseases characterized by misfolded tau.
[0036] The compound is 0.1-10, 0.1-5, 0.1-3, 0.1-2, 0.1-1, 0.1-0.8, 0.1-0.6, 0.1-0.5, 0.1-0.4, 0.1-0.3, or K of 0.1 to 0.2 puu In a second aspect, the present invention provides a compound according to the present invention, comprising:
[0037] [ka]
[0038] or a pharma- ceutically acceptable salt, solvate, hydrate, tautomer, optical isomer, N-oxide, and / or prodrug thereof, R 1 , R 2 and R 3 are each independently selected from the group consisting of halo, H, (C1-C4)alkyl, halo-(C1-C4)alkyl, (C2-C4)alkenyl, and halo-(C2-C4)alkenyl; and R 4 is selected from the group consisting of H, (C1-C3)alkyl, halo-(C1-C3)alkyl, (C3-C8)aryl, halo-(C3-C8)aryl, (C3-C8)heteroaryl and halo-(C3-C8)heteroaryl; R 5 is (C3-C 20 )-aryl, (C3-C 20 )-heteroaryl and 3- to 12-membered heterocyclic ring; the aryl, heteroaryl or heterocyclic ring is optionally substituted with one or more substituents independently selected from halo, -OH, cyano, carbonyl, (C1-C4)alkyl, (C1-C4)hydroxyalkyl, halo-(C1-C4)alkyl, acetyl, (C1-C4)alkoxy, halo-(C1-C4)alkoxy, (C3-C8)aryl and (C3-C8)heteroaryl; or R 4 and R 5 are taken together to form a 6- to 20-membered heterocyclic ring; The heterocyclic ring is monocyclic, bicyclic or tricyclic, and includes halo, -OH, cyano, carbonyl, (C1-C4) alkyl, halo-( ... 10 ) optionally substituted with one or more substituents independently selected from alkyl, acetyl, (C1-C4)alkoxy, and halo-(C1-C4)alkoxy. to provide.
[0039] Compounds of formula (I) according to the second aspect and sortilin modulators according to the first aspect have been found to bind to and modulate sortilin and may therefore be useful in conditions in which sortilin inhibition is beneficial, including neurodegenerative disorders, psychiatric diseases, inflammatory disorders, cancer, pain, diabetes, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, kidney disease, psoriasis, inherited eye conditions, hearing loss or diseases characterized by misfolded tau. The neurodegenerative disorder may be selected from motor neuron disease, frontotemporal lobar degeneration (FTLD), frontotemporal dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, prion diseases such as Creutzfeldt-Jakob disease (CJD), acute brain injury, spinal cord injury and stroke; the psychiatric disorder may be selected from bipolar disorder, major depression, post-traumatic stress disorder and anxiety disorder; the inflammatory disorder may be selected from inflammatory disease and neuroinflammation; the cancer may be selected from breast cancer, lung cancer, ovarian cancer, prostate cancer, thyroid cancer, pancreatic cancer, glioblastoma and colorectal cancer; the cardiovascular disease may be selected from atherosclerosis, cardiomyopathy, heart attack, arrhythmia, heart failure and ischemic heart disease; and the hearing loss may be selected from noise-induced hearing loss, ototoxicity. The hearing loss may be selected from hearing loss, age-related hearing loss, idiopathic hearing loss, tinnitus and sudden hearing loss.
[0040] As used herein, the term "Sortilin" may refer to full-length Sortilin (also referred to as immature Sortilin), including the signal peptide, propeptide, Vps10p domain, 10CC domain, transmembrane domain and large cytoplasmic tail, having the amino acid sequence set forth in SEQ ID NO:1 or SEQ ID NO:2, or to mature Sortilin, including the Vps10p domain, 10CC domain, transmembrane domain and large cytoplasmic tail, having the amino acid sequence set forth in SEQ ID NO:3, or a naturally occurring fragment, homolog or variant thereof. The terms "Sortilin" or "Sortilin molecule" are used interchangeably herein. It is understood that Sortilin has the ability to interact with pro-neurotrophin molecules to form a Sortilin / pro-neurotrophin complex. This Sortilin / pro-neurotrophin complex may or may not have the ability to interact with p75NTR molecules to form a trimeric complex including Sortilin, pro-neurotrophin and p75NTR. It is understood that this trimeric complex may be responsible for deleterious biological responses, such as stimulating apoptosis in retinal and ganglion cells, and controlling growth cone retraction of projecting axons (Jansen et al., 2007; Nykjaer et al., 2004; Santos et al., 2012; Skeldal et al., 2012).
[0041] As used herein, the term "pro-neurotrophin" refers to a larger precursor of neurotrophins that undergoes proteolytic cleavage to result in the mature form of neurotrophins. Neurotrophins are a family of proteins that induce the survival, development and function of neurons and are commonly referred to as growth factors. Pro-neurotrophins are biologically active and have distinct roles compared to their neurotrophin counterparts, such as inducing apoptosis. Examples of pro-neurotrophins include pro-NGF, pro-BDNF, pro-NT3 and pro-NT4. Pro-neurotrophins can also control synaptic plasticity. Mature neurotrophins induce synaptic strength, while in the pro form they can weaken synapses.
[0042] The compounds of the present invention may be sortilin inhibitors, binders, modulators or antagonists. As used herein, the terms "sortilin antagonist", "sortilin inhibitor", "sortilin binder" or "sortilin modulator" (used interchangeably) refer to substances that interfere with, block or otherwise attenuate the binding of sortilin protein to progranulin, or neurotensin or another extracellular ligand, or pro-neurotrophin (e.g., pro-NGF, pro-NT3, pro-BDNF), or prevent the formation of a trimeric complex between sortilin, p75NTR and pro-neurotrophin. The term "sortilin antagonist" also includes substances or agents that interfere with the formation of high affinity trimeric complexes. In the latter scenario, it is recognized that a trimeric complex can be formed in that sortilin can bind to p75NTR (but not pro-NGF) and p75NTR can simultaneously bind to the NGF domain of pro-NGF. However, the resulting trimeric complex may have lower affinity for its receptor and, as a result, may have a significantly reduced ability to stimulate apoptosis via the mechanisms described above. Skeldal et al. (2012) demonstrated that the apoptotic function of the trimeric complex is abolished when Sortilin lacks its intracellular domain. The term "Sortilin antagonist" also includes substances or agents that interfere with, block, or otherwise attenuate the effect of the Sortilin protein's interaction with p75NTR. This interaction may be completely prevented, in which case the formation of the trimeric complex is prevented, or may be only partially prevented, in which case the trimeric complex is Sortilin may form a complex with p75NTR, but it may have a reduced biological potency. Skeldal et al. showed that the complex formation between Sortilin and p75NTR relies on contact points in the extracellular domain of the receptor, and the interaction is critically dependent on the extracellular membrane-proximal 23 amino acid sequence of p75NTR. Therefore, Sortilin antagonists may interfere with this 23 amino acid sequence or the proximal sequence in the molecule. A "Sortilin antagonist" may act as a ligand cellular uptake inhibitor, and the ligand may be progranulin, neurotensin, BDNF, etc.
[0043] R 1 , R 2 and R 3 are preferably each independently selected from the group consisting of halo, (C1-C2)alkyl, and halo-(C1-C2)alkyl.
[0044] In a preferred embodiment of the present invention, R 1 , R 2 and R 3 are each independently selected from F, CH3 and CF3. Most preferably, R 1 , R 2 and R 3 For example, in exemplary compounds of the invention, R 1 , R 2 and R 3 may each be F, CH3, or CF3.
[0045] In another preferred embodiment of the present invention, R 4 is selected from the group consisting of H, (C1-C2)alkyl, halo-(C1-C2)alkyl, (C5-C8)aryl, halo-(C5-C8)aryl, (C3-C8)heteroaryl and halo-(C3-C8)heteroaryl.
[0046] Heteroaryl may contain 1, 2 or more heteroatoms. Preferably, heteroaryl contains 1 or 2 heteroatoms. Heteroatoms may be selected from N, S or O. In groups where more than one heteroatom is present, the heteroatoms may be the same or they may be different.
[0047] The aryl and heteroaryl groups may be monocyclic or bicyclic, preferably monocyclic. Preferably, the aryl and heteroaryl groups have 5 to 8 carbon atoms. The heteroaryl groups may have a ring size of 6 to 12 members, preferably 6 to 8 members.
[0048] In some preferred embodiments, R 4 teeth, (i) H (ii) CH3 (iii) CF3 (iv) CHF2 and [ka] is selected from the group consisting of:
[0049] In another preferred embodiment of the present invention, R 5 is (C5-C 12 )-aryl, (C5-C 12 )-heteroaryl, and 5- to 12-membered heterocyclic ring; the aryl, heteroaryl, or heterocyclic ring is optionally substituted with one or more substituents independently selected from halo, -OH, cyano, carbonyl, (C1-C2)alkyl, (C1-C2)hydroxyalkyl, halo-(C1-C2)alkyl, (C1-C2)alkoxy, halo-(C1-C2)alkoxy, (C3-C8)aryl, and (C3-C8)heteroaryl.
[0050] The alkyl, haloalkyl, alkoxy and haloalkoxy substituents may be straight or branched chain.
[0051] Substituents may be attached at any position of the aryl, heteroaryl or heterocyclic ring. One or more substituents may be attached to a carbon atom, a heteroatom or a combination thereof. Preferably, there are no substituents or 1 to 5 substituents.
[0052] Heteroaryl or heterocyclic rings may contain 1, 2 or more heteroatoms. Preferably, heteroaryl or heterocyclic rings contain 1 or 2 heteroatoms. Heteroatoms may be selected from N, S or O. In groups where more than one heteroatom is present, the heteroatoms may be the same or they may be different.
[0053] The heterocyclic ring may be aliphatic. It may be monocyclic, bicyclic or tricyclic. Preferably, the heterocyclic ring is monocyclic or bicyclic. Preferably, the heterocyclic ring has 5 to 10 members, more preferably 5 to 9 members.
[0054] The aryl and heteroaryl groups may also be monocyclic, bicyclic or tricyclic. Preferably, they are monocyclic or bicyclic. Preferably, the aryl and heteroaryl groups have a ring size of 5 to 10 members.
[0055] Preferably, R 5 is selected from the group consisting of:
[0056] [ka]
[0057] Alternatively, R 4 and R 5 taken together form an 8- to 20-membered heterocyclic ring, which heterocyclic ring is tricyclic.
[0058] Preferably, R 4 and R 5 together form the following structure:
[0059] [ka]
[0060] Particular compounds of the invention are those listed below. (S)-2-(((7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl)amino)-5,5-dimethylhexanoic acid; rac-2-(((7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl)amino)-5,5-dimethylhexanoic acid; (S)-2-(benzylamino)-5,5-dimethylhexanoic acid; (S)-5,5-Dimethyl-2-(((1-methyl-1H-indol-4-yl)methyl)amino)hexanoic acid; (S)-2-(Benzhydrylamino)-5,5-dimethylhexanoic acid; (S)-5,5-Dimethyl-2-(((1-methyl-1H-indol-4-yl)methyl)amino)hexanoic acid; (S)-5,5-Dimethyl-2-(((R)-1-phenylethyl)amino)hexanoic acid; (S)-5,5-Dimethyl-2-(((S)-1-phenylethyl)amino)hexanoic acid; (S)-5,5-Dimethyl-2-(((S)-2,2,2-trifluoro-1-phenylethyl)amino)hexanoic acid; (S)-5,5-Dimethyl-2-(((R)-2,2,2-trifluoro-1-phenylethyl)amino)hexanoic acid; (2S)-5,5-Dimethyl-2-{[(3-methylisoquinolin-8-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(isoquinolin-8-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-({[2-(trifluoromethoxy)phenyl]methyl}amino)hexanoic acid; (2S)-2-{[(2-fluorophenyl)methyl]amino}-5,5-dimethylhexanoic acid;
[0061] (2S)-2-{[(2,6-difluorophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-({[2-(trifluoromethyl)phenyl]methyl}amino)hexanoic acid; (2S)-2-{[(1S)-2,2-difluoro-1-phenylethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1R)-2,2-difluoro-1-phenylethyl]amino}-5,5-dimethylhexanoic acid; (S)-2-(((S)-2,2-difluoro-1-(3-methoxyphenyl)ethyl)amino)-5,5-dimethylhexanoic acid; (S)-2-(((R)-2,2-difluoro-1-(3-methoxyphenyl)ethyl)amino)-5,5-dimethylhexanoic acid; (S)-5,5-Dimethyl-2-(((R)-2,2,2-trifluoro-1-(3-methoxyphenyl)ethyl)amino)hexanoic acid; (S)-5,5-Dimethyl-2-(((S)-2,2,2-trifluoro-1-(3-methoxyphenyl)ethyl)amino)hexanoic acid; (S)-2-((3-(hydroxymethyl)benzyl)amino)-5,5-dimethylhexanoic acid; (S)-2-((2,3-dimethoxybenzyl)amino)-5,5-dimethylhexanoic acid; (S)-2-((3,5-dimethoxybenzyl)amino)-5,5-dimethylhexanoic acid; (S)-2-((2,5-dimethoxybenzyl)amino)-5,5-dimethylhexanoic acid; (2S)-2-{[(3-fluoro-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3-chloro-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3-bromo-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3,5-dichlorophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3-methoxy-4-methylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(2-fluoro-3-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid;
[0062] (2S)-5,5-Dimethyl-2-{[(quinolin-3-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-{[(quinolin-2-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3-fluoro-4-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3,4-dimethoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(5,6,7,8-tetrahydronaphthalen-1-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3,4-dihydro-2H-1-benzopyran-6-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(2,3-dihydro-1,4-benzodioxin-6-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(quinoxalin-6-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-[({1H-pyrrolo[2,3-b]pyridin-5-yl}methyl)amino]hexanoic acid; (2S)-5,5-Dimethyl-2-[({1H-pyrrolo[2,3-b]pyridin-4-yl}methyl)amino]hexanoic acid; (2S)-2-{[(2H-1,3-benzodioxol-4-yl)methyl]amino} -5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(quinolin-6-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-{[(quinolin-8-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-{[(quinolin-5-yl)methyl]amino}hexanoic acid;
[0063] (2S)-2-{[(2-methoxynaphthalen-1-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1H-indol-2-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1,3-benzothiazol-5-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-pyrazol-5-yl)methyl]amino}hexanoic acid; (2S)-2-{[(1,3-benzothiazol-6-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-indazol-6-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-{[(pyrimidin-5-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-({[2-(pyridin-4-yl)phenyl]methyl}amino)hexanoic acid; (2S)-2-({[3-(1H-imidazol-1-yl)phenyl]methyl}amino)-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(pyridin-4-yl)methyl]amino}hexanoic acid; (2S)-2-({[2-(hydroxymethyl)phenyl]methyl}amino)-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(1,5-naphthyridin-3-yl)methyl]amino}hexanoic acid; (2S)-2-{[(1S)-1-(3,4-dimethoxyphenyl)-2,2-difluoroethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1,7-dimethyl-1H-indol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-indazol-4-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-{[(1R)-1-(1-methyl-1H-indol-4-yl)ethyl]amino}hexanoic acid;
[0064] (2S)-2-{[(6-methoxynaphthalen-2-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1S)-1-(3,4-dimethoxyphenyl)-2,2,2-trifluoroethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1R)-1-(3,4-dimethoxyphenyl)-2,2-difluoroethyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-indol-7-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3,4-dimethylphenyl)methyl]amino}-5,5-dimethyl Hexanoic acid; (2S)-2-{[(1S)-1-(4-methoxy-3-methylphenyl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1R)-1-(3,4-dimethoxyphenyl)-2,2,2-trifluoroethyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-1,3-benzodiazol-5-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-1,3-benzodiazol-4-yl)methyl]amino}hexanoic acid; (2S)-2-{[(1S)-1-(3,4-dimethoxyphenyl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(2-methylpyrimidin-5-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-{[(2-methyl-1,3-benzothiazol-5-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3-chloro-4-methylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3-hydroxy-4-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid;
[0065] (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-1,2,3-benzotriazol-5-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-{[(pyrimidin-4-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-{[(1S)-1-(1-methyl-1H-indol-4-yl)ethyl]amino}hexanoic acid; (2S)-2-{[(3-acetylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1-ethyl-1H-indol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1-benzofuran-5-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1S)-1-(2-methoxypyridin-4-yl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1R)-1-(4-methoxy-3-methylphenyl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3,4-dichlorophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(5-bromopyridin-3-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-[({1-methyl-1H-pyrrolo[2,3-b]pyridin-5-yl}methyl)amino]hexanoic acid; (2S)-2-{[(5-methoxypyridin-3-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1H-indol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(isoquinolin-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(1R)-1-(pyrimidin-5-yl)ethyl]amino}hexanoic acid; (2S)-2-{[(4-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid;
[0066] (2S)-5,5-Dimethyl-2-{[(5-methylpyridin-3-yl)methyl]amino}hexanoic acid; (2S)-2-{[(2,3-dimethylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(1S)-1-(pyrimidin-5-yl)ethyl]amino}hexanoic acid; (2S)-2-{[(2H-indazol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(6-methylpyridin-3-yl)methyl]amino}hexanoic acid; (2S)-2-{[(2-chloro-3-fluoropyridin-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(isoquinolin-5-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(4-chlorophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(2-methoxypyridin-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(2-fluoro-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(2-methylpyridin-4-yl)methyl]amino}hexanoic acid; (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-indol-6-yl)methyl]amino}hexanoic acid; (2S)-2-{[(1R)-1-(3,4-dimethoxyphenyl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(3-methylpyridin-4-yl)methyl]amino}hexanoic acid;
[0067] (2S)-2-{[(3-methoxy-5-methylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3-cyanophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(4-methoxynaphthalen-1-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(4-fluoro-3-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-Dimethyl-2-{[(pyridin-3-yl)methyl]amino}hexanoic acid; and (2S)-2-{[(3-methoxy-2-methylphenyl)methyl]amino}-5,5-dimethylhexanoic acid.
[0068] In preferred compounds of formula (I), R 5 teeth, (i) phenyl, naphthyl, 5- or 6-phenyl, each of which is optionally substituted with one or more substituents independently selected from the group consisting of halo, -OH, (C1-C2)alkyl, (C1-C2)alkoxy, (C1-C2)hydroxyalkyl, (C1-C2)haloalkyl, (C1-C2)haloalkoxy, acetyl, cyano, imidazolyl, and pyridyl. is a 6-membered monocyclic heteroaryl, and a 9- or 10-membered fused bicyclic heteroaryl; and
[0069] [ka] is selected from the group consisting of:
[0070] A 5- or 6-membered monocyclic heteroaryl group contains 5 ring atoms, up to two of which are heteroatoms (preferably N) and the other ring atom is C.
