Compositions and methods for inducing esr1, pi3k, her2, and her3 immune responses

Abstract

To provide solutions to problems associated with previous attempts to generate cancer vaccines, and further potentially propose improved methods for cancer treatment and prevention.SOLUTION: The present disclosure relates to a field of molecular virology, and particularly to nucleic acid molecules encoding a modified equine encephalitis virus viral genome and a self-replicating RNA (srRNA) construct, pharmaceutical compositions comprising the same, and use of such nucleic acid molecules and compositions for production of desired products in cell cultures or in a living body. Also provided are methods for eliciting an immune response in a subject in need thereof, and methods for preventing and / or treating cancer.SELECTED DRAWING: Figure 1

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of priority to U.S. Patent Application No. 17 / 537,199, filed November 29, 2021. The above-referenced application is hereby incorporated by reference in its entirety, including any drawings.

[0002] Incorporation of sequence listings The contents of the attached Sequence Listing are hereby incorporated by reference into this application. 058462-505001 The attached Sequence Listing file, named WO_Sequence Listing_ST26.xml, was created on November 28, 2022 and is 101 KB.

[0003] Field The present disclosure relates to the fields of molecular virology and immunology, and in particular to nucleic acid molecules encoding the viral genome and self-replicating RNA (srRNA) of modified equine encephalitis viruses, pharmaceutical compositions containing the same, and the use of such nucleic acid molecules and compositions for the production of desired products in cell culture or in an organism. Also provided are methods for eliciting an immune response in a subject in need thereof, and methods for preventing and / or treating conditions. [Background technology]

[0004] background The development of resistance to cancer therapeutic or prophylactic agents is a common problem in the treatment of cancer or precancerous lesions, and various mechanisms of resistance to therapeutic agents are known. Resistance is often the result of changes in gene expression (protein overexpression or expression blockage), changes in the gene due to mutation, or altered sequence due to altered splicing or translocation, or altered protein activation in the cell (protein overactivation or activation blockage).

[0005] One way to address cancers in which such changes in gene expression, alterations, and mutations occur has been the development of cancer vaccines. Cancer vaccines target antigens expressed by tumors, but the application of these vaccines has not been as effective as previously hoped due to the induction of immune tolerance through chronic overexpression of target proteins in the absence of costimulatory molecules and under the induced immune-modulating environment. Preventive cancer vaccines may be more promising, but cancers are highly variable, with multiple genetic alterations and few truly universal changes. Therefore, it is difficult to predict which antigens will be overexpressed in any particular cancer or whether individuals should be vaccinated, and if so, which antigens should be used.

[0006] The disclosure provided herein provides solutions to the problems that have existed with previous attempts to create cancer vaccines, and further potentially suggests improved methods for cancer treatment and prevention. Summary of the Invention

[0007] The present disclosure generally relates to the development of immunotherapeutics, such as recombinant nucleic acid constructs and pharmaceutical compositions comprising the same, for use in the prevention and management of various health conditions, including cancer. In particular, as described in more detail below, some embodiments of the present disclosure provide nucleic acid constructs containing sequences encoding a modified genome or self-replicating RNA (srRNA) of the alphavirus Eastern Equine Encephalitis Virus (EEEV), wherein at least a portion of the nucleic acid sequence encoding a viral structural protein related to the modified EEEV genome or srRNA has been replaced with a coding sequence for a polypeptide construct comprising: a) a coding sequence for estrogen receptor 1 (ESR1) or a mutant thereof; b) a coding sequence for PI3K or a mutant thereof; c) a coding sequence for HER2 or a mutant thereof; and d) a coding sequence for HER3 or a mutant thereof. Also disclosed are recombinant cells engineered to contain one or more nucleic acid constructs disclosed herein, methods for producing molecules of interest, and pharmaceutical compositions comprising one or more of the following: (a) a nucleic acid construct of the present disclosure, (b) a recombinant cell of the present disclosure, or (c) a pharmaceutical composition of the present disclosure. In certain aspects of the present disclosure, compositions and methods are further provided for inducing an immune response in a subject in need thereof, and / or for preventing and / or treating various conditions, including cancer, in a subject in need thereof. The foregoing summary is merely illustrative and is not intended to be limiting in any way. In addition to the exemplary embodiments and features described herein, further aspects, embodiments, objects, and features of the present disclosure will become more fully apparent from the drawings, detailed description, and claims.