[0071] A 9- or 10-membered fused bicyclic heteroaryl group contains two rings fused together so that they share two adjacent ring atoms. Preferably, the 9- or 10-membered fused bicyclic heteroaryl group contains a 6-membered ring fused to a 5- or 6-membered ring.
[0072] A 9- or 10-membered fused bicyclic heteroaryl group contains 9 or 10 ring atoms, up to three ring atoms being heteroatoms (preferably independently selected from N, O, and S), and the remaining ring atoms being C.
[0073] More preferably, R 5 teeth, (i) phenyl, pyridyl, pyrimidinyl, pyrazolyl, quinolinyl, isoquinolinyl, indolyl, azaindolyl, quinoxalinyl, benzothiazolyl, indazolyl, naphthyridinyl, naphthyl, benzimidazolyl, benzotriazolyl, and benzofuranyl, each of which is optionally substituted with one or more substituents independently selected from the group consisting of halo, -OH, (C1-C2)alkyl, (C1-C2)alkoxy, (C1-C2)hydroxyalkyl, (C1-C2)haloalkyl, (C1-C2)haloalkoxy, acetyl, cyano, imidazolyl, and pyridyl; and
[0074] [ka] is selected from the group consisting of:
[0075] More preferably, R 5 teeth, (i) phenyl optionally substituted with one or more substituents independently selected from the group consisting of halo, -OH, (C1-C2)alkyl, (C1-C2)alkoxy, (C1-C2)hydroxyalkyl, (C1-C2)haloalkyl, (C1-C2)haloalkoxy, acetyl, cyano, imidazolyl, and pyridyl; (ii) pyridyl optionally substituted with one or more substituents independently selected from the group consisting of halo, (C1-C2)alkyl, (C1-C2)alkoxy; (iii) pyrimidinyl and pyrazolyl, each of which is optionally substituted with one or more substituents independently selected from the group consisting of (C1-C2)alkyl; (iv) quinolinyl, isoquinolinyl, indolyl, azaindolyl, quinoxalinyl, benzothiazolyl, indazolyl, naphthyridinyl, naphthyl, benzimidazolyl, benzotriazolyl, and benzofuranyl, each of which is optionally substituted with one or more substituents selected from the group consisting of (C1-C2)alkyl and (C1-C2)alkoxy; and
[0076] [ka] is selected from the group consisting of:
[0077] More preferably, R 5 is one of the following groups:
[0078] [ka]
[0079] [ka]
[0080] [ka]
[0081] Alternatively, R 4 and R 5 together form the group:
[0082] [ka]
[0083] In the compound of formula (I), R 1 , R 2 and R 3 It is highly preferred that all are CH3.
[0084] Preferably, R 4 is phenyl in the compounds of formula (I), R 5 is phenyl.
[0085] Preferably, the compound of formula (I) has the following structure:
[0086] [ka]
[0087] The compounds of formula (I) of the present invention are intended for use in the treatment or prevention of neurodegenerative disorders, psychiatric disorders, inflammatory disorders, cancer, pain, diabetes, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, kidney disease, psoriasis, inherited eye conditions, hearing loss or diseases characterized by misfolded tau. They may also be used in the treatment or prevention of diseases of the central nervous system.
[0088] Preferably, the neurodegenerative disorder is selected from motor neuron diseases, frontotemporal lobar degeneration (FTLD), frontotemporal dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, prion diseases such as Creutzfeldt-Jakob disease (CJD), acute brain injury, spinal cord injury and stroke.
[0089] Preferably, the motor neuron disease is selected from amyotrophic lateral sclerosis (ALS), primary lateral sclerosis, and progressive muscular atrophy.
[0090] The neurodegenerative disorder is preferably characterized by misfolded TAR DNA binding protein 43 (tdp-43).In other words, the neurodegenerative disease is characterized by truncated tdp-43 and inclusions.Examples of such diseases include amyotrophic lateral sclerosis, Alzheimer's disease, frontotemporal lobar degeneration, and frontotemporal dementia.
[0091] Preferably, the psychiatric disorder is selected from bipolar disorder, major depression, post-traumatic stress disorder, and anxiety disorder.
[0092] Preferably, the inflammatory disorder may be selected from inflammatory diseases and neuroinflammation.
[0093] Preferably, the cancer is selected from breast cancer, lung cancer, ovarian cancer, prostate cancer, thyroid cancer, pancreatic cancer, glioblastoma and colorectal cancer.
[0094] Preferably, the cardiovascular disease is selected from atherosclerosis, cardiomyopathy, heart attack, arrhythmia, heart failure, and ischemic heart disease.
[0095] Preferably, the hearing loss is selected from noise-induced hearing loss, ototoxic hearing loss, age-related hearing loss, idiopathic hearing loss, tinnitus and sudden hearing loss.
[0096] Thus, in one embodiment, a compound for use according to the invention may disrupt the interaction between a Sortilin molecule and a pro-neurotrophin molecule, or may disrupt the interaction between a Sortilin molecule and a p75NTR molecule. The Sortilin molecule may be mature Sortilin.
[0097] According to a third aspect of the present invention, a compound according to the first or second aspect of the present invention and Pharmaceutical compositions are provided that include one or more pharma- ceutically acceptable carriers, excipients, and / or diluents.
[0098] In a fourth aspect of the invention there is provided a compound according to the first aspect of the invention, or a pharmaceutical composition according to the second aspect of the invention, for use in therapy.
[0099] According to a fifth aspect of the invention there is provided a compound according to the first or second aspect of the invention, or a pharmaceutical composition according to the third aspect of the invention, for use in the treatment or prevention of a neurodegenerative disorder, a psychiatric disorder, an inflammatory disorder, cancer, pain, diabetes, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, an inherited eye condition or hearing loss.
[0100] Preferably, the neurodegenerative disorder is selected from motor neuron disease, frontotemporal lobar degeneration (FTLD), frontotemporal dementia, Alzheimer's disease, Parkinson's disease and spinal cord injury.
[0101] Preferably, the psychiatric disorder is selected from bipolar disorder, major depression, post-traumatic stress disorder, and anxiety disorder.
[0102] Preferably, the cancer is selected from breast cancer, lung cancer, ovarian cancer, prostate cancer, thyroid cancer, pancreatic cancer, glioblastoma, and colorectal cancer.
[0103] Preferably, the hearing loss is selected from noise-induced hearing loss, ototoxic hearing loss, age-related hearing loss, idiopathic hearing loss, tinnitus and sudden hearing loss.
[0104] Preferably, the cardiovascular disease is selected from atherosclerosis, cardiomyopathy, heart attack, arrhythmias, heart failure, and ischemic heart disease (ie, coronary artery disease).
[0105] According to a sixth aspect of the invention there is provided the use of a compound according to the first or second aspect of the invention for the manufacture of a medicament for the treatment or prevention of a neurodegenerative disorder, a psychiatric disorder, an inflammatory disorder, cancer, pain, diabetes, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, an inherited eye condition or hearing loss.
[0106] According to a seventh aspect of the invention there is provided a method for the treatment or prevention of a disease or condition responsive to sortilin modulation comprising administering a therapeutically effective amount of a compound according to the first or second aspect of the invention or a pharmaceutical composition according to the third aspect of the invention.
[0107] The compounds of the present invention may include isotopically labeled and / or isotopically enriched forms of the compounds. The compounds of the invention herein may contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. Examples of isotopes that can be incorporated into the disclosed compounds include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, chlorine, e.g. 2 H, 3 H, 11 C. 13 C. 14 C. 13 N, 15 O. 17 O. 32 P, 35 S, 18 F, 36 Contains Cl.
[0108] The compounds of the present invention may be used as they are or, where appropriate, as their pharmacologically acceptable salts (acid or base addition salts). The pharmacologically acceptable addition salts mentioned below are meant to include the therapeutically active non-toxic acid and base addition salt forms that the compounds can form. Compounds that have basic properties can be converted to their pharma-ceutically acceptable acid addition salts by treating the base form with an appropriate acid. Exemplary acids include inorganic acids, such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, phosphoric acid; and organic acids, such as formic acid, acetic acid, propanoic acid, hydroxyacetic acid, lactic acid, pyruvic acid, glycolic acid, glycerol ... Acids include maleic acid, malonic acid, oxalic acid, benzenesulfonic acid, toluenesulfonic acid, methanesulfonic acid, trifluoroacetic acid, fumaric acid, succinic acid, malic acid, tartaric acid, citric acid, salicylic acid, p-aminosalicylic acid, pamoic acid, benzoic acid, and ascorbic acid. Compounds with acidic properties can be converted to their pharmaceutically acceptable base addition salts by treating the acid form with a suitable base. Exemplary base addition salt forms are sodium, potassium, calcium salts, and salts with pharmaceutically acceptable amines, such as ammonia, alkylamines, benzathine, and amino acids, such as arginine and lysine. The term addition salt, as used herein, also includes solvates, such as hydrates and alcoholates, that the compounds and their salts can form.
[0109] Throughout this disclosure, a given chemical formula or chemical name also encompasses all its pharma-ceutically acceptable salts, solvates, hydrates, N-oxides, and / or prodrug forms.It should be understood that the compounds of the present invention include any and all hydrates and / or solvates of the formula of the compound.It is understood that certain functional groups, such as hydroxy, amino, and similar groups, form complexes and / or coordination compounds with water and / or various solvents in the various physical forms of the compound.Therefore, it should be understood that the above formula includes and represents various hydrates and / or solvates thereof.
[0110] The compounds of the present invention also include tautomeric forms. Tautomeric forms result from the swapping of a single bond with an adjacent double bond with the concomitant migration of a proton. Tautomeric forms include prototropic tautomers, which are isomeric protonation states with the same empirical formula and overall charge. Exemplary prototropic tautomers include ketone-enol pairs, amide-imidic acid pairs, lactam-lactim pairs, amide-imidic acid pairs, enamine-imine pairs, and cyclic forms in which protons can occupy more than one position of a heterocyclic ring system, such as 1H- and 3H-imidazole, 1H, 2H- and 4H-1,2,4-triazole, 1H- and 2H-isoindole, and 1H- and 2H-pyrazole. Tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution.
[0111] The compounds described herein can be asymmetric (e.g., have one or more stereogenic centers). Unless otherwise indicated, all stereoisomers, such as enantiomers and diastereomers, are intended. Compounds of the present invention containing asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods for preparing optically active forms from optically active starting materials are known in the art, for example, by resolution of racemic mixtures or stereoselective synthesis. Many geometric isomers, such as olefins and C=N double bonds, can also exist in the compounds described herein, and all such stable isomers are contemplated in the present invention. Cis and trans geometric isomers of the compounds of the present invention are described, and they may be isolated as a mixture of isomers or as separated isomeric forms.
[0112] In the case of compounds containing asymmetric carbon atoms, the present invention relates to D-form, L-form and D,L mixtures, and also to diastereomeric forms when more than one asymmetric carbon atom is present. Compounds of the present invention containing asymmetric carbon atoms and generally occurring as racemates can be separated into optically active isomers in a known manner, for example using optically active acids. However, it is also possible to use optically active starting materials from the beginning, and the corresponding optically active or diastereomeric compounds are then obtained as final products.
[0113] The term "prodrug" refers to a compound that is capable of producing a biologically active compound of the present invention under physiological conditions or by solvolysis. Prodrugs refer to compounds that can be converted into active compounds in vivo. Prodrugs may be inactive when administered to a subject in need thereof, but are converted in vivo to the active compounds of the invention. Prodrugs are typically rapidly converted in vivo, for example by hydrolysis in blood, to yield the parent compounds of the invention. Prodrug compounds usually offer advantages of solubility, tissue compatibility, or delayed release in mammalian organisms (see Silverman, RB, The Organic Chemistry of Drug Design and Drug Action, 2nd Ed., Elsevier Academic Press (2004), pp. 498-549). Prodrugs of the compounds of the invention may be prepared by modifying functional groups present in the compounds of the invention, such as hydroxy, amino, or mercapto groups, such that the modifications are cleaved to yield the parent compounds of the invention, either by routine manipulation or in vivo. Examples of prodrugs include, but are not limited to, acetate, formate, and succinate derivatives of hydroxy functional groups or phenylcarbamate derivatives of amino functional groups.
[0114] The term "treatment" as used herein may include prevention of the named disorder or condition, or amelioration or elimination of the disorder after it has been established. The term "prophylaxis" refers to the prevention of the named disorder or condition.
[0115] The methods delineated herein include methods in which a subject is identified as needing a particular described treatment. Identification of a subject in need of such treatment can be the judgment of the subject or a health care professional, and can be subjective (e.g., observation) or objective (e.g., measurable by a test or diagnostic method).
[0116] In other embodiments, the methods herein include methods further comprising monitoring the subject's response to treatment administration. Such monitoring may include periodic imaging or sampling of subject tissues, fluids, specimens, cells, proteins, chemical markers, genetic material, etc., as markers or indicators of the treatment regimen. In other methods, subjects are pre-screened or identified as in need of such treatment by assessment for relevant markers or indicators of suitability for such treatment.
[0117] The present invention provides a method for monitoring the progress of treatment. The method includes determining the level or performing a diagnostic measurement (e.g., screening, assay) of a diagnostic marker (marker) (e.g., any target or cell type as described herein that is modulated by a compound as described herein) in a subject suffering from or susceptible to a disorder or a symptom thereof as described herein, and administering a sufficient therapeutic amount of a compound as described herein to treat the disease or a symptom thereof. The level of the marker determined in the method can be compared to a known level of the marker in either a healthy normal control or another affected patient to establish the disease state of the subject. In a preferred embodiment, a second level of the marker in the subject is determined at a time later than the determination of the first level, and the two levels are compared to monitor the progress of the disease or the effectiveness of the treatment. In certain preferred embodiments, a pre-treatment level of the marker in the subject is determined prior to the initiation of treatment according to the present invention; this pre-treatment level of the marker can then be compared to the level of the marker in the subject after the initiation of treatment to determine the effectiveness of the treatment.
[0118] The level of the marker or marker activity in a subject may be determined at least once. For example, a comparison of the marker level with another measurement of the marker level obtained previously or subsequently from the same patient, another patient, or a normal subject may be useful in determining whether the treatment according to the present invention has the desired effect, thereby allowing for the adjustment of dosage levels accordingly. The determination of the marker level may be performed according to any method known in the art or as described herein. Any suitable sampling / expression assay method described herein may be used. Preferably, a tissue or fluid sample is first removed from the subject. Examples of suitable samples include blood, urine, tissue, oral or cheek cells, and hair samples containing hair roots. Other suitable samples will be known to those skilled in the art. Determination of protein levels and / or mRNA levels (e.g., marker levels) in the sample may be performed using any suitable technique known in the art, including, but not limited to, enzyme immunoassays, ELISA, radiolabeling / assay techniques, blotting / chemiluminescence, and real-time PCR.
[0119] For clinical use, the compounds disclosed herein are formulated into pharmaceutical compositions (or formulations) for various modes of administration. It is understood that the compounds of the present invention may be administered together with physiologically acceptable carriers, excipients, and / or diluents (i.e., one, two, or all three of these). The pharmaceutical compositions disclosed herein may be administered by any suitable route, preferably by oral, rectal, nasal, topical (including ophthalmic, buccal, and sublingual), sublingual, transdermal, intrathecal, transmucosal, or parenteral (including subcutaneous, intramuscular, intravenous, and intradermal) administration. Other formulations may conveniently be provided in unit dosage form, for example, tablets and sustained release capsules, as well as liposomes, and may be prepared by any method well known in the art of pharmacy. Pharmaceutical formulations are usually prepared by mixing the active substance, or a pharmaceutically acceptable salt thereof, with a conventional pharmaceutically acceptable carrier, diluent, or excipient. Examples of excipients are water, gelatin, gum arabic, lactose, microcrystalline cellulose, starch, sodium starch glycolate, calcium hydrogen phosphate, magnesium stearate, talcum, and colloidal silicon dioxide. Such formulations may also contain other pharmacologically active agents, as well as conventional additives, such as stabilizers, wetting agents, emulsifiers, flavoring agents, and buffers. Usually, the amount of active compound is 0.1-95% of the weight of the formulation, preferably 0.2-20% of the weight of the formulation for parenteral use, and more preferably 1-50% of the weight of the formulation for oral administration. The formulations may be further prepared by known methods, such as granulation, compression, microencapsulation, spray coating, and the like. The formulations may be prepared in the dosage form of tablets, capsules, granules, powders, syrups, suspensions, suppositories, or injections by conventional methods. Liquid formulations may be prepared by dissolving or suspending the active substance in water or other suitable medium. Tablets and granules may be coated in conventional manner. To maintain therapeutically effective plasma concentrations for extended periods of time, the compounds disclosed herein may be incorporated into slow release formulations.
[0120] The dose level and frequency of administration of a particular compound will vary depending on a variety of factors, including the potency of the particular compound employed, the metabolic stability and length of action of that compound, the age, weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, severity of the condition to be treated, and the patient undergoing treatment. Daily dosages may be within the range of about 0.001 mg to about 100 mg per kilogram of body weight, administered in single or multiple doses, for example, at doses of about 0.01 mg to about 25 mg each. Usually, such dosages are given orally, although parenteral administration may also be selected.
[0121] definition "Optional" or "optionally" means that the subsequently described event or circumstance may, but need not, occur, and that the description includes instances in which the event or circumstance occurs as well as instances in which it does not occur.
[0122] The term "heteroatom" means O, N, or S.
[0123] The term “(C1-C n )Alkyl" is an alkyl group having 1 to n carbon atoms, i.e. 1, 2, 3... or represents a straight-chain, branched-chain, or cyclic or partially cyclic alkyl group having n carbon atoms. n For a "(C1-C2) alkyl" group to contain a cyclic moiety, it must be formed from at least three carbon atoms. nFor the moiety "(C1-C6)alkyl" all subgroups thereof are envisaged. For example, in the range (C1-C6)alkyl, all subgroups are envisaged, such as (C1-C5)alkyl, (C1-C4)alkyl, (C1-C3)alkyl, (C1-C2)alkyl, (C1)alkyl, (C2-C6)alkyl, (C2-C5)alkyl, (C2-C4)alkyl, (C2-C3)alkyl, (C2)alkyl, (C3-C6)alkyl, (C3-C5)alkyl, (C3-C4)alkyl, (C3)alkyl, (C4-C6)alkyl, (C4-C5)alkyl, (C4)alkyl, (C5-C6)alkyl, (C6)alkyl. Examples of "C1-C6 alkyl" include methyl, ethyl, n-propyl, isopropyl, cyclopropyl, n-butyl, isobutyl, sec-butyl, t-butyl, cyclobutyl, cyclopropylmethyl, branched chain or cyclic or partially cyclic pentyl and hexyl, and the like.
[0124] The term "halo-(C1-C n )Alkyl" is preferably a C-C alkyl as defined above substituted with at least one halogen atom, which is preferably F, Cl, Br and I, more preferably F and Cl, most preferably F. n Represents alkyl.