[0008] In one aspect of the present disclosure, provided herein is a nucleic acid construct comprising a nucleic acid sequence encoding a modified Eastern Equine Encephalitis Virus (EEEV) genome or srRNA, wherein at least a portion of the nucleic acid sequence encoding a viral structural protein of the modified EEEV genome or srRNA has been replaced with a coding sequence for a polypeptide construct, including: a) a coding sequence for estrogen receptor 1 (ESR1) or a variant thereof; b) a coding sequence for PI3K or a variant thereof; c) a coding sequence for HER2 or a variant thereof; and d) a coding sequence for HER3 or a variant thereof.

[0009] In some embodiments, the modified EEEV genome or srRNA does not include nucleic acid sequences encoding viral structural proteins.

[0010] In some embodiments, the nucleic acid sequence encoding the modified EEEV or srRNA is operably linked to a promoter sequence.

[0011] In some embodiments, the coding sequences of (a) through (d) are operably linked to each other in a single open reading frame (e.g., within a polycistronic ORF). In some embodiments, each antigen is under the control of a separate promoter. In certain other embodiments, all four antigens are under the control of a single promoter, for example, the S26 subgenomic promoter.

[0012] In some embodiments, the coding sequence is operably linked to a coding sequence for an autoproteolytic peptide or an internal ribosome entry site (IRES). In some embodiments, the autoproteolytic peptide comprises one or more autoproteolytic cleavage sequences from calcium-dependent serine endoprotease (furin), porcine teschovirus-1 2A (P2A), foot-and-mouth disease virus (FMDV) 2A (F2A), equine rhinitis A virus (ERAV) 2A (E2A), Thosea asigna virus 2A (T2A), cytoplasmic polyhedrosis virus 2A (BmCPV2A), flacherie virus 2A (BmIFV2A), or a combination thereof. In some embodiments, the IRES is derived from Kaposi's sarcoma-associated herpesvirus (KSHV) IRES, Hepatitis virus IRES, Pestivirus IRES, Cripavirus IRES, Rhopalosiphum padi virus IRES, fibroblast growth factor IRES, platelet-derived growth factor IRES, vascular endothelial growth factor IRES, insulin-like growth factor IRES, picornavirus IRES, encephalomyocarditis virus (EMCV) IRES, Pim-1 IRES, p53 IRES, Apaf-1 IRES, TDP2 IRES, L-myc IRES, and c-myc IRES.

[0013] In some embodiments, at least one of the coding sequences (a)-(d) comprises one or more molecular modifications. In some embodiments, the one or more molecular modifications are organized into multiple modification cassettes arranged in tandem along the length of the coding sequence. In some embodiments, the multiple modification cassettes are operably linked to each other by one or more linkers.

[0014] In some embodiments, the coding sequence of the ESR1 variant of (a) comprises one or more molecular modifications that promote ligand-independent receptor activity, in some embodiments, the one or more molecular modifications comprise an activating mutation selected from the group consisting of K303R, E380Q, Y537C, Y537S, Y537N, and D538G.

[0015] In some embodiments, the coding sequence of the PI3K mutant of (b) comprises one or more molecular modifications that promote ligand-independent receptor activity, in some embodiments, the one or more molecular modifications comprise an activating mutation selected from the group consisting of E542K, E545K, H1047L, and H1047R.

[0016] In some embodiments, the HER2 variant in (c) comprises coding sequences for the extracellular domain and the transmembrane domain.

[0017] In some embodiments, the HER3 mutant in (d) comprises a coding sequence for a kinase-inactive HER3.

[0018] In some embodiments, the nucleic acid sequence has at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 7-10.

[0019] In some embodiments, the coding sequence of the polypeptide construct comprises, from 5' to 3', the following: a) a coding sequence for a mutant of PI3K comprising one or more activating molecule modifications selected from E542K, H1047L, E545K, and H1047R; b) a coding sequence for the autoproteolytic peptide P2A; c) a coding sequence for a mutant of HER2 comprising its extracellular domain and transmembrane domain; d) a coding sequence for the autoproteolytic peptide P2A; e) a coding sequence for a kinase-inactive mutant of HER3; f) a coding sequence for an internal ribosome entry site (IRES); and g) a coding sequence for a mutant of ESR1 comprising one or more activating molecule modifications selected from Y537C, E380Q, K303R, Y537S, D538G, and Y537N.

[0020] In one aspect, provided herein is a recombinant cell comprising a nucleic acid construct disclosed herein. In some embodiments, the recombinant cell is a mammalian cell or an insect cell.

[0021] In yet another aspect, provided herein is a pharmaceutical composition comprising a pharmaceutically acceptable excipient and a nucleic acid construct of the present disclosure.

[0022] In some embodiments, the composition is formulated into a delivery system with a delivery vehicle, wherein the delivery system comprises a liposome, a viral replicon particle (VRP), a lipid-based nanoparticle (LNP), a polymeric nanoparticle, a physiological buffer, a microsphere, an immune stimulating complex (ISCOM), a conjugate of a bioactive ligand, or any combination thereof. In some embodiments, the lipid is present in a lipid-to-RNA mass ratio of about 100:1 to about 4:1. In some embodiments, the lipid-based nanoparticle has an average diameter of about 25 nm to about 1000 nm. In some embodiments, the composition is formulated as a vaccine.

[0023] In another aspect, provided herein are methods for inducing an immune response or treating a condition in a subject in need thereof. The methods comprise administering to the subject a composition comprising a nucleic acid construct of the present disclosure. In some embodiments, the methods are methods for inducing an immune response. In some embodiments, the methods are methods for treating cancer. In some embodiments, the cancer is breast cancer. In some embodiments, the compositions are administered to the subject individually as a monotherapy (monotherapy) or as a first therapy in combination with at least one additional therapy. [Brief explanation of the drawings]

[0024] The features of the present disclosure are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present disclosure will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the present disclosure are utilized, and the accompanying drawings, in which:

[0025] [Figure 1] Figure 1 is a graphical representation of immunogenicity in mice used to optimize the design of mutant ESR1 antigen cassettes. The X-axis lists the ordinality of the ESR1 molecular modifications K303R, E380Q, Y537C, Y537S, Y537N, and D538G within the gene cassette and the use of linkers connecting these molecular modifications. The Y-axis shows the total T cell response using peptide-encoding ESR1 sequences in an ELISpot assay.

[0026] [Figures 2A-2G]Figures 2A-2G show protein expression from BHK21 cells transfected with mono-, di-, or tetra-gene srRNA constructs encoding ESR1, PI3K, HER2, and HER3 from a panel of constructs with various molecular configurations, as well as a comparison of these with the mono-gene constructs. The protein expression level of the mono-gene construct was determined as a value of "1," and the relative expression of each gene in the di- to tetra-gene constructs was compared to the protein expression level of the mono-gene construct. Figure 2A is an immunoblot for ESR1 protein expression. Figure 2B is a chart showing relative ESR1 expression based on the signal intensity of the immunoblot bands. Figure 2C is an immunoblot for PI3K protein expression. Figure 2D is a chart showing relative PI3K expression based on the signal intensity of the immunoblot bands. Figure 2E is a chart showing the relative expression of HER2 based on mean fluorescence intensity (MFI) quantified by fluorescence flow cytometry (FFC) after filtering with an Alexa Fluor® 488 (AF488)-labeled HER2-specific antibody. Figure 2F is a chart showing the relative expression of HER3 based on MFI quantified by FFC after filtering with an allophycocyanin (APC)-labeled HER3-specific antibody. Figure 2G is a spider chart summarizing the protein expression readouts of ESR1, PI3K, HER2, and HER3 in the panel of constructs.

[0027] [Figure 3] Figure 3 is a graphical representation of T cell responses in mice administered constructs with various molecular configurations. The X-axis shows different constructs, either monogenic, digenic, or tetragenic, with different sequences of ESR1, PI3K, HER2, and HER3. The Y-axis shows the total T cell response to sequences encoding peptides derived from ESR1 molecular modifications, HER2, and HER3 in an ELISpot assay. PI3K responses were not measured in this experiment because they do not generate responses in BALB / c mice.

[0028] [Figure 4]Figure 4 is a diagram of an exemplary neoantigen cassette. Peptides containing molecular modifications are separated by linkers to create one cassette.

[0029] [Figure 5] Figure 5 is a graphical representation of T cell responses in mice administered constructs carrying various srRNA vectors and formulated in two different lipid nanoparticles that differ in the cationic lipid content of either LNP1 ("L1") or LNP2 ("L2") in their composition.

[0030] [Figure 6] Figure 6 is a diagram illustrating two types of estrogen receptor-positive breast cancer efficacy studies (i.e., therapeutic and preventative) to model human disease.