[0125] Where a term denotes a range, for example in the definition of "1 to 6 carbon atoms" of (C1-C6)alkyl, each integer, i.e., 1, 2, 3, 4, 5, and 6, is considered to be disclosed.
[0126] The term “(C2-C n "(C2-C6)alkenyl" refers to a straight, branched, or cyclic or partially cyclic alkyl group having at least one carbon-carbon double bond and having from 2 to 6 carbon atoms. The alkenyl group may contain a ring formed from 3 to 6 carbon atoms. The range "(C2-C6)alkenyl" refers to a straight, branched, or cyclic or partially cyclic alkyl group having at least one carbon-carbon double bond and having from 2 to 6 carbon atoms. The alkenyl group may contain a ring formed from 3 to 6 carbon atoms. nFor the moiety "(C2-C4)alkenyl", all subgroups thereof are envisaged. For example, the range "(C2-C4)alkenyl" covers (C2-C4)alkenyl, (C2-C3)alkenyl, (C2)alkenyl. Examples of "(C2-C4)alkenyl" include 2-propenyl, 2-butenyl, 3-butenyl, 2-methyl-2-propenyl, and the like.
[0127] The term "(C1-C4)alkoxy" refers to -O-((C1-C4)alkyl), where the (C1-C4)alkyl group is as defined above and is attached to the remainder of the compound through an oxygen atom. Examples of "(C1-C4)alkoxy" include methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, isobutoxy, sec-butoxy and t-butoxy.
[0128] The term "halo(C1-C4)alkoxy" refers to (C1-C4)alkoxy as defined above substituted with a halogen atom, preferably F, Cl, Br and I, more preferably F and Cl, most preferably F.
[0129] The term "halo" refers to a halogen atom, preferably F, Cl, Br and I, more preferably F and Cl, and most preferably F.
[0130] The term "3- to 12-membered heterocyclic ring" refers to a non-aromatic ring system having 3 to 12 ring atoms in which at least one ring atom is a heteroatom.
[0131] "Effective amount" refers to that amount of a compound of the invention that confers a therapeutic effect in the treated subject. The therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., the subject gives an indication of or feels an effect). good.
[0132] As used herein, the term "administration" or "administering" refers to the route of administration for the compounds disclosed herein.Exemplary routes of administration include, but are not limited to, oral, intraocular, intravenous, intraperitoneal, intraarterial, and intramuscular.The preferred route of administration can vary depending on various factors, such as the components of the pharmaceutical composition comprising the compounds disclosed herein, the site of potential or actual disease, and the severity of disease.
[0133] The terms "subject" and "patient" are used interchangeably herein. They refer to a human or another mammal (e.g., a mouse, rat, rabbit, dog, cat, cow, pig, sheep, horse, or primate) that may or may not suffer from a disease or disorder, or that is susceptible to a disease or disorder. Preferably, the subject is a human.
[0134] The compounds of the invention may be disclosed by name or by chemical structure. If a discrepancy exists between the name of a compound and its associated chemical structure, the chemical structure shall prevail.
[0135] The present invention will now be further described by the following non-limiting examples. The following specific examples should be construed as merely illustrative, and in no way limit the remainder of the disclosure. Without further elaboration, it is believed that one skilled in the art can utilize the present invention to its fullest extent based on the description herein. All references and publications referred to in this specification are incorporated herein by reference in their entirety.
[0136] Preparation of the Compounds of the Invention The compounds of the present invention can be prepared according to the following general synthetic procedure schemes by methods well known and understood in the art. Suitable reaction conditions are well known in the art, and appropriate substitution of solvents and auxiliary reagents is within the common general knowledge of the skilled artisan. Similarly, it will be understood by those skilled in the art that synthetic intermediates can be isolated and / or purified by various well-known techniques as necessary or desired, and frequently various intermediates can be used directly in subsequent synthetic steps with little or no purification. Furthermore, those skilled in the art will understand that in some circumstances the order in which moieties are introduced is not critical. The specific order of steps required to prepare a compound of formula (I) will depend on the specific compound being synthesized, the starting compound, and the relative liability of the moieties being substituted, as is well understood by those skilled in the art. All substituents are as previously defined unless otherwise indicated, and all reagents are well known and understood in the art.
[0137] Suitable starting materials as optically active as single enantiomers or racemic mixtures and protected amino acids of general formula AA-1 are commercially available or may be prepared by various methods. For example, as shown in the general synthetic procedure, Scheme 1, the carboxylic acid function of an appropriately substituted amino acid of general formula AA-1 may be used as the free acid, PG=H, or protected as a suitable derivative, e.g., a methyl ester. The insertion of a substituent at the primary amine present in AA-1 can be carried out by various methods, and for illustrative purposes, by the reaction of a suitably substituted carbonyl compound Int-1, an aldehyde (R 5 =H) or ketones (R 4 and R 5≠H) and a reductive amination step with a reducing reagent, such as, but not limited to, sodium triacetoxyborohydride in a suitable solvent mixture, such as, for example, acetic acid and dichloromethane. An alternative method for introducing a substituent at the primary amine present in AA-1 uses an alkylation step between a suitable protected AA-1 and a reagent of type Int-2, as depicted in the general synthetic procedure scheme. In the latter, LG is converted to acetonite by a reductive amination step with a reducing reagent, such as, but not limited to, sodium triacetoxyborohydride in a suitable solvent mixture, such as, for example, acetic acid and dichloromethane. AA-1 represents a reactive leaving group, for example a bromine atom, which can be selectively displaced by a free amine in AA-1 in the presence of a suitable base, for example potassium carbonate, in a suitable solvent, such as ethyl acetate.
[0138] General synthetic procedure
[0139] [ka]
[0140] Compounds of general formula (I) may be prepared by a variety of procedures, some of which are described below. The products of each step may then be recovered by conventional methods including extraction, evaporation, precipitation, chromatography, filtration, trituration, crystallization, and the like.
[0141] The compounds of general formula (I) contain one or more stereogenic centers. They can be introduced from available single enantiomers, optically active starting materials of type AA-1. The completeness of the stereogenic centers present can be confirmed by analytical techniques well known to those skilled in the art, such as chiral support high pressure chromatography. Alternatively, when racemic starting materials are used, it is understood that single isomeric products can be obtained as single enantiomers or as single diastereoisomers, if desired, by known techniques such as preparative chiral support high pressure chromatography.
[0142] Those skilled in the art will also recognize that all of the substituents in a compound of formula (I) are identical to those used to synthesize the compound. It will be understood that the present invention does not necessarily permit certain particular reaction conditions to be used. These moieties may be introduced at any convenient point in the synthesis, or may be protected and then deprotected as necessary or desired, as is well known in the art. Those skilled in the art will understand that the protecting groups may be removed at any convenient point in the synthesis of the compounds of the invention. Methods for introducing or removing protecting groups used in the present invention are well known in the art; see, for example, Greene and Wuts, Protective Groups, Vol. 14, No. 1, pp. 111-115, 1997, 1999. See Groups in Organic Synthesis, 4th Ed., John Wiley and Sons, New York (2006). EXAMPLES
[0143] Abbreviation approx: about; aq: aqueous; br: broad; ca.: circa; CDI: 1,1'-carbonyldiimidazole; d: doublet; DCM: dichloromethane; DIC: N,N'-diisopropylcarbodiimide; dioxane: 1,4-dioxane; DIPEA: diisopropylethylamine; DMF: dimethylformamide; eq.: equivalent; Et3N: triethylamine; EtOAc: ethyl acetate; EtOH: ethanol; Fmoc: fluorenylmethoxycarbonyl; Boc: tert-butoxycarbonyl; h: hours; min: minutes: HAT U: 2-(3H-[1,2,3]triazolo[4,5-b]pyridin-3-yl)-1,1,3,3-tetramethylisouronium hexafluorophosphate (V); HPLC: high performance liquid chromatography; IPA, isopropanol; LC: liquid chromatography; m: multiplet; M: molar concentration, molecular ion; MeCN: acetonitrile; MeOH: methanol; MS: mass spectrometry; NMR: nuclear magnetic resonance; PDA: photodiode array; q: quartet; rt: room temperature (approximately 20 °C); RT: retention time; s: singlet, solid; SPPS: solid phase peptide synthesis; t: triplet; TBAF: tetrabutylammonium fluoride; TBME: tert-butyl methyl ether; TFA: trifluoroacetic acid; THF: tetrahydrofuran; UPLC: ultra performance liquid chromatography; UV: ultraviolet.
[0144] Other abbreviations are intended to convey their commonly accepted meaning.
[0145] General experimental conditions All starting materials and solvents were obtained from commercial sources or prepared according to literature references. Reactions were magnetically stirred and carried out at room temperature (approximately 20° C.) unless otherwise indicated.
[0146] Column chromatography was carried out on an automated flash chromatography system, such as a CombiFlash Rf system, using pre-packed silica (40 μm) cartridges unless otherwise indicated.
[0147] 1 H-NMR spectra were recorded at 400 MHz on a Bruker Avance AV-I-400 or Bruker Avance AV-II-400 instrument. Chemical shift values are expressed in ppm relative to tetramethylsilane unless otherwise noted. The following abbreviations or combinations thereof are used for the multiplicity of NMR signals: br = broad, d = doublet, m = multiplet, q = quartet, quint = quintet, s = singlet and t = triplet.
[0148] Analysis method Method 1 - UPLC_AN_BASE, Instrument: Waters IClass; Binary Pump: UPIBSM, UPISMFTN with SM: SO; UPCMA, PDA: U PPDATC, 210-320 nm, SQD: ACQ-SQD2 ESI; ELSD: gas pressure 40 psi, drift tube temperature: 50 °C; column: Waters XSelect CSH C18, 50 × 2.1 mm, 2.5 µm, temperature: 25 °C, flow rate: 0.6 mL / min, gradient: t0 = 5% B, t2.0 min = 98% B, t2.7 min = 98% B, post time: 0.3 min, eluent A: 10 mM ammonium bicarbonate in water (pH = 9.5), eluent B: acetonitrile.
[0149] Method 2 - PREP_ACID-AS4A, Instrument: Agilent Technologies G6130B Quadrupole; HPLC Instrument Type: Agilent Technologies 1290 preparative LC; column: Waters XSelect CSH (C18, 100 × 30 mm, 10μ); flow rate: 55 mL / min; column temperature: RT; eluent A: 0.1% formic acid in water; eluent B: 100% acetonitrile, linear gradient: t = 0 min 20% B, t = 2 min 20% B, t = 8.5 min 60% B, t = 10 min 100% B, t = 13 min 100% B; detection: DAD (220-320 nm); detection: MSD (ESI pos / neg) mass range: 100-1000; fraction collection based on MS and DAD.
[0150] Method 3 - UPLC Acid Method, Instrument: Waters HClass; Binary Solvent Pump, SM-FTN, CMA, PDA, QDa; Column: Waters ACQUITY UPLC® CSH (C18, 1.7 μm, 2.1×30 mm, 40° C.); Detection: UV at 210-400 nm unless otherwise indicated, MS with electrospray ionization; Solvents: A: 0.1% formic acid in water, B: MeCN Gradient:
[0151] [Table 1]
[0152] Method 4 - UPLC Basic Method; Instrument: Waters HClass; Binary Solvent Pump, SM-FTN, CMA, PDA, QDa; Column: Waters ACQUITY UPLC® BEH (C18, 1.7 μm, 2.1×30 mm, 40° C.); Detection: UV at 210-400 nm unless otherwise indicated, MS with electrospray ionization; Solvents: A: 0.2% ammonia in water, B: MeCN. Gradient:
[0153] [Table 2]
[0154] Method 5 - #acid3minb; Instrument: Agilent 1260; Quaternary pump, HiP Sampler, Column compartment, DAD: G6150 MSD; Column: Waters Cortecs (C18, 30×2.1 mm, 2.7 μm, 40° C.); Detection: UV at 260 nm+ / -90 nm unless otherwise indicated, MS with electrospray ionization; Solvents: A: 0.1% formic acid in water, B: MeCN. Gradient:
[0155] [Table 3]
[0156] Method 6 - #basic3minb; Instrument: Agilent 1260; Quaternary pump, HiP Sampler, Column compartment, DAD: G6150 MSD; Column: Phenomenex Evo (C18, 30×2.1 mm, 2.6 μm, 40° C.); Detection: UV at 260 nm+ / -90 nm unless otherwise indicated, MS with electrospray ionization; Solvents: A: 0.2% ammonia in water, B: MeCN; Gradient:
[0157] [Table 4]
[0158] Example 1 [ka]
[0159] Synthesis of (S)-2-(((7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl)amino)-5,5-dimethylhexanoic acid 1 (S)-2-Amino-5,5-dimethylhexanoic acid hydrochloride (100 mg, 0.51 mmol) and formaldehyde (0.084 mL, 3.07 mmol, 6 equiv.) were added to a solution of 7-hydroxy-4-methylcoumarin (90 mg, 0.51 mmol, 1 equiv.) in ethanol (2 mL). The mixture was stirred at 80° C. for 16 h. After cooling to room temperature, the white precipitate was collected by filtration. The filter was rinsed with ethanol (5 mL). (S)-2-(((7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl)amino)-5,5-dimethylhexanoic acid (45 mg, 0.130 mmol, 25% yield, 96.96% purity) was isolated as a white powder. LCMS (Method 1, 0.817 min; M+H=348.2; calculated 348.2). 1 H-NMR(400MHz,DMSO) δ 7.54(t,J=6.6Hz,1H), 6.86-6.71(m,1H), 6.12(s,1H), 4.05(d,J=6.3Hz,2H), 3.17 (t,J=6.1Hz,1H), 2.38(s,3H), 1.75-1.46(m,2H), 1.27-1.18(m,2H), 0.84(s,9H).
[0160] Example 2
[0161] [ka]
[0162] Synthesis of rac-2-(((7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl)amino)-5,5-dimethylhexanoic acid 2-Amino-5,5-dimethylhexanoic acid hydrochloride (100 mg, 0.51 mmol) and formaldehyde (0.084 mL, 3.07 mmol) were added to a solution of 7-hydroxy-4-methylcoumarin (90 mg, 0.51 mmol, 1 equiv.) in ethanol (2 mL). The mixture was stirred at 80° C. for 16 h. After cooling to room temperature, the white precipitate was collected by filtration. The filter was rinsed with ethanol (5 mL) and 2-(((7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl)amino)-5,5-dimethylhexanoic acid (20 mg, 0.058 mmol, 11.2% yield) was isolated as a white powder. LCMS (Method 1, 0.826 min; M+H=348.1; calculated 348.1). 1 H-NMR(400MHz,DMSO) δ 7.57(d,J=8.7Hz,1H), 6.81(d,J=8.7Hz,1H), 6.15(s,1H), 4.13-4.01(m,2H), 3.22 (t,J=6.1Hz,1H), 2.37(s,3H), 1.73-1.51(m,2H), 1.32-1.19(m,2H), 0.84(s,9H).
[0163] Example 3 [ka]
[0164] Synthesis of (S)-2-(benzylamino)-5,5-dimethylhexanoic acid hydrochloride Benzaldehyde (64 μL, 0.634 mmol, 1.01 equiv) was added to a mixture of (S)-2-amino-5,5-dimethylhexanoic acid (100 mg, 0.628 mmol) and sodium acetate (77 mg, 0.942 mmol, 1.5 equiv) in dichloromethane (1 mL). The mixture was stirred at room temperature for 2 h before sodium cyanoborohydride (79 mg, 1.256 mmol, 2 equiv) was added. The mixture was stirred at room temperature for 16 h. The solvent was evaporated in vacuo and the residue taken up in 1M HCl in water / methanol (1:1, 2 mL) and purified by basic reverse phase column chromatography (12 g Porapak RXn RP, 5%→100% acetonitrile in water (0.1M ammonium carbonate). Product containing fractions were combined. A white precipitate formed during evaporation. This was filtered off and the solid was dissolved in 2 mL 2M hydrochloric acid and lyophilized to give (S)-2-(benzylamino)-5,5-dimethylhexanoic acid hydrochloride (50 mg, 0.175 mmol, 27% yield, 94.82% purity). LCMS (Method 1, 0.880 min; M+H=250.0; calculated 250.0). 1 H-NMR(400MHz,DMSO) δ 14.02(s,1H), 9.45(s,2H), 7.52(dq,J=4.8,2.7Hz,2H), 7.48-7.39(m,3H), 4.16(d,J=2.1Hz,2H), 3.88(dd,J =7.1,4.6Hz,1H), 1.97-1.73(m,2H), 1.33(td,J=13.1,4.9Hz,1H), 1.12(td,J=12.9,4.4Hz,1H), 0.86(s,9H).
[0165] The following examples were prepared in a similar manner to Example 3, starting from (S)-2-amino-5,5-dimethylhexanoic acid (20 mg, 0.126 mmol) and their corresponding aldehydes. Targets were purified by preparative HPLC.
[0166] [Table 5-1]
[0167] [Table 5-2]
[0168] [Table 5-3]
[0169] [Table 5-4]
[0170] [Table 5-5]
[0171] Example 6
[0172] [ka]
[0173] Synthesis of (S)-5,5-dimethyl-2-(((1-methyl-1H-indol-4-yl)methyl)amino)hexanoic acid hydrochloride A suspension of 1-methyl-1H-indole-4-carbaldehyde (100 mg, 0.63 mmol, 1 equiv), (S)-2-amino-5,5-dimethylhexanoic acid (100 mg, 0.63 mmol) and acetic acid (0.036 mL, 0.63 mmol, 1 equiv) in dichloromethane (1 mL) was stirred at room temperature for 2 h before sodium triacetoxyborohydride (266 mg, 1.26 mmol, 2 equiv) was added. The resulting suspension was stirred at room temperature for 16 h. Aqueous sodium hydroxide (1 M, 1 mL) was added to the reaction mixture and the layers were separated. The aqueous phase was acidified with aqueous hydrochloric acid (2 M). A white precipitate formed which was filtered off. The solid was dissolved in 4 M hydrochloric acid in dioxane / water (1:1, 4 mL) and lyophilized to give (S)-5,5-dimethyl-2-(((1-methyl-1H-indol-4-yl)methyl)amino)hexanoic acid hydrochloride (66 mg, 0.195 mmol, 31% yield, 99% purity) as an off-white solid. LCMS (Method 1, 1.002 min; M+H=303.1; calculated 303.2). 1 H-NMR(400MHz,DMSO) δ 7.44-7.32(m,2H), 7.18-7.05(m,2H), 6.62(d,J=3.2Hz,1H), 4.19-3.99(m,2H), 3.79(s, 3H), 3.10(t,J=6.1Hz,1H), 1.57(dq,J=11.9,6.1Hz,2H), 1.30-1.12(m,2H), 0.81(s,9H).
[0174] The following examples were prepared in a similar manner to Example 6, starting from the corresponding aldehyde.
[0175] [Table 6-1]
[0176] [Table 6-2]
[0177] [Table 6-3]
[0178]
Table 6-4
[0179]
Table 6-5
[0180]
Table 6-6
[0181]
Table 6-7
[0182]
Table 6-8
[0183]
Table 6-9
[0184]
Table 6-10
[0185]
Table 6-11
[0186]
Table 6-12
[0187]
Table 6-13
[0188] [Table 6-14]
[0189] [Table 6-15]
[0190] [Table 6-16]
[0191] [Table 6-17]
[0192] [Table 6-18]
[0193] Example 34
[0194] [ka]
[0195] Synthesis of (S)-2-((2-fluoro-3-methoxybenzyl)amino)-5,5-dimethylhexanoic acid, HCl A suspension of (S)-2-amino-5,5-dimethylhexanoic acid (75 mg, 1 Eq, 0.47 mmol), 2-fluoro-3-methoxybenzaldehyde (73 mg, 1 eq, 0.47 mmol) and Et3N (48 mg, 66 μL, 1 Eq, 0.47 mmol) in MeOH (3 mL) was heated at 35 °C for 2 h, then cooled in an ice bath and treated with NaBH4 (18 mg, 1 Eq, 0.47 mmol) in one portion. The mixture was then warmed to rt and concentrated to dryness. This was then suspended in water (5 mL) and acetic acid (57 mg, 54 μL, 2 Eq, 0.94 mmol) was added. This was further diluted with water (5 mL) and MeCN (2 mL) before filtering. The filtered solid was then suspended in 1:1 acetone:water (20 mL) at 80° C. for 20 min before being cooled to rt, filtered, and washed with water (10 mL) and isohexane (10 mL). The solid was then taken up in water (5 mL) and MeCN (5 mL) followed by the addition of concentrated aqueous HCl (0.2 mL) to give a solution which was concentrated to give (S)-2-((2-fluoro-3-methoxybenzyl)amino)-5,5-dimethylhexanoic acid, HCl (122 mg, 0.36 mmol, 76%, 98% purity) as a colorless solid. UPLC (Method 3, 0.87min; M+H=298.3. 1H NMR (500MHz, DMSO) δ 14.03(s,1H), 9.36(s,2H), 7.28-7.18(m,2H), 7.17-7.12(m,1H), 4.25-4 .12(m,2H), 3.96-3.92(m,1H), 3.86(s,3H), 1.94-1.74(m,2H), 1.33(app. td,J=13.0,4.7Hz,1H), 1.11(app. td,J=13.0,4.4Hz,1H), 0.86(s,9H) 19F NMR(471MHz,DMSO) δ -137.89.
[0196] The following examples were prepared in a similar manner to Example 34, starting from the corresponding aldehyde.
[0197] [Table 7-1]
[0198] [Table 7-2]
[0199] [Table 7-3]
[0200] Example 8
[0201] [ka]
[0202] Synthesis of (S)-2-(benzhydrylamino)-5,5-dimethylhexanoic acid hydrochloride Bromodiphenylmethane (177 mg, 0.715 mmol) was added to a suspension of potassium carbonate (198 mg, 1.431 mmol) and methyl (S)-2-amino-5,5-dimethylhexanoate hydrochloride (75 mg, 0.358 mmol) in acetonitrile (1 mL) and stirred at 80° C. for 16 h. The reaction mixture was filtered and purified by flash chromatography (12 g silica; ethyl acetate in heptane 0%→50%) to give methyl (S)-2-(benzhydrylamino)-5,5-dimethylhexanoate (61 mg, 0.126 mmol, 35.2% yield) as a white solid. The product was dissolved in acetonitrile (1 mL) / water (1 mL) and lithium hydroxide monohydrate (37.7 mg, 0.898 mmol) was added. The mixture was stirred at 50° C. for 16 h. The reaction mixture was purified by acidic preparative HPLC (4 g ReproSil-Pur C18, acetonitrile 2-50% in water (+0.1% formic acid) and the product-containing fractions were combined and lyophilized. The white solid was dissolved in 4 mL MeCN, 1 mL hydrochloric acid (2M) was added and the vail was lyophilized again to give (S)-2-(benzhydrylamino)-5,5-dimethylhexanoic acid hydrochloride (46 mg, 0.127 mmol, 35% yield, 92.91% purity) as a white solid. LCMS (Method 1, 1.137 min; M+H=326.2; calculated 326.2). 1 H-NMR(400MHz,DMSO) δ 10.18(s,1H), 7.70(dd,J=11.6,7.5Hz,4H), 7.48-7.32(m,6H), 5.53(s,1H), 2.54(s,2H), 2 .02(s,1H), 1.78(d,J=17.7Hz,1H), 1.30-1.19(m,2H), 1.06(t,J=12.1Hz,1H), 0.83(s,9H). Contains 7% (w / w) DMSO.
[0203] Example 9
[0204] [ka]
[0205] Synthesis of (S)-5,5-dimethyl-2-(((1-methyl-1H-indol-4-yl)methyl)amino)hexanoic acid hydrochloride 2-Methoxybenzaldehyde (64.9 mg, 0.477 mmol) was added to a solution of methyl (S)-2-amino-5,5-dimethylhexanoate hydrochloride (100 mg, 0.477 mmol) and sodium acetate (77 mg, 0.939 mmol) in dichloromethane (1 mL). The mixture was stirred for 1 h. Sodium cyanoborohydride (80 mg, 1.273 mmol) was added and the mixture was stirred overnight. The solvent was evaporated and the residue was taken up in methanol (1 mL) and water (1 mL). Lithium hydroxide (57.1 mg, 2.384 mmol) was added and the mixture was stirred at 50° C. overnight. The solvent was removed and the residue was taken up in DMSO and purified by preparative HPLC (Method 2). The product-containing fractions were combined and lyophilized. The white solid was dissolved in 4 M hydrochloric acid in dioxane / water (1:1, 4 mL) and lyophilized to give (S)-2-((2-methoxybenzyl)amino)-5,5-dimethylhexanoic acid hydrochloride (66.2 mg, 0.210 mmol, 44% yield, 100% purity). LCMS (Method 1, 0.976 min; M+H=280.2; calculated 280.2). 1 H-NMR(400MHz,DMSO) δ 13.98(s,1H), 9.25(s,2H), 7.47(dd,J=7.5,1.7Hz,1H), 7.42(td,J=7.9, 1.7Hz,1H), 7.08(d,J=7.3Hz,1H), 7.00(td,J=7.6,1.1Hz,1H), 4.13(q,J= 13.1Hz,2H), 3.82(s,3H), 3.77(dd,J=7.1,4.7Hz,1H), 1.97-1.71(m,2H) , 1.32(td,J=13.1,4.9Hz,1H), 1.12(td,J=12.9,4.5Hz,1H), 0.86(s,9H).
[0206] The following examples were prepared in a similar manner to Example 9, starting from their corresponding aldehydes.
[0207] [Table 8-1]
[0208] [Table 8-2]
[0209] Example 14
[0210] [ka]
[0211] Synthesis of (S)-5,5-dimethyl-2-(((R)-1-phenylethyl)amino)hexanoic acid hydrochloride Sodium borohydride (86.9 mg, 2.297 mmol) was added to a suspension of zinc chloride (157 mg, 1.152 mmol) in 1,2-dimethoxyethane (1.15 mL) at 0 °C. The mixture was warmed to RT and aged for 18 h. Acetophenone (69.0 mg, 0.574 mmol) was added to a suspension of methyl (S)-2-amino-5,5-dimethylhexanoate hydrochloride (139 mg, 0.661 mmol) and potassium carbonate (198 mg, 1.433 mmol) in methanol (super anhydrous) (1.7 mL). The mixture was heated at 50 °C overnight and cooled to RT. The mixture was diluted with acetonitrile (anhydrous) (17 mL). The solution was added to a mixture of Zn(BH4)2 at -40 °C. After 4 h at -40 °C, 1 mL acetone was added and the mixture was warmed to RT. 5 mL 1M HCl was added slowly. Acetonitrile was removed in vacuo and the mixture was extracted with TBME (3×3 mL). The organic layers were combined, washed with brine, dried over Na2SO4, filtered and concentrated. The residue was taken up in DMSO and purified by preparative HPLC (Method 2). The product-containing fractions were combined and lyophilized. The white solid was dissolved in 4M hydrochloric acid in dioxane / water (1:1, 4 mL) and lyophilized to give (S)-5,5-dimethyl-2-(((R)-1-phenylethyl)amino)hexanoic acid hydrochloride (12.1 mg, 0.040 mmol, 7% yield, 91.90% purity). LCMS (Method 1, 0.930 min; M+H=264.3; calculated 264.2). 1 H-NMR(400MHz,DMSO) δ 9.40(br,1H) 7.54-7.38(m,5H), 4.36(d,J=7.1Hz,1H), 1.86-1.64(m,2H), 1.60(d,J=6.7Hz ,3H), 1.22(td,J=12.9,4.8Hz,1H), 1.06(td,J=12.8,4.6Hz,1H), 0.81(s,9H).
[0212] Example 15
[0213] [ka]
[0214] Synthesis of (S)-5,5-dimethyl-2-(((S)-1-phenylethyl)amino)hexanoic acid hydrochloride Acetophenone (60.1 mg, 0.5 mmol) was added to a suspension of methyl (S)-2-amino-5,5-dimethylhexanoate hydrochloride (121 mg, 0.575 mmol) and potassium carbonate (225 mg, 1.628 mmol) in methanol (super dehydrated) (1 mL). The mixture was heated at 50° C. overnight and cooled to RT. Methanol was removed and the residue was suspended in dry tetrahydrofuran (2 mL). The suspension was added to sodium borohydride (151 mg, 3.99 mmol). A 20% (v / v) solution of water / THF (5 mL) was added slowly over 2 h. The mixture was stirred overnight. The reaction was quenched by the addition of 1 mL of HCl (1 M). The mixture was extracted with TBME (3×3 mL). The organic layers were combined, washed with brine, dried over Na2SO4, filtered and concentrated. The product was purified by acidic prep (Method 2). The product-containing fractions were combined and lyophilized. The white solid was dissolved in 4 M hydrochloric acid in dioxane / water (1:1, 4 mL) and lyophilized to give (S)-5,5-dimethyl-2-(((S)-1-phenylethyl)amino)hexanoic acid hydrochloride (17.4 mg, 0.058 mmol, 11% yield, 89.33% purity). LCMS (Method 1, 0.952 min; M+H=264.3; calculated 264.2). 1 H-NMR(400MHz,DMSO) δ 13.95(br,1H), 9.30(br,2H), 7.57-7.50(m,2H), 7.48-7.40(m,3H), 4.40(q,J=6.9Hz,1H), 3.64-3.54(m,1H), 1.95-1.81( m,1H), 1.77-1.65(m,1H), 1.59(d,J=6.7Hz,3H), 1.27(td,J=13.1,4.8Hz,1H), 1.03(td,J=12.9,4.1Hz,1H), 0.85(s,9H).
[0215] Example 16
[0216] [ka]
[0217] Synthesis of (S)-5,5-dimethyl-2-(((S)-2,2,2-trifluoro-1-phenylethyl)amino)hexanoic acid Sodium borohydride (86.9 mg, 2.297 mmol) was added to a suspension of zinc chloride (157 mg, 1.152 mmol) in 1,2-dimethoxyethane (1.15 mL) at 0 °C. The mixture was warmed to RT and aged for 18 h. 2,2,2-Trifluoro-1-phenylethan-1-one (100 mg, 0.574 mmol) was added to a suspension of methyl (S)-2-amino-5,5-dimethylhexanoate hydrochloride (139 mg, 0.661 mmol) and potassium carbonate (198 mg, 1.433 mmol) in methanol (super anhydrous) (1.7 mL). The mixture was heated at 50 °C overnight and cooled to room temperature. The mixture was diluted with anhydrous acetonitrile (17 mL). The solution was added to a mixture of Zn(BH4)2 at -40 °C. After 4 h at -40 °C, 1 mL acetone was added and the mixture was allowed to warm to room temperature. 5 mL 1M HCl was slowly added. The acetonitrile was removed in vacuo and the mixture was cooled to room temperature. The mixture was extracted with TBME (3×3 mL). The organic layers were combined, washed with brine, dried over Na2SO4, filtered and concentrated. The product was purified by acidic prep (Method 2) to give (S)-5,5-dimethyl-2-(((S)-2,2,2-trifluoro-1-phenylethyl)amino)hexanoic acid (88.4 mg, 0.278 mmol, 48% yield, 99.69% purity). LCMS (Method 1, 1.087 min; M+H=318.3; calculated 318.2). 1 H-NMR(400MHz,DMSO) δ 7.47-7.42(m,2H), 7.39(dq,J=7.4,2.1Hz,3H), 4.38(q,J=8.1Hz,1H), 3.20(d ,J=11.9Hz,1H), 1.66-1.45(m,2H), 1.22(dd,J=9.8,7.0Hz,2H), 0.85(s,9H).
[0218] The following examples were prepared in an analogous manner to Example 16, starting from their corresponding ketones.
[0219] [Table 9-1]
[0220] [Table 9-2]
[0221] [Table 9-3]
[0222] Example 18
[0223] [ka]
[0224] Synthesis of (S)-5,5-dimethyl-2-(((R)-2,2,2-trifluoro-1-phenylethyl)amino)hexanoic acid 2,2,2-Trifluoro-1-phenylethan-1-one (87 mg, 0.5 mmol) was added to a suspension of methyl (S)-2-amino-5,5-dimethylhexanoate hydrochloride (121 mg, 0.575 mmol) and potassium carbonate (225 mg, 1.628 mmol) in methanol (super anhydrous) (1 mL). The mixture was heated at 50° C. overnight and cooled to RT. Methanol was removed and the residue was suspended in tetrahydrofuran (dry) (2 mL). The suspension was added to sodium borohydride (151 mg, 3.99 mmol). A 20% (v / v) solution of water / THF (5 mL) was added slowly over 2 h. The mixture was stirred overnight. The reaction was quenched by the addition of 1 mL of HCl (1 M). The mixture was extracted with TBME (3×3 mL). The organic layers were combined, washed with brine, dried over Na2SO4, filtered and concentrated. The product was purified by acidic prep (Method 2) to give (S)-5,5-dimethyl-2-(((R)-2,2,2-trifluoro-1-phenylethyl)amino)hexanoic acid (55 mg, 0.173 mmol, 30% yield, 99.78% purity). LCMS (Method 1, 1.054 min; M+H=318.4; calculated 318.2). 1 H-NMR(400MHz,DMSO) δ 12.52(br,1H), 7.53-7.44(m,2H), 7.44-7.32(m,3H), 4.39(q,J=7.8Hz,1H), 2.86(t,J=6.4Hz,1H), 1.50(tdd,J =13.3,8.1, 5.0Hz,2H), 1.22(ddd,J=13.2,10.6, 6.2Hz,1H), 1.05(ddd,J=13.1,10.5, 6.7Hz,1H), 0.80(s,9H).
[0225] The following examples were prepared in an analogous manner to Example 18, starting from their corresponding ketones.
[0226] [Table 10-1]
[0227] [Table 10-2]
[0228] [Table 10-3]
[0229] Example 59
[0230] [ka]
[0231] Preparation of (2-(((tert-butyldimethylsilyl)oxy)methyl)phenyl)methanol (59-a)
[0232] [ka]
[0233] Triethylamine (8.07 mL, 57.9 mmol) was added to a solution of 1,2-benzenedimethanol (2.0 g, 14.48 mmol) and TBDMS-Cl (1.96 g, 13.03 mmol) in dichloromethane (5 mL) under nitrogen atmosphere at 0 °C. The mixture was stirred for 2 h. The reaction mixture was washed with 0.5 M aqueous hydrochloric acid (10 mL) and extracted with dichloromethane (10 mL). The combined organic layers were dried over Na2SO4, filtered, and the filtrate was evaporated in vacuo. The crude product was purified by flash chromatography (40 g silica; ethyl acetate in heptane 0% → 30%) to give (2-(((tert-butyldimethylsilyl)oxy)methyl)phenyl)methanol (1.71 g, 6.77 mmol, 46.8% yield) as a colorless oil. 1 H-NMR (400MHz, CDCl3) δ 7.40-7.28(m,4H), 4.81(s,2H), 4.68(d,J=6.5Hz,2H), 3.17(t,J=6.4Hz,1H), 0.93-0.90(m,9H), 0.13(t,J=1.0Hz,6H).
[0234] Preparation of 2-(((tert-butyldimethylsilyl)oxy)methyl)benzaldehyde (59-b)
[0235] [ka]
[0236] To (2-(((tert-butyldimethylsilyl)oxy)methyl)phenyl)methanol (1.70 g, 6.73 mmol) in dichloromethane (10 mL) was added Dess-Martin periodinane (3.14 g, 7.41 mmol) and the mixture was stirred at RT for 48 h. The reaction mixture was washed with saturated aqueous sodium bicarbonate (10 mL) and the organic layer was dried over Na2SO4, filtered and evaporated to give 2-(((tert-butyldimethylsilyl)oxy)methyl)benzaldehyde (1.7 g, 6.79 mmol, quantitative yield) as a white solid. LCMS (Method 6, 1.65 min; M+H=251.2; calculated 251.4).
[0237] (S)-2-((2-(hydroxymethyl)benzyl)amino)-5,5-dimethyl Synthesis of xanthic acid hydrochloride (compound 59)
[0238] [ka]
[0239] To 5,5-dimethyl-L-norleucine (100 mg, 0.628 mmol) in dichloromethane (2 mL) was added 2-(((tert-butyldimethylsilyl)oxy)methyl)benzaldehyde (236 mg, 0.942 mmol) and the mixture was stirred at RT for 2 h before sodium triacetoxyborohydride (266 mg, 1.256 mmol) was added. After addition, the mixture was stirred at RT for 16 h. The reaction mixture was evaporated by heating and the residue was dissolved in 2 M hydrochloric acid (2 mL) and stirred at RT for 16 h. The solid was filtered and the filtrate was purified by acidic prep (Method 2). The product-containing fractions were combined, lyophilized, dissolved in 4 mL 1 M hydrochloric acid, and lyophilized to give (S)-2-((2-(hydroxymethyl)benzyl)amino)-5,5-dimethylhexanoic acid hydrochloride (66.2 mg, 0.21 mmol, 33.5% yield) as a white solid. LCMS (Method 1, 0.87 min; M+H=280.2; calculated 280.3). 1 H-NMR(400MHz,DMSO) δ 9.28(s,1H), 7.54-7.52(m,1H), 7.48-7.33(m,3H), 4.66(s,2H), 4.26(s,2H), 4.02-4.00(m,1H ), 1.98-1.77(m,2H), 1.34(td,J=12.9,4.9Hz,1H), 1.13(td,J=12.8,4.6Hz,1H), 0.86(s,9H).