[0031] The present disclosure generally relates to nucleic acid constructs expressing variants of ESR1, PI3K, HER2, and HER3 for both preventive and therapeutic treatment of human diseases, such as breast cancer. These constructs address problems associated with therapeutic approaches, such as cancer vaccines, because it is difficult to predict which antigens will be overexpressed in any particular cancer or whether an individual should be vaccinated, and if so, which antigens. Provided herein are gene expression systems with excellent expression potential suitable for expressing coding sequences for estrogen receptor 1 (ESR1) or variants thereof, PI3K or variants thereof, HER2 or variants thereof, and HER3 or variants thereof in recombinant cells. For example, some embodiments of the present disclosure relate to nucleic acid constructs, such as expression constructs and vectors containing a modified genome or srRNA of Eastern Equine Encephalitis Virus (EEEV), in which at least a portion of the nucleic acid sequence encoding the viral structural proteins of the modified EEEV genome or srRNA has been replaced with a coding sequence for a polypeptide construct comprising a coding sequence for estrogen receptor 1 (ESR1) or a mutant thereof, a coding sequence for PI3K or a mutant thereof, a coding sequence for HER2 or a mutant thereof, and a coding sequence for HER3 or a mutant thereof. Further provided are recombinant cells genetically engineered to contain one or more of the nucleic acid molecules disclosed herein. Biomaterials and recombinant products derived from such recombinant cells are also within the scope of the application. Compositions and methods useful for eliciting an immune response or treating cancer in a subject in need thereof are also provided.

[0032] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.

[0033] Various features of the disclosure may be described in the context of a single embodiment, and the features may also be provided separately or in any suitable combination. Conversely, although the disclosure may, for clarity, be described herein in the context of separate embodiments, the disclosure may also be practiced in a single embodiment. definition

[0034] Unless otherwise defined, all technical terms, notation, and other scientific or technical terms used herein are intended to have the meaning commonly understood by one of ordinary skill in the art to which this application pertains. In some cases, terms having a commonly understood meaning are defined herein for clarity and / or ready reference, and the inclusion of such definitions herein should not necessarily be construed as representing a substantial difference from what is commonly understood in the art. Many of the techniques and procedures described or referenced herein are well understood by those skilled in the art and are commonly employed using conventional methodology.

[0035] The singular forms "a," "an," and "the" include plural references unless the context clearly dictates otherwise. For example, the term "a cell" includes one or more cells, including mixtures thereof. "A and / or B" is used herein to include all alternatives of "A," "B," "A or B," and "A and B."

[0036] As used herein, the terms "administration" and "administering" refer to the delivery of a bioactive composition or formulation by a route of administration including, but not limited to, intranasal, transdermal, intravenous, intraarterial, intramuscular, intranodal, intraperitoneal, subcutaneous, intramuscular, oral, intravaginal, or topical administration, or a combination thereof. The term includes, but is not limited to, administration by a healthcare professional and self-administration.

[0037] The terms "cell," "cell culture," and "cell line" refer not only to a particular subject cell, cell culture, or cell line, but also to the progeny or potential progeny of that cell, cell culture, or cell line, regardless of the number of transplants or passages in culture. It is understood that not all progeny are exactly identical to the parent cell. This is because certain modifications may occur in later generations, either due to mutation (e.g., intentional or inadvertent mutation) or environmental influences (e.g., methylation or other epigenetic modifications), such that the progeny may not, in fact, be identical to the parent cell, but still be within the scope of the term as used herein, so long as the progeny retain the same functionality as the original cell, cell culture, or cell line.

[0038] The term "construct" refers to a recombinant molecule, e.g., a recombinant nucleic acid or polypeptide, that includes one or more nucleic acid or amino acid sequences from heterologous sources. For example, a polypeptide construct is a chimeric polypeptide molecule in which two or more amino acid sequences from different sources are operably linked to each other in a single polypeptide construct. Similarly, a nucleic acid construct can be a chimeric nucleic acid molecule in which two or more nucleic acid sequences from different sources are attached to a single nucleic acid molecule. Exemplary nucleic acid constructs can include any recombinant nucleic acid molecule, linear or circular, single- or double-stranded DNA or RNA nucleic acid molecule, and include nucleic acid molecules derived from any source capable of genomic integration or autonomous replication, e.g., plasmids, cosmids, viruses, autonomously replicating polynucleotide molecules, and phages, to which one or more nucleic acid sequences are operably linked. Two or more nucleic acid constructs can be contained within a single nucleic acid molecule, e.g., a single vector, or can be contained within two or more separate nucleic acid molecules, e.g., two or more separate vectors.