[0240] Example 108
[0241] [ka]
[0242] Synthesis of (R)-2-hydroxy-5,5-dimethylhexanoic acid (int 108-a) 1M aqueous sulfuric acid (226 mL, 226 mmol, 3.0 equiv.) was added to (R)-2-amino-5,5-dimethylhexanoic acid (12 g, 75 mmol, 1.0 equiv.) in water (220 ml). The mixture was cooled to -5°C and a solution of sodium nitrite (31.2 g, 452 mmol, 6.0 equiv.) in water (220 ml) was added dropwise, keeping the temperature below 0°C. Addition Afterwards the mixture was warmed to room temperature and stirred for 16 h.
[0243] The mixture was extracted with Et2O (4 x 200 mL) and the combined organics were washed with brine (300 mL), dried over Na2SO4, filtered and concentrated in vacuo to give (R)-2-hydroxy-5,5-dimethylhexanoic acid (8.98 g, 56.1 mmol, 74.4% yield) as a yellow solid. 1H-NMR (400 MHz, CDCl3) δ 4.28 (dd, J = 7.2, 4.2 Hz, 1H), 1.92-1.80 (m, 1H), 1.75-1.62 (m, 1H), 1.41-1.27 (m, 2H), 0.90 (s, 9H).
[0244] Synthesis of methyl (R)-2-hydroxy-5,5-dimethylhexanoate (int 108-b) SOCl2 (12 ml, 164 mmol, 2.93 equiv) was added to (R)-2-hydroxy-5,5-dimethylhexanoic acid (8.98 g, 56.1 mmol, 1 equiv) in methanol (120 ml) at 0° C. After the addition, the mixture was warmed to room temperature and stirred for 16 h. The mixture was alkalized to pH 9 by addition of saturated aqueous NaHCO3 and extracted with Et2O (2×400 mL). The combined organics were dried over Na2SO4, filtered, and concentrated in vacuo to give methyl (R)-2-hydroxy-5,5-dimethylhexanoate (10.01 g, 55.0 mmol, 98% yield) as a yellow oil. Contains 4.2% (w / w) MeOH. 1H-NMR (400MHz, CDCl3) δ 4.18(dd,J=7.2,4.2Hz,1H), 3.80(s,3H), 1.84-1.72(m,1H), 1.67-1.52(m,1H), 1.37-1.21(m,2H), 0.89(s,9H).
[0245] Synthesis of methyl (R)-5,5-dimethyl-2-(((trifluoromethyl)sulfonyl)oxy)hexanoate (int 108-c) Trifluoromethanesulfonic anhydride (4.65 mL, 27.5 mmol, 1.10 equiv) was added dropwise to a solution of methyl (R)-2-hydroxy-5,5-dimethylhexanoate (4.36 g, 25.02 mmol, 1.0 equiv) and triethylamine (4.19 ml, 30.0 mmol, 1.2 equiv) in dichloromethane (100 mL) at 0° C. After the addition, the mixture was warmed to room temperature and stirred for 16 h. Water (100 mL) was added and the mixture was extracted with EtOAc (2×250 mL). The combined organics were washed with brine (250 mL), dried over Na2SO4, filtered, and concentrated in vacuo to give methyl (R)-5,5-dimethyl-2-(((trifluoromethyl)sulfonyl)oxy)hexanoate (7.14 g, 23.31 mmol, 49% corrected yield) as a dark brown oil. 1H-NMR (400MHz, CDCl3) δ 5.12 (dd, J=6.9, 5.0Hz, 1H), 3.85 (s, 3H), 2.05-1.90 (m, 2H), 1.36-1.24 (m, 2H), 0.90 (s, 9H).
[0246] Synthesis of (S)-2-(((S)-1-(3,4-dimethoxyphenyl)ethyl)amino)-5,5-dimethylhexanoic acid (compound 108)-methanesulfonic acid Methyl (R)-5,5-dimethyl-2-(((trifluoromethyl)sulfonyl)oxy)hexanoate (70 mg, 0.229 mmol) in dichloromethane was added dropwise to a solution of (S)-1-(3,4-dimethoxyphenyl)ethan-1-amine (41.4 mg, 0.229 mmol) in dichloromethane containing triethylamine (104 μl, 0.743 mmol). The mixture was stirred overnight. The DCM was removed by a gentle stream of air and the residue was taken up in acetonitrile (1.000 ml) and water (1.000 ml). Lithium hydroxide (21.89 mg, 0.914 mmol) was added and the mixture was stirred overnight. The mixture was subjected to acidic preparative HPLC (Method 2) to give (S)-2-(((S)-1-(3,4-dimethoxyphenyl)ethyl)amino)-5,5-dimethylhexanoic acid (33.5 mg, 0.104 mmol, 45.3% yield). The product was dissolved in acetonitrile (1.1 ml). and methanesulfonic acid (0.1 M in MeCN) (1040 μl, 0.104 mmol) was added. The mixture was lyophilized to give (S)-2-(((S)-1-(3,4-dimethoxyphenyl)ethyl)amino)-5,5-dimethylhexanoic acid compound with methanesulfonic acid (43.6 mg, 45.5% yield, 99.67% purity). LCMS (Method 1, 0.884 min; MH- MsOH=322.2; calculated 322.2). 1 H-NMR(400MHz,DMSO) δ 14.32-13.95(br,1H), 9.47-8.85(br,2H), 7.13(d,J=1.9Hz,1H), 7.00(d,J= 8.3Hz,1H), 6.95(dd,J=8.3,1.9Hz,1H), 4.37-4.29(m,1H), 3.77(s,3H), 3.77 (s,3H), 3.38-3.29(m,1H), 2.31(s,3H), 1.79-1.62(m,2H), 1.60(d,J=6.8Hz, 3H), 1.21(td,J=12.9,5.3Hz,1H), 1.07(td,J=12.6,4.6Hz,1H), 0.81(s,9H).
[0247] The following examples were prepared in an analogous manner to Example 108, starting from the corresponding esters.
[0248] [Table 11-1]
[0249] [Table 11-2]
[0250] [Table 11-3]
[0251] Example 131
[0252] [ka]
[0253] Synthesis of 4-bromo-1,7-dimethyl-1H-indole intermediate 131-a
[0254] [ka]
[0255] A solution of 4-bromo-7-methyl-1H-indole (606 mg, 1 Eq, 2.88 mmol) in DMF (3.0 mL) was cooled to 0° C. before adding NaH (60% wt in mineral oil) (0.12 g, 60% Wt, 1.0 Eq, 2.88 mmol). The mixture was warmed to rt and stirred for 15 min before adding MeI (409 mg, 180 μL, 1.0 Eq, 2.88 mmol). The reaction mixture was stirred at rt for 2 h before partitioning between EtOAc (40 mL) and saturated aqueous NH4Cl (30 mL). The layers were separated and the organic phase was washed with 1:1 brine:water (2×30 mL) and brine (30 mL). The organic phase was dried over MgSO4, filtered, and concentrated in vacuo to give 4-bromo-1,7-dimethyl-1H-indole (638 mg, 2.8 mmol, 97%, 98% purity) as a brown oil that solidified on standing. LCMS (method #acid3minb, 2.14min; M+H=n / a. 1H NMR (500MHz, DMSO) δ 7.34(d,J=3.1Hz,1H), 7.08(d,J=7.6Hz,1H), 6.78(dd,J=7.6,1.0Hz,1H), 6.32(d,J=3.1Hz,1H), 4.06(s,3H), 2.70(d,J=0.9Hz,3H).
[0256] Preparation of 1,7-dimethyl-1H-indole-4-carbaldehyde 131-b
[0257] [ka]
[0258] A solution of 4-bromo-1,7-dimethyl-1H-indole (400 mg, 1 Eq, 1.78 mmol), triethylamine (545 mg, 750 μL, 3.01 Eq, 5.38 mmol), triethylsilane (619 mg, 850 μL, 2.98 Eq, 5.32 mmol) and PdCl2(dppf)-DCM (60 mg, 0.041 Eq, 73 μmol) in DMF (6.0 mL) was degassed under a stream of N2 for 5 min before sealing. It was purged with N2 (×3) before being charged with CO (1.5 bar) and then the reaction mixture was heated to 90 °C for 6 h. After cooling to rt, the reaction mixture was taken up in EtOAc (40 mL) and then washed with saturated aqueous NH4Cl (20 mL), water:brine (2×1:1, 20 mL) and brine (20 mL). The organic phase was dried over MgSO4, filtered, and concentrated onto silica (~1 g). The crude product was purified by chromatography on silica gel (12 g cartridge, 0-70% EtOAc / iHex) to give 1,7-dimethyl-1H-indole-4-carbaldehyde (195 mg, 1.1 mmol, 62%, 98% purity) as a yellow solid. LCMS (method #acid3minb, 1.68min; M+H=174.2. 1H NMR(500MHz,DMSO) δ 10.10(d,J=0.7Hz,1H), 7 .53(d,J=7.4Hz,1H), 7.47(d,J=3.0Hz,1H), 7.09-7.04(m,2H), 4.11(s,3H), 2.83(s,3H).
[0259] Preparation of (S)-2-(((1,7-dimethyl-1H-indol-4-yl)methyl)amino)-5,5-dimethylhexanoic acid, mesylate 131
[0260] [ka]
[0261] A suspension of (S)-2-amino-5,5-dimethylhexanoic acid (92 mg, 1.0 Eq, 0.58 mmol), 1,7-dimethyl-1H-indole-4-carbaldehyde (100 mg, 1 Eq, 577 μmol) and triethylamine (59 mg, 81 μL, 1.0 Eq, 0.58 mmol) in MeOH (5.0 mL) was stirred at 40° C. for 2 h to form a solution. After cooling to 0° C., sodium borohydride (22 mg, 1.0 Eq, 0.58 mmol) was added and the mixture was allowed to warm to rt over 1 h. The mixture was concentrated to dryness and then suspended in water (5 mL). Treatment with acetic acid (0.1 mL) was followed by filtration. The material was then suspended in water (10 mL) and acetone (2 mL) before heating at 60° C. for 30 min. After cooling to rt, the mixture was filtered to obtain the free base. The free base was suspended in MeCN (2 mL), treated with 0.1 M MsOH in MeCN (1 equiv.) and sonicated briefly to give a solution which was then concentrated to dryness to give (S)-2-(((1,7-dimethyl-1H-indol-4-yl)methyl)amino)-5,5-dimethylhexanoic acid, mesylate (52 mg, 0.12 mmol, 21%, 96% purity) as a colorless solid. LCMS (method #acid3minb, 1.49min; M+Na=339.2. 1H NMR(500MHz,DMSO) δ 9.12(v. br. s,2H), 7.32(d,J=3.2Hz,1H), 7.03(d,J=7.3Hz,1H), 6.89(d,J=7.3Hz,1H), 6.57(d,J=3.2Hz,1H), 4.36 -4.26(m,2H), 4.07(s,3H), 3.82-3.76(m,1H), 2.74(s,3H), 2.30(s,3H), 1.88-1.70(m,2H), 1.32(app. td,J=13.1,4.7Hz,1H), 1.10(app. td,J=12.8,4.4Hz,1H), 0.84(s,9H).
[0262] Example 136
[0263] [ka]
[0264] Synthesis of (S)-5,5-Dimethyl-2-((pyrimidin-4-ylmethyl)amino)hexanoic acid, HCl A suspension of (S)-2-amino-5,5-dimethylhexanoic acid (60 mg, 1 Eq, 0.38 mmol), pyrimidine-4-carbaldehyde (41 mg, 1 Eq, 0.38 mmol) and Et3N (38 mg, 53 μL, 1 Eq, 0.38 mmol) in MeOH (2 mL) was heated intermittently with a heat gun to give a solution which was stirred at rt for 2 h before being cooled in an ice bath and treated with NaBH4 (16 mg, 1.1 Eq, 0.41 mmol) in one portion. The mixture was then warmed to rt and stirred for 1.5 h. The reaction mixture was concentrated to dryness. The residue was suspended in water (5 mL) followed by the addition of acetic acid (45 mg, 43 μL, 2 Eq, 0.75 mmol). This was further diluted with water (5 mL) before the solvent was removed under reduced pressure. The crude residue was dry loaded onto Celite and purified by chromatography on RP Flash C18 (12 g cartridge, 0-50% (0.1% formic acid in MeCN) / (0.1% formic acid in water)) to give the crude product as a brown solid (309 mg). The crude product was suspended in water (15 ml) and MeCN (10 mL) before adding concentrated aqueous HCl (1.04 g, 700 μL, 12 molar, 22 Eq, 8.40 mmol) and stirring the suspension for 5 min to give a solution. This was then concentrated to dryness and azeotroped with MeCN (2×10 mL) to give (S)-5,5-dimethyl-2-((pyrimidin-4-ylmethyl)amino)hexanoic acid, HCl (100 mg, 0.33 mmol, 88%, 95% purity) as an off-white solid. UPLC (Method 4, 0.48min; M+H=252.3. 1H NMR (500MHz, DMSO) δ 9.75(brs,2H), 9.27(d,J=1.4Hz,1H), 8.88(d,J=5.2Hz,1H), 7.71(dd,J=5.1,1.4Hz,1H), 4.42(m,2H), 4.07(m,1H), 2.00-1.83(m,2H), 1.39(app. td,J=13.1,4.9Hz,1H), 1.17(app. td,J=12.8,4.5Hz,1H), 0.87(s,9H).
[0265] Example 137
[0266] [ka]
[0267] (S)-2-((3,4-dimethylbenzyl)amino)-5,5-dimethylhexanoic acid , Synthesis of mesylic acid A suspension of (S)-2-amino-5,5-dimethylhexanoic acid (50 mg, 1 Eq, 0.31 mmol), 3,4-dimethylbenzaldehyde (42 mg, 1 Eq, 0.31 mmol) and Et3N (32 mg, 44 μL, 1 Eq, 0.31 mmol) in MeOH (3 mL) was heated at 40 °C for 2 h, then cooled to 0 °C and treated with NaBH4 (12 mg, 1 Eq, 0.31 mmol). The mixture was then warmed to room temperature and concentrated to dryness. The mixture was then suspended in water (5 mL) and treated with acetic acid (42 mg, 40 μL, 2.2 Eq, 0.70 mmol) before filtering. The material was suspended in water (10 mL) and acetone (2 mL) before heating at 60 °C for 30 min, then cooled and filtered. The free base was suspended in MeCN (10 mL) and treated with 0.1 M MsOH in MeCN (1 eq) to give a solution which was concentrated in vacuo. After addition of MeCN (2×5 mL) the solvent was removed in vacuo to give (S)-2-((3,4-dimethylbenzyl)amino)-5,5-dimethylhexanoic acid, mesylate (69 mg, 0.18 mmol, 58%, 98% purity) as a colorless solid. LCMS (Method 5, 1.48min; M+H=278.2. 1H NMR (500MHz, DMSO) δ 14.02(s,1H), 9.16(s,2H), 7.25(s,1H), 7.22-7.14(m,2H), 4.08(s,2H), 3.90-3 .84(m,1H), 2.30(s,3H), 2.24(s,3H), 2.24(s,3H), 1.89-1.71(m,2H), 1.32(app. td,J=13.2,4.7Hz,1H), 1.11(app. td,J=13.0,4.3Hz,1H), 0.85(s,9H).
[0268] Example 138
[0269] [ka]
[0270] Synthesis of (S)-5,5-dimethyl-2-(((1-methyl-1H-benzo[d]imidazol-4-yl)methyl)amino)hexanoic acid, mesylic acid A suspension of (S)-2-amino-5,5-dimethylhexanoic acid (100 mg, 1 Eq, 628 μmol), 1-methyl-1H-benzo[d]imidazole-4-carbaldehyde (101 mg, 1 Eq, 628 μmol) and Et3N (64 mg, 88 μL, 1.0 Eq, 0.63 mmol) in MeOH (3 mL) was heated at 40 °C for 2 h, then cooled in an ice bath and treated with NaBH4 (24 mg, 1.0 Eq, 0.63 mmol) in one portion. The mixture was then warmed to rt and concentrated to dryness. This was then suspended in water (5 mL) and acetic acid (84 mg, 80 μL, 2.2 Eq, 1.4 mmol) was added. This was diluted with MeCN (20 mL) and then concentrated onto Celite (ca. 2 g). The crude product was purified by RP Flash chromatography. Purification by chromatography on C18 (12 g cartridge, 5-30% (0.1% formic acid in MeCN) / (0.1% formic acid in water)) gave the crude product, which was suspended in MeCN (20 mL) and treated with 0.1 M MsOH in MeCN (1 eq) to give a solution which was then concentrated to give (S)-5,5-dimethyl-2-(((1-methyl-1H-benzo[d]imidazol-4-yl)methyl)amino)hexanoic acid, mesylate (75 mg, 0.18 mmol, 28%, 95% purity) as a colorless solid. LCMS (Method 5, 0.97min; M+H=304.2. 1H NMR (500MH z,DMSO) δ 8.54(s,1H), 7.73(d,J=7.5Hz,1H), 7.45-7.38(m,2H), 4.63-4.54(m,2H), 3.96 (dd,J=6.9,4.7Hz,1H), 3.92(s,3H), 2.31(s,3H), 1.95-1.76(m,2H), 1.32(app. td,J=13.1,4.7Hz,1H), 1.10(app. td,J=12.9,4.4Hz,1H), 0.85(s,9H).
[0271] The following examples were prepared in an analogous manner to Example 138 starting from the corresponding aldehyde.
[0272] [Table 12]
[0273] Examples 141 and 143
[0274] [ka]
[0275] Synthesis of (2-(((S)-1-(2-methoxypyridin-4-yl)ethyl)amino)-5,5-dimethylhexanoic acid, HCl A solution of 1-(pyrimidin-5-yl)ethan-1-one (28 mg, 1 Eq, 0.23 mmol) and tert-butyl (S)-2-amino-5,5-dimethylhexanoate (50 mg, 1 Eq, 0.23 mmol) in THF (2 mL) was treated with EtN (23 mg, 32 μL, 1 Eq, 0.23 mmol) and AcOH (14 mg, 13 μL, 1 Eq, 0.23 mmol) and then heated at 50 °C for 2 h. The reaction mixture was concentrated to dryness and the residue was taken up in MeOH (1 mL) and then treated with NaBH (10 mg, 1.1 Eq, 0.26 mmol). The mixture was stirred at room temperature for 1 h before the solvent was removed in vacuo. The crude product was purified by chromatography on RP Flash C18 (12 g cartridge, 25-40% (0.1% formic acid in MeCN) / (0.1% formic acid in water)) to give tert-butyl (2S)-5,5-dimethyl-2-((1-(pyrimidin-5-yl)ethyl)amino)hexanoate (21 mg, 65 μmol, 14%) as a colorless solid and tert-butyl (2S)-5,5-dimethyl-2-((1-(pyrimidin-5-yl)ethyl)amino)hexanoate (3 mg, 9 μmol, 2%) was isolated as a colorless gum.
[0276] tert-Butyl (2S)-5,5-dimethyl-2-((1-(pyrimidin-5-yl)ethyl)amino)hexanoate (21 mg, 7 Eq, 65 μmol) was treated with 4 M HCl in dioxane (4 mL) and stirred at 40° C. for 16 h before being concentrated to dryness and triturated with MeCN (2 mL) to give (2S)-5,5-dimethyl-2-((1-(pyrimidin-5-yl)ethyl)amino)hexanoic acid, HCl (15 mg, 49 μmol, 75%, 98% purity) as a single diastereomer as a colorless solid. LCMS (Method 5, 0.56min; M+H=266.2. 1H NMR (500MHz, DMSO) δ 14.03(s,1H), 10.14-9.71(m,2H), 9.23(s,1H), 9.02(s,2H), 4.56-4.51(m,1H), 3.66-3.57(m,1H), 1.92-1.83(m,1H), 1.80-1.72(m ,1H), 1.68(d,J=6.9Hz,3H), 1.24(app. td,J=13.2,4.7Hz,2H), 1.15-1.05(m,1H), 0.83(s,9H).
[0277] The other diastereomer was prepared via a similar method and isolated as a single diastereomer (3 mg, 9 μmol, 100%, 95% purity) as a colorless solid. LCMS (Method 5, 0.49min; M+H=266.2. 1H NMR (500MHz, DMSO) δ 9.17(s,1H), 8.93(s,2H), 4.33-4.22(m,1H), 3.75-3.65(m,1H), 1.87-1.68(m,2H), 1.59(d,J=6.9Hz,3H), 1.32-1.04(m,2H), 0.85(s,9H).
[0278] Example 142
[0279] [ka]
[0280] Synthesis of (S)-2-((3-cyanobenzyl)amino)-5,5-dimethylhexanoic acid, HCl A vial was charged with (S)-2-amino-5,5-dimethylhexanoic acid (100 mg, 1 Eq, 628 μmol), 3-formylbenzonitrile (82 mg, 1.0 Eq, 0.63 mmol), acetic acid (38 mg, 36 μL, 1.0 Eq, 0.63 mmol) and NMP (3 mL). The suspension was stirred at rt for 2 h. Sodium triacetoxyborohydride (266 mg, 2 Eq, 1.26 mmol) was added to the mixture in one portion and the resulting mixture was stirred at rt for 20 h. The reaction was purified by SCX (ca. 1 g) and the product was eluted first with MeCN (30 mL) followed by NH3 (7M in MeOH) / MeCN (1:2, 100 mL). The ammonia fraction was concentrated under reduced pressure. The crude product was purified by chromatography on RP Flash C18 (12 g cartridge, 25-40% (0.1% formic acid in MeCN) / (0.1% formic acid in water)) to give a white solid, which was dissolved in MeOH (1 mL) and then treated with 4 M HCl in dioxane (1 mL). The mixture was stirred at rt for 30 min before being concentrated to dryness to give (S)-2-((3-cyanobenzyl)amino)-5,5-dimethylhexanoic acid, HCl (4 mg, 0.01 mmol, 70%, 98% purity) as a colorless solid. LCMS (Method 5, 1.23min; M+H=275.0. 1H NMR (500MHz, DMSO-d6) δ 7.97(s,1H), 7.91(app. d,J=7.8Hz,1H), 7.82(d,J=7.8Hz,1H), 7.67(app. t,J=7.8Hz,1H), 4.22(s,2H), 4.01-3.91(m,1H), 1.92-1.74(m,2H), 1.36-1.27(m,1H), 1.16-1.07(m,1H), 0.87(s,9H).
[0281] Examples 20 to 59 and 144 The following example compounds according to the invention have been prepared: Example 20: (2S)-5,5-Dimethyl-2-({2-oxa-9-azatricyclo[9.4.0.0 3 , 8]Pentadeca-1(11),3(8),4,6,9,12,14-heptaen-10-yl}amino)hexanoic acid Example 21: (2S)-2-{[(1S)-2,2-difluoro-1-(3-methoxyphenyl)ethyl]amino}-5,5-dimethylhexanoic acid Example 22: (2S)-2-{[(1R)-2,2-difluoro-1-(3-methoxyphenyl)ethyl]amino}-5,5-dimethylhexanoic acid Example 23: (2S)-5,5-dimethyl-2-{[(1R)-2,2,2-trifluoro-1-(3-methoxyphenyl)ethyl]amino}hexanoic acid Example 24: (2S)-5,5-Dimethyl-2-{[(1S)-2,2,2-trifluoro-1-(3-methoxyphenyl)ethyl]amino}hexanoic acid Example 25: (2S)-2-({[3-(hydroxymethyl)phenyl]methyl}amino)-5,5-dimethylhexanoic acid Example 26: (2S)-2-{[(2,3-dimethoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 27: (2S)-2-{[(3,5-dimethoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 28: (2S)-2-{[(2,5-dimethoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 29: (2S)-2-{[(3-fluoro-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 30: (2S)-2-{[(3-chloro-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 31: (2S)-2-{[(3-bromo-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 32: (2S)-2-{[(3,5-dichlorophenyl)methyl]amino}-5,5-dimethylhexanoic acid
[0282] Example 33: (2S)-2-{[(3-methoxy-4-methylphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 34: (2S)-2-{[(2-fluoro-3-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 35: (2S)-5,5-Dimethyl-2-{[(quinolin-3-yl)methyl]amino}hexanoic acid Example 36: (2S)-5,5-Dimethyl-2-{[(quinolin-2-yl)methyl]amino}hexanoic acid Example 37: (2S)-2-{[(3-fluoro-4-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 38: (2S)-2-{[(3,4-dimethoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid Example 39: (2S)-5,5-Dimethyl-2-{[(5,6,7,8-tetrahydronaphthalen-1-yl)methyl]amino}hexanoic acid Example 40: (2S)-2-{[(3,4-dihydro-2H-1-benzopyran-6-yl)methyl]amino}-5,5-dimethylhexanoic acid Example 41: (2S)-2-{[(2,3-dihydro-1,4-benzodioxin-6-yl)methyl]amino}-5,5-dimethylhexanoic acid Example 42: (2S)-5,5-Dimethyl-2-{[(quinoxalin-6-yl)methyl]amino}hexanoic acid Example 43: (2S)-5,5-Dimethyl-2-[({1H-pyrrolo[2,3-b]pyridin-5-yl}methyl)amino]hexanoic acid Example 44: (2S)-5,5-Dimethyl-2-[({1H-pyrrolo[2,3-b]pyridin-4-yl}methyl)amino]hexanoic acid Example 45: (2S)-2-{[(2H-1,3-benzodioxol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid Example 46: (2S)-5,5-Dimethyl-2-{[(quinolin-6-yl)methyl]amino}hexanoic acid Example 47: (2S)-5,5-Dimethyl-2-{[(quinolin-8-yl)methyl]amino}hexanoic acid Example 48: (2S)-5,5-Dimethyl-2-{[(quinolin-5-yl)methyl]amino}hexanoic acid
[0283] Example 49: (2S)-2-{[(2-methoxynaphthalen-1-yl)methyl]amino}-5,5-dimethylhexanoic acid Example 50: (2S)-2-{[(1H-indol-2-yl)methyl]amino}-5,5-dimethylhexanoic acid Example 51: (2S)-2-{[(1,3-benzothiazol-5-yl)methyl]amino}-5,5-dimethylhexanoic acid Example 52: (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-pyrazol-5-yl)methyl]amino}hexanoic acid Example 53: (2S)-2-{[(1,3-benzothiazol-6-yl)methyl]amino}-5,5-dimethylhexanoic acid Example 54: (2S)-5,5-Dimethyl-2-{[(1-methyl-1H-indazol-6-yl)methyl]amino}hexanoic acid Example 55: (2S)-5,5-Dimethyl-2-{[(pyrimidin-5-yl)methyl]amino}hexanoic acid Example 56: (2S)-5,5-Dimethyl-2-({[2-(pyridin-4-yl)phenyl]methyl}amino)hexanoic acid Example 57: (2S)-2-({[3-(1H-imidazol-1-yl)phenyl]methyl}amino)-5,5-dimethylhexanoic acid Example 58: (2S)-5,5-Dimethyl-2-{[(pyridin-4-yl)methyl]amino}hexanoic acid Example 59: (2S)-2-({[2-(hydroxymethyl)phenyl]methyl}amino)-5,5-dimethylhexanoic acid Example 144: (2S)-2-{[(5-methoxypyridin-3-yl)methyl]amino}-5,5-dimethylhexanoic acid
[0284] [ka]
[0285] Any remaining example compounds were prepared in a similar manner to the other examples.
[0286] Biological Data Neurotensin scintillation proximity assay Exemplary compounds of the present invention were tested in the Neurotensin (NTS) Scintillation Proximity Assay (SPA). IC 50 The data are shown in Table 1 below. NTS, a 13 amino acid neuropeptide, is a sortilin ligand. IC 50 IC is a measure of the amount of compound required to inhibit 50% of NTS binding to sortilin. 50 One of skill in the art will recognize that the lower the value, the less compound is needed to achieve the desired effect, thereby reducing the chance of unwanted off-target effects.
[0287] In the SPA format, [ 3 Compound affinity was determined by measuring the displacement of [H]-neurotensin binding. A total volume of 40 μl was achieved in 50 mM HEPES pH 7.4 assay buffer containing 100 mM NaCl, 2.0 mM CaCl2, 0.1% BSA and 0.1% Tween-20. Compounds were pre-incubated with 150 nM 6his-sortilin for 30 min at room temperature before addition of 5 nM [3H]-neurotensin and Ni-chelating imaging beads (Perkin Elmer) and after 6 h the plates were read on a ViewLux with an exposure time of 360 s. Dose-response evaluation of compounds was performed at eight concentrations of drug (covering three decimal places). IC was determined by nonlinear regression using a sigmoidal concentration response (variable slope) using CDD Vault software. 50 Values were calculated. All values reported are the average of at least two determinations.
[0288] The data in Table 6 below demonstrate that the compounds disclosed herein are sortilin inhibitors.
[0289] [Table 13-1]
[0290] [Table 13-2]
[0291] [Table 13-3]
[0292] Blood-brain barrier permeability Example 60 –Plasma protein binding and brain homogenate binding of study compounds in mice by rapid equilibrium dialysis To determine whether the compounds of the present invention have the ability to cross the blood-brain barrier, K puu was calculated:
[0293] [ka]
[0294] Mice were dosed with the compounds of Example 5, Example 6 and Comparative Example 1, and then plasma and brain were removed at specific time points and analyzed for compound concentration. The proportion of compound bound to plasma proteins or brain homogenates, respectively, was measured to assess the free proportion.
[0295] The free drug hypothesis states that only unbound compounds can penetrate biological membranes, interact, and induce pharmacological effects. Therefore, it is desirable for a compound to have a high free brain concentration. However, only the free, unbound drug moiety is subject to clearance mechanisms.
[0296] Indeed, in vitro rapid equilibrium dialysis was used to assess the unbound fraction in plasma and brain tissue. Separate pharmacokinetic studies were performed in vivo, where a dose of the compound of interest was given at T=0 and at subsequent time points (e.g., 0.5, 1, and 4 hours), and plasma and separately brain samples were analyzed for the total concentration of the compound of interest. These total concentrations could then be adjusted with the unbound fraction to give the unbound concentrations in plasma and brain. The unbound partition coefficient (K puu ) was then determined as the ratio between the free compound concentrations in the compartments of interest, here brain / CNS and plasma.
[0297] rapid equilibrium dialysis Test compounds were incubated in triplicate at 5 μM for 4 hours in CD1 mouse plasma and brain homogenate at 37°C in RED devices with inserts (8K MWCO, Thermo scientific). 350 μL of 150 mM phosphate buffered saline (PBS, pH 7.4) was used as the receiver solution. Samples were collected from both sides after 4 hours equilibration time, and their matrices were made similar by diluting donor side samples with blank PBS and receiver side samples with blank plasma / phosphate buffered saline. After incubation, an aliquot of donor side matrix was diluted with an equal volume of blank receiver side matrix, and an aliquot of receiver side matrix was diluted with an equal volume of blank donor side matrix. All samples were protein precipitated by the addition of 2 volumes of acetonitrile containing 100 nM repaglinide as an internal standard. After 10 minutes of centrifugation at 13200 rpm, sample supernatants were analyzed by LC-MS / MS to determine the unbound fraction (F) of test compounds. ub The unbound ratio was calculated from the peak area ratio obtained for each matrix: F ub =C PBS / C plasma ; (In the formula, C PBS and C plasma are the analyte concentrations in PBS (receiver) and plasma (donor), respectively).
[0298] Recovery samples were prepared in each condition without dialysis and were analyzed according to the following formula: Recovery% = 100 × (V PBS ×C PBS +V plasma ×C plasma ) / V plasma ×C recovery (In the formula, V PBS is the volume in the receiver side (PBS) of the dialysis device, and V plasma is the volume at the donor site (plasma). C recovery is the analyte concentration measured from the recovered sample) was used for evaluation of recovery from the dialysis experiments.
[0299] Propranolol (1 μM) and fluoxetine (5 μM) were included in the experiment as control compounds.
[0300] Taking into account the dilution factor used in the preparation of the brain homogenate, the values measured in the brain homogenate (F ub,meas ) to the unbound fraction in the brain (F ub,brain ) was calculated:
[0301]
number
[0302] (where D = dilution factor (here 5)).
[0303] Analysis method Instrument: Waters Acquity UPLC + Waters Xevo TQ-XS Triple Quadrupole MS; Column: Waters Acquity HSS T3 (2.1 x 50 mm, 1.8 μm) column with pre-column filter; Gradient elution; A = 0.1% formic acid, B = acetonitrile
[0304] [Table 14]
[0305] Temperature: 40°C; injection volume: 1.5 μl; ion source: ESI+; capillary voltage: 2400V; source temperature: 150°C; desolvation temperature: 650°C; cone gas flow: 240L / hr; desolvation gas flow: 1200L / hr; nebulizer gas flow: 7Bar; collision gas flow: 0.15mL / min; software: MassLynx 4.2
[0306] [Table 15]
[0307] Equilibrium dialysis results
[0308] The table below shows the unbound percentages of compounds Example 5, Example 6 and Comparative Example 1 in plasma and brain homogenates for mice.
[0309] [Table 16]
[0310] Example 21 – Blood-brain barrier permeability of study compounds in mice after PO administration Compounds are administered to animals in a suitable vehicle at T=0 time. One hour after administration, plasma and separately brain are removed, prepared and analyzed for total compound concentration.
[0311] Sample preparation – brain Mouse brain samples were prepared for analysis by homogenization in an Omni bead grinder using 4 volumes of 150 mM phosphate buffered saline (PBS) (e.g., 400uL PBS + 100mg brain). After homogenization, 30μL homogenate samples were combined with 60μL of internal standard solution (100ng / ml repaglinide and phenacetin in acetonitrile (ACN) containing 1% formic acid) and mixed. Samples were centrifuged (4000rpm, Thermo Scientific SL16) for 20 minutes and 50μl of supernatant was transferred to the analysis plate along with 100μl of 50% acetonitrile. Standard samples were prepared by spiking blank brain homogenate using 1 volume of spiking solution and 9 volumes of blank homogenate to obtain concentrations ranging from 0.1 to 10000ng / ml in brain homogenate. Quality control (QC) samples were prepared for concentrations of 3, 30, 300 and 3000 ng / ml by using 1 volume of spiking solution and 9 volumes of blank brain homogenate. Standards and QC were then prepared for analysis in the same way as samples. Blank brain matrix was collected in-house from CD-1 mice.
[0312] Sample preparation – plasma Samples were prepared by mixing 30 μL of plasma sample with 60 μL of internal standard solution (100 ng / ml repaglinide and phenacetin in ACN with 1% formic acid) and mixed. Samples were centrifuged for 20 minutes (4000 rpm, Thermo Scientific SL16) and 50 μl of the supernatant was transferred to the analysis plate along with 100 μl of 50% acetonitrile. 10 μl of the diluted sample was transferred to the analysis plate and further diluted with 190 μl of 50% acetonitrile. Standard samples were prepared by spiking blank plasma to obtain concentrations of 0.1-10000 ng / ml in plasma by using 1 volume of spiking solution and 9 volumes of blank plasma. Quality control (QC) samples were prepared for concentrations of 3, 30, 300 and 3000 ng / ml by using 1 volume of spiking solution and 9 volumes of plasma. Standards and QC were then prepared for analysis in the same way as the samples. Blank plasma was collected in-house from CD-1 mice.
[0313] For samples of the compound of Example 5 collected 15 minutes to 4 hours after dosing, an additional 10-fold dilution was performed (5 μl analytical sample + 45 μl precipitated blank plasma) due to the unexpectedly high concentration.
[0314] Analysis method Instrument: Waters Acquity UPLC + Waters TQ-S Triple Quadrupole MS; Column: Waters Acquity HSS T3 (2.1 x 50 mm, 1.8 μm) column with pre-column filter; Gradient elution; A = 0.1% formic acid, B = acetonitrile
[0315] [Table 17]
[0316] Temperature: 40°C; Injection volume: 1.5 μl for brain, 4 μl for plasma; Ion source: ESI+; Capillary voltage: 3000V; Source temperature: 150°C; Desolvation temperature: 650°C; Cone gas flow: 220 L / hr; Desolvation gas flow: 1200 L / hr; Nebulizer gas flow: 7 mL / min; Collision gas flow: 0.15 mL / min; Software: MassLynx 4.2
[0317] [Table 18]
[0318] result Examples 5 and 6 have a K value higher than 0.1. puu The results show that Comparative Example 1 has a K value lower than 0.1 and penetrates the blood-brain barrier. puu and did not exhibit blood-brain barrier penetration.
[0319] [Table 19]
[0320] Nonbonded partition coefficient (K puu ) was determined as the ratio between the free compound concentrations in plasma and brain:
[0321]
number
[0322] (In the formula, C u,brain = unbound concentration in brain (C × F ub,brain ); C = concentration at steady state; and C ub,plasma = unbound concentration in plasma (C × F ub ).
[0323] For the treatment of CNS diseases, puu It is desirable for the β-acetylglucosamine (β) concentration to have a value greater than 0.1, indicating that a proportion of the unbound compound in the plasma penetrates the blood-brain barrier.
[0324] Example 146 Creoptix (GCI) method - Use of SEQ ID NO:4 (mouse sortilin) The GCI assay is based on a well-understood surface plasmon resonance methodology that is specifically enhanced to detect the binding of small entities to proteins. Proteins bound to a surface are bathed in a solution containing potential ligands that give rise to binding kinetics, and the K on and K. off In addition to the rate, K d This methodology does not require the use of an additional tracer and can be used with or without the element of competition with a known ligand.
[0325] reagent: [Table 20]
[0326] All buffers described were filtered using a 0.2 μm filter (product number: 10300461, Nalgene) and degassed for 15 min prior to use.
[0327] A flow cell temperature of 25° C. was used throughout the experiments.
[0328] Chip conditioning and immobilization The 4PCH chip was conditioned across all flow cells using a pre-configured conditioning wizard (WAVE control software) injection: 0.1M borate, 1M NaCl (pH 9), followed by three start-up injections of 0.2x running buffer at 0.2x concentration (running buffer composition: 1XHBS-N, pH 7.4, 3.4mM EDTA, 1% DMSO).
[0329] A buffer exchange was performed and 1× running buffer (1×HBS-N, pH 7.4, 3.4 mM EDTA, 1% DMSO) was used during the immobilization procedure: An initial injection of EDC / NHS (mixed in a 1:1 ratio) was performed over all four flow cells to activate the surfaces for amine coupling of ligands.
[0330] Recombinant Sortilin aliquots were rapidly thawed by hand and centrifuged at 13,300 rpm for 10 min. 10 μg / ml protein solutions were then made in pH 5.0 acetate and injected once for 20 min into flow cells 2, 3 and 4 for human, human (flow cells 2 & 3), and mouse Sortilin, respectively, followed by a 60 s dissociation period.
[0331] A final 7 min passivation injection of 50 mM tris was used across all flow cells.
[0332] A flow rate of 10 μl / min was used for all conditioning and fixation cycles.
[0333] Rapid Action: Intermediate Binder Compounds were screened at 1 μM using the built-in "medium binder" settings: 100 ul / min, 45 s baseline, 25 s association, 300 s dissociation, blank every 5th sample and DMSO compensation (1.5% DMSO at the start and end of the experiment as well as every 20 cycles). An acquisition rate of 10 Hz was used throughout the experiment.
[0334] Compounds were screened at a final assay concentration of 1 μM with a final DMSO concentration of 1%. To achieve this, compounds were diluted in DMSO from a 10 mM stock to 100 μM (100× final assay concentration) and then diluted 1:100 into running buffer without DMSO to establish a final assay concentration of compound of 1 μM and a final DMSO concentration of 1% [DMSO].
[0335] Compounds and DMSO were mixed by shaking the plate at 1000 rpm for 60 seconds using a Bioshake instrument.
[0336] A flow rate of 100 μl / min was used throughout the experiments.
[0337] Data evaluation: Data were evaluated using the RAPID kinetic analysis tool in GCI WAVE_control software with data fitted using a standard 1:1 kinetic BioModel.
[0338] [Table 21-1]
[0339] [Table 21-2]
[0340] It is advantageous for the compounds of the invention to have a Kd of less than 1.00E-4. Examples of the invention bind directly to Sortilin protein, as well as to both human and mouse Sortilin proteins in a generally similar manner, and have been shown to have Kds that are advantageous for the development of non-human models of disease. d The data proves it.
[0341] References Andersen, J et al., Identification of the first small-molecule ligand of the neuronal receptor sortilin and structure determination of the receptor-ligand complex. Acta Crystallogr D Biol Crystallogr (2014), 70(Pt 2), pp.451-460; Baker, M. et al., Mutations in progranulin cause tau-negative frontotemporal dementia linked to chromosome 17. Nature (2006), 442(7105), pp. 916-919; Brouwers, N. et al., Genetic variability in progranulin contributes to risk for clinically diagnosed Alzheimer disease. Neurology, (2008), 71(9), pp. 656-664; Buttenshon, HN et al., Increased serum levels of sortilin are associated with depression and correlated with BDNF and VEGF, Nature Translational Psychiatry (2015), 5(e677), pp. 1-7; Carecchio, M., et al., Cerebrospinal fluid biomarkers in Progranulin mutations carriers. J Alzheimers Dis (2011), 27(4), pp. 781-790; Carrasquillo, M. et al.,. Genome-wide screen identifies rs646776 near sortilin as a regulator of progranulin levels in human plasma. Am J Hum Genet (2010), 87(6), pp. 890-897; Chen, Z. Y.et al., Sortilin controls intracellular sorting of brain-derived neurotrophic factor to the regulated secretory pathway. J Neurosci (2005), 25(26), pp. 6156-6166; Cruts, M. et al., Loss of progranulin function in frontotemporal lobar degeneration. Trends Genet (2008), 24(4), pp. 186-194;
[0342] De Muynck, L. et al., The neurotrophic properties of progranulin depend on the granulin E domain but do not require sortilin binding. Neurobiol Aging (2013), 34(11), pp. 2541-2547; Egashira, Y. et al., The growth factor progranulin attenuates neuronal injury induced by cerebral ischemia-reperfusion through the suppression of neutrophil recruitment. J Neuroinflammation (2013), 10, pp. 105; Galimberti, D. et al.,. GRN variability contributes to sporadic frontotemporal lobar degeneration. J Alzheimers Dis (2010), 19(1), pp. 171-177; Galimberti, D. et al.,. Progranulin as a therapeutic target for dementia. Expert Opin Ther Targets (2018), 22(7), pp. 579-585. doi:10.1080 / 14728222.2018.1487951Gao, A. et al., Implications of Sortilin in Lipid Metabolism and Lipid Disorder Diseases. DNA and Cell Biology (2017), 36(12), pp.1050-1061; Gass, J. et al., Progranulin regulates neuronal outgrowth independent of sortilin. Mol Neurodegener (2012), 7, pp. 33; Gass, J. et al., Progranulin: an emerging target for FTLD therapies. Brain Res (2012), 1462, pp. 118-128; Gijselinck, I., et al., Granulin mutations associated with frontotemporal lobar degeneration and related disorders: an update. Hum Mutat (2008), 29(12), pp. 1373-1386; Goettsch, C., et al., Sortilin and Its Multiple Roles in Cardiovascular and Metabolic Diseases. Atherosclerosis, Thrombosis and Vascular Biology (2017), 38(1), pp. 19-25
[0343] Jansen, P., et al., Roles for the pro-neurotrophin receptor sortilin in neuronal development, aging and brain injury. Nature Neuroscience (2007), 10(11), pp.1449-1457; Hu, F. et al., Sortilin-mediated endocytosis determines levels of the frontotemporal dementia protein, progranulin. Neuron (2010), 68(4), pp. 654-667; Huang, G. et al., Insulin responsiveness of glucose transporter 4 in 3T3-L1 cells depends on the presence of sortilin. Mol Biol Cell (2013), 24(19), pp.3115-3122; Kaddai, V. et al. Involvement of TNF-α in abnormal adipocyte and muscle sortilin expression in obese mice and humans. Diabetologia (2009) 52, pp. 932-940; Kjolby, M.et al., Sort1, encoded by the cardiovascular risk locus 1p13.3, is a regulator of hepatic lipoprotein export. Cell Metab (2010), 12(3), pp. 213-223; Laird, A. S. et al., Progranulin is neurotrophic in vivo and protects against a mutant TDP-43 induced axonopathy. PLoS One (2010), 5(10), e13368; Lee, W. et al., Targeted manipulation of the sortilin-progranulin axis rescues progranulin haploinsufficiency. Hum Mol Genet (2014), 23(6), pp. 1467-1478; Martens, L.et al., Progranulin deficiency promotes neuroinflammation and neuron loss following toxin-induced injury. J Clin Invest (2012), 122(11), pp. 3955-3959; Mazella, J. et al., The 100-kDa neurotensin receptor is gp95 / sortilin, a non-G-protein-coupled receptor. J Biol Chem (1998), 273(41), pp. 26273-26276; Miyakawa, S. et al, Anti-sortilin1 Antibody Up-Regulates Progranulin via Sortilin1 Down-Regulation. Front Neurosci (2020), 14, pp. 586107;
[0344] Moller et al. Sortilin as a Biomarker for Cardiovascular Disease Revisited. Frontiers in Cardiovascular Medicine (2021), 8, 652584; Mortensen, M.B. et al., Targeting sortilin in immune cells reduces proinflammatory cytokines and atherosclerosis. J Clin Invest (2014), 124(12), pp. 5317-5322; Nykjaer, A et al., Sortilin is essential for proNGF-induced neuronal cell death. Nature (2014), 427(6977), pp. 843-848; Nykjaer, A., & Willnow, T. E, Sortilin: a receptor to regulate neuronal viability and function. Trends Neurosci (2012), 35(4), pp. 261-270. Oh, T.J. et al., Circulating sortilin level as a potential biomarker for coronary atherosclerosis and diabetes mellitus. Cardiovascular Diabetology (2017), 16(92); Pan, X. et al., Sortilin and retromer mediate retrograde transport of Glut4 in 3T3-L1 adipocytes. Mol Biol Cell (2017), 28(12), pp.1667-1675; Petersen, C. et al., Molecular identification of a novel candidate sorting receptor purified from human brain by recepto r-associated protein affinity chromatography. J Biol Chem (1997), 272(6), pp. 3599-3605; Pickford, F.et al., Progranulin is a chemoattractant for microglia and stimulates their endocytic activity. Am J Pathol (2011), 178(1), pp. 284-295; Pottier, C., et al., Potential genetic modifiers of disease risk and age at onset in patients with frontotemporal lobar degeneration and GRN mutations: a genome-wide association study. Lancet Neurol (2018), 17(6), pp. 548-558;
[0345] Quistgaard, E. et al., Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Nat Struct Mol Biol (2009), 16(1), pp. 96-98; Santos, A. M. et al., Sortilin Participates in Light-dependent Photoreceptor Degeneration in Vivo. PLoS ONE (2012), 7(4), pp. e36243-e36243.16. Kuruvilla, R. et al., A neurotrophin signaling cascade coordinates sympathetic neuron development through differential control of TrkA trafficking and retrograde signalling. Cell (2004), 118(2), pp. 243-255; Shi, J. & Kandror, K. V., Sortilin Is Essential and Sufficient for the Formation of Glut4 Storage Vesicles in 3T3-L1 Adipocytes. Developmental Cell (2005), 9, pp. 99-108; Schroder, T. et al., The identification of AF38469: an orally bioavailable inhibitor of the VPS10P family sorting receptor Sortilin. Bioorg Med Chem Lett (2014), 24(1), pp. 177-180; Sheng, J. et al., Progranulin polymorphism rs5848 is associated with increased risk of Alzheimer’s disease. Gene (2014), 542(2), pp. 141-145;Skeldal, S. et al., Mapping of the Interaction Site between Sortilin and the p75 Neurotrophin Receptor Reveals a Regulatory Role for the Sortilin Intracellular Domain in p75 Neurotrophin Receptor Shedding and Apoptosis. J Biol Chem (2012), 21(287), pp. 43798-43809; Tauris, J., et al., Proneurotrophin-3 May Induce Sortilin-Dependent Death In Inn er Ear Neurons. Eur J Neuroscience (2020), 33(4), pp.622-31;
[0346] Tang, W. et al., The growth factor progranulin binds to TNF receptors and is therapeutic against inflammatory arthritis in mice. Science (2011), 332(6028), pp. 478-484; Tao, J.et al., Neuroprotective effects of progranulin in ischemic mice. Brain Res (2012), 1436, pp. 130-136; Tenk, H.K., et al., ProBDNF induces neuronal apoptosis via activation of a receptor complex of p75NTR and sortilin. J Neuroscience (2005), 10(11), pp.1449-1457 Van Kampen, J. M., et al., Progranulin gene delivery protects dopaminergic neurons in a mouse model of Parkinson’s disease. PLoS One (2014), 9(5), e97032; Willnow, T. E.et al., VPS10P-domain receptors - regulators of neuronal viability and function. Nat Rev Neurosci (2008), 9(12), pp. 899-909; Willnow, T.E., et al., Sortilins: new players in lipoprotein metabolism. Current Opinion in Lipidology (2011), 22(2), pp. 79-85. Wuts, P.G.M. and Greene, T.W, Greene’s Protective Groups in Organic Synthesis, 4th Edition, John Wiley and Sons, New York (2006);
[0347] Xu, S.H. et al., Regional and Cellular Mapping of Sortilin Immunoreactivity in Adult Human Brain, Frotiers in Neuroanatomy (2019), 13(31), pp. 1-27; Yano, H., et al., Proneurotrophin-3 is a neuronal apoptotic ligand: evidence for retrograde-directed cell killing. J Neurosci (2009), 29(47), pp. 14790-14802; Yin, F., et al., Exaggerated inflammation, impaired host defense, and neuropathology in progranulin-deficient mice. J Exp Med (2010), 207(1), pp. 117-128; Zheng, Y., et al., C-terminus of progranulin interacts with the beta-propeller region of sortilin to regulate progranulin trafficking. PLoS One (2011), 6(6), e21023; Zhou, X. et al., Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin. J Cell Biol (2015), 210(6), pp. 991-1002; Meneses et al., TDP-43 Pathology in Alzheimer’s Disease, Mol Neurodegeneration (2021), 16, 84; Prudencio et al., Misregulation of human sortilin splicing leads to the generation of a nonfunctional progranulin receptor, Proc Natl Acad Sci USA (2012), 109(52): 21510-21515; Beel et al., Progranulin reduces insoluble TDP-43 levels, slows down axonal degeneration and prolongs survival in mutant TDP-43 mice, Mol Neurodegener. (2018), 13: 55.
[0348] Sequences referenced throughout and forming part of this specification SEQ ID NO:1 (Full length sortilin - isoform 1) 1 MERPWGAADG LSRWPHGLGL LLLLQLLPPS TLSQDRLDAP PPPAAPLPRW 51 SGPIGVSWGL RAAAAGGAFP RGGRWRRSAP GEDEECGRVR DFVAKLANNT 101 HQHVFDDLRG SVSLSWVGDS TGVILVLTTF HVPLVIMTFG QSKLYRSEDY 151 GKNFKDITDL INNTFIRTEF GMAIGPENSG KVVLTAEVSG GSRGGRIFRS 201 SDFAKNFVQT DLPFHPLTQM MYSPQNSDYL LALSTENGLW VSKNFGGKWE 251 EIHKAVCLAK WGSDNTIFFT TYANGSCKAD LGALELWRTS DLGKSFKTIG 301 VKIYSFGLGG RFLFASVMAD KDTTRRIHVS TDQGDTWSMA QLPSVGQEQF 351 YSILAANDDM VFMHVDEPGD TGFGTIFTSD DRGIVYSKSL DRHLYTTTGG 401 ETDFTNVTSL RGVYITSVLS EDNSIQTMIT FDQGGRWTHL RKPENSECDA 451 TAKNKNECSL HIHASYSISQ KLNVPMAPLS EPNAVGIVIA HGSVGDAISV 501 MVPDVYISDD GGYSWTKMLE GPHYYTILDS GGIIVAIEHS SRPINVIKFS 551 TDEGQCWQTY TFTRDPIYFT GLASEPGARS MNISIWGFTE SFLTSQWVSY 601 TIDFKDILER NCEEKDYTIW LAHSTDPEDY EDGCILGYKE QFLRLRKSSM 651 CQNGRDYVVT KQPSICLCSL EDFLCDFGYY RPENDSKCVE QPELKGHDLE 701 FCLYGREEHL TTNGYRKIPG DKCQGGVNPV REVKDLKKKC TSNFLSPEKQ 751 NSKSNSVPII LAIVGLMLVT VVAGVLIVKK YVC GGRFLVHRYSVLQQHAE 801 ANGVDGVDAL DTASHTNKSG YHDDSDEDLL E
[0349] SEQ ID NO:2 (Full length sortilin - isoform 2) 1 MERPWGAADG LSRWPHGLGL LLLLQLLPPS TLSQDRLDAP PPPAAPLPRW 51 SGPIGVSWGL RAAAAGGAFP RGGRWRRSAP GEDEECGRVR DFVAKLANNT 101 HQHVFDDLRG SVSLSWVGDS TGVILVLTTF HVPLVIMTFG QSKLYRSEDY 151 GKNFKDITDL INNTFIRTEF GMAIGPENSG KVVLTAEVSG GSRGGRIFRS 201 SDFAKNFVQT DLPFHPLTQM MYSPQNSDYL LALSTENGLW VSKNFGGKWE 251 EIHKAVCLAK WGSDNTIFFT TYANGSCTDL GALELWRTSD LGKSFKTIGV 301 KIYSFGLGGR FLFASVMADK DTTRRIHVST DQGDTWSMAQ LPSVGQEQFY 351 SILAANDDMV FMHVDEPGDT GFGTIFTSDD RGIVYSKSLD RHLYTTTGGE 401 TDFTNVTSLR GVYITSVLSE DNSIQTMITF DQGGRWTHLR KPENSECDAT 451 AKNKNECSLH IHASYSISQK LNVPMAPLSE PNAVGIVIAH GSVGDAISVM 501 VPDVYISDDG GYSWTKMLEG PHYYTILDSG GIIVAIEHSS RPINVIKFST 551 DEGQCWQTYT FTRDPIYFTG LASEPGARSM NISIWGFTES FLTSQWVSYT 601 IDFKDILERN CEEKDYTIWL AHSTDPEDYE DGCILGYKEQ FLRLRKSSVC 651 QNGRDYVVTK QPSICLCSLE DFLCDFGYYR PENDSKCVEQ PELKGHDLEF 701 CLYGREEHLT TNGYRKIPGD KCQGGVNPVR EVKDLKKKCT SNFLSPEKQN 751 SKSNSVPIIL AIVGLMLVTV VAGVLIVKKY VCGGRFLVHR YSVLQQHAEA 801 NGVDGVDALD TASHTNKSGY HDDSDEDLLE
[0350] SEQ ID NO:3 (mature sortilin) 1 MTFGQSKLYR SEDYGKNFKD ITDLINNTFI RTEFGMAIGP ENSGKVVLTA 51 EVSGGSRGGR IFRSSDFAKN FVQTDLPFHP LTQMMYSPQN SDYLLALSTE 101 NGLWVSKNFG GKWEEIHKAV CLAKWGSDNT IFFTTYANGS CTDLGALELW 151 RTSDLGKSFK TIGVKIYSFG LGGRFLFASV MADKDTTRRI HVSTDQGDTW 201 SMAQLPSVGQ EQFYSILAAN DDMVFMHVDE PGDTGFGTIF TSDDRGIVYS 251 KSLDRHLYTT TGGETDFTNV TSLRGVYITS VLS EDNSIQT MITFDQGGRW 301 THLRKPENSE CDATAKNKNE CSLHIHASYS ISQKLNVPMA PLSEPNAVGI 361 VIAHGSVGDA ISVMVPDVYI SDDGGYSWTK MLEGPHYYTI LDSGGIIVAI 401 EHSSRPINVI KFSTDEGQCW QTYTFTRDPI YFTGLASEPG ARSMNISIWG 451 FTESFLTSQW VSYTIDFKDI LERNCEEKDY TIWLAHSTDP EDYEDGCILG 501 YKEQFLRLRK SSVCQNGRDY VVTKQPSICL CSLEDFLCDF GYYRPENDSK 551 CVEQPELKGH DLEFCLYGRE EHLTTNGYRK IPGDKCQGGV NPVREVKDLK 601 KKCTSNFLSP EKQNSKSNSV PIILAIVGLM LVTVVAGVLI VKKYVCGGRF 651 LVHRYSVLQQ HAEANGVDGV DALDTASHTN KSGYHDDSDE DLLE
[0351] Array number 4 (mouse sortilin) >sp|Q6PHU5|SORT_MOUSE Sortilin OS=Mus musculus OX=10090 GN=Sort1 PE=1 SV=1 MERPRGAADGLLRWPLGLLLLLQLLPPAAVGQDRLDAPPPPAPPLLRWAGPVGVSWGLRA AAPGGPVPRAGRWRRGAPAEDQDCGRLPDFIAKLTNNTHQHVFDDLSGSVSLSWVGDSTG VILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNLINNTFIRTEFGMAIGPENSGKV ILTAEVSGGSRGGRVFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVS KNFGEKWEEIHKAVCLAKWGPNNIIFFTTHVNGSCKADLGALELWRTSDLGKTFKTIGVK IYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVF MHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSED NSIQSMITFDQGGRWEHLRKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMAPLSEP NAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNR PINVIKFSTDEGQCWQSYVFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTV DFKDILERNCEEDDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQ PSVCPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDK CQGGMNPAREVKDLKKKCTSNFLNPTKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYV CGGRFLVHRYSVLQQHAEADGVEALDSTSHAKSGYHDDSDEDLLE
Claims
1. A compound that binds to sortilin and modulates its activity, and has a blood-to-brain K greater than 0.
1. puu The compound having the formula:
2. 10. Use of a compound according to claim 1 in the manufacture of a medicament for the treatment or prevention of a disease of the central nervous system, wherein said disease of the central nervous system is a neurodegenerative disorder selected from motor neuron disease, frontotemporal lobar degeneration (FTLD), frontotemporal dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, prion diseases including Creutzfeldt-Jakob disease (CJD), acute brain injury, spinal cord injury and stroke; a psychiatric disorder selected from bipolar disorder, major depression, post-traumatic stress disorder, and anxiety disorder; hearing loss selected from noise-induced hearing loss, ototoxic hearing loss, age-related hearing loss, idiopathic hearing loss, tinnitus, and sudden hearing loss; Brain tumors, retinopathy, glaucoma, neuroinflammation, chronic pain and diseases characterized by misfolded tau Selected from, use.
3. Formula (I): 【Chemical 1】 or a pharmaceutically acceptable salt, solvate, hydrate, tautomer, optical isomer, N-oxide, and / or prodrug thereof, wherein R 1 , R 2 and R 3 is halo, H, (C 1 -C 4 ) alkyl, halo-(C 1 -C 4 ) alkyl, (C 2 -C 4 ) alkenyl, and halo-(C 2 -C 4 ) alkenyl; and R 4 is H, (C 1 -C 3 ) alkyl, halo-(C 1 -C 3 ) alkyl, (C 3 -C 8 ) aryl, halo-(C 3 -C 8 ) aryl, (C 3 -C 8 ) heteroaryl and halo-(C 3 -C 8 ) heteroaryl; R 5 is (C 3 -C 20 )-aryl, (C 3 -C 20 )-heteroaryl and 3- to 12-membered heterocyclic ring; The aryl, heteroaryl or heterocyclic ring may be selected from halo, —OH, cyano, carbonyl, (C 1 -C 4 ) alkyl, (C 1 -C 4 ) hydroxyalkyl, halo-(C 1 -C 4 ) alkyl, acetyl, (C 1 -C 4 ) alkoxy, halo-(C 1 -C 4 ) alkoxy, (C 3 -C 8 ) aryl and (C 3 -C 8 ) optionally substituted with one or more substituents independently selected from heteroaryl; or R 4 and R 5 are taken together to form a 6- to 20-membered heterocyclic ring; The heterocyclic ring may be monocyclic, bicyclic, or tricyclic, and may include halo, —OH, cyano, carbonyl, (C 1 -C 4 ) alkyl, halo-(C 1 -C 10 ) alkyl, acetyl, (C 1 -C 4 ) alkoxy, and halo-(C 1 -C 4 ) optionally substituted with one or more substituents independently selected from alkoxy).
4. R 1 , R 2 and R 3 But, Halo, (C 1 -C 2 ) alkyl and halo-(C 1 -C 2 4. The compound of claim 3, wherein each independently is selected from the group consisting of: ) alkyl.
5. R 1 , R 2 and R 3 But F, CH 3 and C.F. 3 4. The compound of claim 3, wherein each independently is selected from:
6. R 4 But, H, (C 1 -C 2 ) alkyl, halo-(C 1 -C 2 ) alkyl, (C 5 -C 8 ) aryl, halo-(C 5 -C 8 ) aryl, (C 3 -C 8 ) heteroaryl and halo-(C 3 -C 8 4. The compound of claim 3, wherein the compound is selected from the group consisting of: ) heteroaryl.
7. R 4 but, (i)H (ii)CH 3 (iii)CF 3 (iv) CHF 2 and 【Chemistry 2】 7. The compound of claim 6 selected from the group consisting of:
8. R 5 However, (C 5 -C 12 )-aryl, (C 5 -C 12 )-heteroaryl and 5- to 12-membered heterocyclic ring; The aryl, heteroaryl or heterocyclic ring is selected from the group consisting of halo, —OH, cyano, carbonyl, (C 1 -C 2 ) alkyl, (C 1 -C 2 ) hydroxyalkyl, halo-(C 1 -C 2 ) alkyl, (C 1 -C 2 ) alkoxy, halo-(C 1 -C 2 ) alkoxy, (C 3 -C 8 ) aryl and (C 3 -C 8 ) optionally substituted with one or more substituents independently selected from heteroaryl; The compound of claim 3.
9. R 5 but, 【Chemistry 3】 9. The compound of claim 8 selected from the group consisting of:
10. R 4 and R 5 are taken together to form an 8- to 20-membered heterocyclic ring; the heterocyclic ring is tricyclic; The compound of claim 3.
11. R 4 and R 5 together form the following structure: 【Chemistry 4】 11. The compound of claim 10, wherein
12. wherein said compound of formula (I) (S)-2-(((7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl)amino)-5,5-dimethylhexanoic acid; rac-2-(((7-hydroxy-4-methyl-2-oxo-2H-chromen-8-yl)methyl)amino)-5,5-dimethylhexanoic acid; (S)-2-(benzylamino)-5,5-dimethylhexanoic acid; (S)-5,5-dimethyl-2-(((1-methyl-1H-indol-4-yl)methyl)amino)hexanoic acid; (S)-2-(benzhydrylamino)-5,5-dimethylhexanoic acid; (S)-5,5-dimethyl-2-(((1-methyl-1H-indol-4-yl)methyl)amino)hexanoic acid; (S)-5,5-dimethyl-2-(((R)-1-phenylethyl)amino)hexanoic acid; (S)-5,5-dimethyl-2-(((S)-1-phenylethyl)amino)hexanoic acid; (S)-5,5-dimethyl-2-(((S)-2,2,2-trifluoro-1-phenylethyl)amino)hexanoic acid; (S)-5,5-dimethyl-2-(((R)-2,2,2-trifluoro-1-phenylethyl)amino)hexanoic acid; (2S)-5,5-dimethyl-2-{[(3-methylisoquinolin-8-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(isoquinolin-8-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-({[2-(trifluoromethoxy)phenyl]methyl}amino)hexanoic acid; (2S)-2-{[(2-fluorophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(2,6-difluorophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-({[2-(trifluoromethyl)phenyl]methyl}amino)hexanoic acid; (2S)-2-{[(1S)-2,2-difluoro-1-phenylethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1R)-2,2-difluoro-1-phenylethyl]amino}-5,5-dimethylhexanoic acid; (S)-2-(((S)-2,2-difluoro-1-(3-methoxyphenyl)ethyl)amino)-5,5-dimethylhexanoic acid; (S)-2-(((R)-2,2-difluoro-1-(3-methoxyphenyl)ethyl)amino)-5,5-dimethylhexanoic acid; (S)-5,5-dimethyl-2-(((R)-2,2,2-trifluoro-1-(3-methoxyphenyl)ethyl)amino)hexanoic acid; (S)-5,5-dimethyl-2-(((S)-2,2,2-trifluoro-1-(3-methoxyphenyl)ethyl)amino)hexanoic acid; (S)-2-((3-(hydroxymethyl)benzyl)amino)-5,5-dimethylhexanoic acid; (S)-2-((2,3-dimethoxybenzyl)amino)-5,5-dimethylhexanoic acid; (S)-2-((3,5-dimethoxybenzyl)amino)-5,5-dimethylhexanoic acid; (S)-2-((2,5-dimethoxybenzyl)amino)-5,5-dimethylhexanoic acid; (2S)-2-{[(3-fluoro-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3-chloro-5-methoxyphenyl)methyl]amino}-5,5- Dimethylhexanoic acid; (2S)-2-{[(3-bromo-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3,5-dichlorophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3-methoxy-4-methylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(2-fluoro-3-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(quinolin-3-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-{[(quinolin-2-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3-fluoro-4-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3,4-dimethoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(5,6,7,8-tetrahydronaphthalen-1-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3,4-dihydro-2H-1-benzopyran-6-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(2,3-dihydro-1,4-benzodioxin-6-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(quinoxalin-6-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-[({1H-pyrrolo[2,3-b]pyridin-5-yl}methyl)amino]hexanoic acid; (2S)-5,5-dimethyl-2-[({1H-pyrrolo[2,3-b]pyridin-4-yl}methyl)amino]hexanoic acid; (2S)-2-{[(2H-1,3-benzodioxol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(quinolin-6-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-{[(quinolin-8-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-{[(quinolin-5-yl)methyl]amino}hexanoic acid; (2S)-2-{[(2-methoxynaphthalen-1-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1H-indol-2-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1,3-benzothiazol-5-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(1-methyl-1H-pyrazol-5-yl)methyl]amino}hexanoic acid; (2S)-2-{[(1,3-benzothiazol-6-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(1-methyl-1H-indazol-6-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-{[(pyrimidin-5-yl)methyl]amino}hexyl San acid; (2S)-5,5-dimethyl-2-({[2-(pyridin-4-yl)phenyl]methyl}amino)hexanoic acid; (2S)-2-({[3-(1H-imidazol-1-yl)phenyl]methyl}amino)-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(pyridin-4-yl)methyl]amino}hexanoic acid; (2S)-2-({[2-(hydroxymethyl)phenyl]methyl}amino)-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(1,5-naphthyridin-3-yl)methyl]amino}hexanoic acid; (2S)-2-{[(1S)-1-(3,4-dimethoxyphenyl)-2,2-difluoroethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1,7-dimethyl-1H-indol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(1-methyl-1H-indazol-4-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-{[(1R)-1-(1-methyl-1H-indol-4-yl)ethyl]amino}hexanoic acid; (2S)-2-{[(6-methoxynaphthalen-2-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1S)-1-(3,4-dimethoxyphenyl)-2,2,2-trifluoroethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1R)-1-(3,4-dimethoxyphenyl)-2,2-difluoroethyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(1-methyl-1H-indol-7-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3,4-dimethylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1S)-1-(4-methoxy-3-methylphenyl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1R)-1-(3,4-dimethoxyphenyl)-2,2,2-trifluoroethyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(1-methyl-1H-1,3-benzodiazol-5-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-{[(1-methyl-1H-1,3-benzodiazol-4-yl)methyl]amino}hexanoic acid; (2S)-2-{[(1S)-1-(3,4-dimethoxyphenyl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(2-methylpyrimidin-5-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-{[(2-methyl-1,3-benzothiazol-5-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3-chloro-4-methylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3-hydroxy-4-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(1-methyl-1H-1,2,3-benzotriazol-5-yl)methyl]amino}hexanoic acid; (2S)-5,5-dimethyl-2-{[(pyrimidin-4-yl)methyl]amino}hexyl San acid; (2S)-5,5-dimethyl-2-{[(1S)-1-(1-methyl-1H-indol-4-yl)ethyl]amino}hexanoic acid; (2S)-2-{[(3-acetylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1-ethyl-1H-indol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1-benzofuran-5-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1S)-1-(2-methoxypyridin-4-yl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1R)-1-(4-methoxy-3-methylphenyl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3,4-dichlorophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(5-bromopyridin-3-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-[({1-methyl-1H-pyrrolo[2,3-b]pyridin-5-yl}methyl)amino]hexanoic acid; (2S)-2-{[(5-methoxypyridin-3-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(1H-indol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(isoquinolin-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(1R)-1-(pyrimidin-5-yl)ethyl]amino}hexanoic acid; (2S)-2-{[(4-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(5-methylpyridin-3-yl)methyl]amino}hexanoic acid; (2S)-2-{[(2,3-dimethylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(1S)-1-(pyrimidin-5-yl)ethyl]amino}hexanoic acid; (2S)-2-{[(2H-indazol-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(6-methylpyridin-3-yl)methyl]amino}hexanoic acid; (2S)-2-{[(2-chloro-3-fluoropyridin-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(isoquinolin-5-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(4-chlorophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(2-methoxypyridin-4-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(2-fluoro-5-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(2-methylpyridin-4-yl)methyl]amine no}hexanoic acid; (2S)-5,5-dimethyl-2-{[(1-methyl-1H-indol-6-yl)methyl]amino}hexanoic acid; (2S)-2-{[(1R)-1-(3,4-dimethoxyphenyl)ethyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(3-methylpyridin-4-yl)methyl]amino}hexanoic acid; (2S)-2-{[(3-methoxy-5-methylphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(3-cyanophenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(4-methoxynaphthalen-1-yl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-2-{[(4-fluoro-3-methoxyphenyl)methyl]amino}-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-{[(pyridin-3-yl)methyl]amino}hexanoic acid; and (2S)-2-{[(3-methoxy-2-methylphenyl)methyl]amino}-5,5-dimethylhexanoic acid 4. The compound of claim 3, wherein:
13. R 5 but, (i) each of which is selected from the group consisting of halo, —OH, (C 1 -C 2 ) alkyl, (C 1 -C 2 ) alkoxy, (C 1 -C 2 ) hydroxyalkyl, (C 1 -C 2 ) haloalkyl, (C 1 -C 2 ) phenyl, naphthyl, 5- or 6-membered monocyclic heteroaryl, and 9- or 10-membered fused bicyclic heteroaryl optionally substituted with one or more substituents independently selected from the group consisting of haloalkoxy, acetyl, cyano, imidazolyl, and pyridyl, wherein no more than two ring atoms in said 5- or 6-membered monocyclic heteroaryl group are heteroatoms and no more than three ring atoms in said 9- or 10-membered fused bicyclic heteroaryl group are heteroatoms; and 【Chemistry 5】 4. The compound of claim 3 selected from the group consisting of:
14. R 5 but, (i) each of which is selected from the group consisting of halo, —OH, (C 1 -C 2 ) alkyl, (C 1 -C 2 ) alkoxy, (C 1 -C 2 ) hydroxyalkyl, (C 1 -C 2 ) haloalkyl, (C 1 -C 2 ) phenyl, pyridyl, pyrimidinyl, pyrazolyl, quinolinyl, isoquinolinyl, indolyl, azaindolyl, quinoxalinyl, benzothiazolyl, indazolyl, naphthyridinyl, naphthyl, benzimidazolyl, benzotriazolyl, and benzofuranyl, optionally substituted with one or more substituents independently selected from the group consisting of haloalkoxy, acetyl, cyano, imidazolyl, and pyridyl; and 【Chemistry 6】 14. The compound of claim 13 selected from the group consisting of:
15. R 5 but, (i) halo, —OH, (C 1 -C 2 ) alkyl, (C 1 -C 2 ) alkoxy, (C 1 -C 2 ) hydroxyalkyl, (C 1 -C 2 ) haloalkyl, (C 1 -C 2 ) phenyl optionally substituted with one or more substituents independently selected from the group consisting of haloalkoxy, acetyl, cyano, imidazolyl, and pyridyl; (ii) halo, (C 1 -C 2 ) alkyl, (C 1 -C 2 ) pyridyl optionally substituted with one or more substituents independently selected from the group consisting of alkoxy; (iii) each of which is (C 1 -C 2 ) alkyl, pyrimidinyl, and pyrazolyl, optionally substituted with one or more substituents independently selected from the group consisting of: (iv) each of which is (C 1 -C 2 ) alkyl and (C 1 -C 2 quinolinyl, isoquinolinyl, indolyl, azaindolyl, quinoxalinyl, benzothiazolyl, indazolyl, naphthyridinyl, naphthyl, benzimidazolyl, benzotriazolyl, and benzofuranyl, optionally substituted with one or more substituents selected from the group consisting of alkoxy; and 【Chemistry 7】 15. The compound of claim 14 selected from the group consisting of:
16. R 5 is the following group: 【Chemistry 8-1】 【Chemistry 8-2】 【Chemistry 8-3】 16. The compound of claim 15, wherein
17. A pharmaceutical composition comprising a compound according to any one of claims 1 and 3 to 16 and a pharmaceutically acceptable carrier, excipient, and / or diluent.
18. 18. A pharmaceutical composition according to claim 17 for use in therapy.
19. 18. The pharmaceutical composition of claim 17 for the treatment or prevention of a neurodegenerative disorder, a psychiatric disorder, an inflammatory disorder, cancer, pain, diabetes, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, kidney disease, psoriasis, a genetic eye condition, hearing loss or a disease characterized by misfolded tau; the neurodegenerative disorder is selected from motor neuron disease, frontotemporal lobar degeneration (FTLD), frontotemporal dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, prion diseases including Creutzfeldt-Jakob disease (CJD), acute brain injury, spinal cord injury, and stroke, and the motor neuron disease is selected from amyotrophic lateral sclerosis (ALS), primary lateral sclerosis, and progressive muscular atrophy; the neurodegenerative disorder is a neurodegenerative disorder characterized by misfolded TAR DNA-binding protein 43 selected from amyotrophic lateral sclerosis, Alzheimer's disease, frontotemporal lobar degeneration, and frontotemporal dementia; the psychiatric disorder is selected from bipolar disorder, major depression, post-traumatic stress disorder, and an anxiety disorder; the inflammatory disorder is selected from an inflammatory disease and neuroinflammation; the cancer is selected from breast cancer, lung cancer, ovarian cancer, prostate cancer, thyroid cancer, pancreatic cancer, glioblastoma, and colorectal cancer; the cardiovascular disease is selected from atherosclerosis, cardiomyopathy, heart attack, arrhythmia, heart failure, and ischemic heart disease; and A pharmaceutical composition wherein the hearing loss is selected from noise-induced hearing loss, ototoxic hearing loss, age-related hearing loss, idiopathic hearing loss, tinnitus, and sudden hearing loss.