[0039] The terms "effective amount," "therapeutically effective amount," or "pharmaceutically effective amount" of a composition of the present disclosure, e.g., a nucleic acid construct, srRNA, recombinant cell, and / or pharmaceutical composition, generally refer to an amount sufficient for the composition to achieve a predetermined purpose compared to the absence of the composition (e.g., achieve the effect for which it is administered, stimulate an immune response, prevent or treat a disease, or alleviate one or more symptoms of a disease, disorder, infection, or condition). An example of an "effective amount" is an amount sufficient to contribute to the treatment, prevention, or alleviation of a symptom(s) of a disease, which may also be referred to as a "therapeutically effective amount." "Alleviation" of a symptom refers to a decrease in the severity or frequency of the symptom, or elimination of the symptom. The precise amount of a composition that comprises a "therapeutically effective amount" will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003, Gennaro, Ed., Lippincott, Williams & Wilkins).

[0040] The term "naked" as used herein refers to a nucleic acid that is substantially free of other macromolecules, such as, for example, lipids, polymers, and proteins. A "naked" nucleic acid, such as a self-replicating RNA, is not formulated with other macromolecules to improve cellular uptake. Thus, a naked nucleic acid is not encapsulated in, adsorbed to, or bound to a liposome, microparticle, nanoparticle, cationic emulsion, or the like.

[0041] As used herein, the term "operably linked" refers to a physical or functional connection between two or more elements, e.g., polypeptide sequences or polynucleotide sequences, so that they can function in their intended manner. For example, when used in the context of a nucleic acid molecule described herein, or a coding sequence and promoter sequence therein, the term "operably linked" means that the coding sequence and promoter sequence are in frame and at a suitable spacing and distance to allow the binding of each by a transcription factor or RNA polymerase for transcription. It should be understood that operably linked elements can be contiguous or non-contiguous (e.g., linked to each other via a linker). In the context of a polypeptide construct, "operably linked" refers to a physical connection (e.g., directly or indirectly linked) between amino acid sequences (e.g., different segments, portions, regions, or domains) that provides the described activity of the construct. The operably linked segments, portions, regions, and domains of the polypeptides or nucleic acid molecules disclosed herein can be contiguous or non-contiguous (e.g., linked to each other via a linker).

[0042] The term "portion" as used herein refers to a fraction. With respect to a particular structure, such as a polynucleotide sequence or an amino acid sequence or a protein, the term "portion" can refer to a continuous or discontinuous fraction of the structure. For example, a portion of an amino acid sequence comprises at least 1%, at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, and at least 90% of the amino acids of the amino acid sequence. Additionally or alternatively, when the portion is a discontinuous fraction, the discontinuous fraction may be composed of 2, 3, 4, 5, 6, 7, 8, or more portions of the structure (e.g., domains of a protein), each of which is a continuous element of the structure. For example, the non-contiguous fraction of an amino acid sequence may consist of 2, 3, 4, 5, 6, 7, 8 or more, e.g., up to 4 portions of said amino acid sequence, each portion comprising at least 1, at least 2, at least 3, at least 4, at least 5 consecutive amino acids, at least 10 consecutive amino acids, at least 20 consecutive amino acids, or at least 30 consecutive amino acids of the amino acid sequence.

[0043] Where a range of values ​​is provided, it is understood that each intervening value (to the tenth of the unit of the lower limit, unless the context clearly dictates otherwise) between the upper and lower limit of that range, and any other stated or intervening value in that stated range, is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure.

[0044] In this specification, certain ranges are presented using numerical values ​​preceded by the term "about." The term "about" is used to literally support the exact number preceded by the term, as well as a number that is close to or approximately the number preceded by the term. When determining whether a number is close to or approximately a specifically recited number, a number that is close to or approximately an unrecited number may be a number that, in the context in which it is presented, provides a substantial equivalent to the specifically recited number. If the degree of approximation is not clear from the context, "about" refers to within plus or minus 10% of the provided value, or rounded to the nearest significant figure, in all cases including the provided value. In some embodiments, the term "about" refers to the specified value ± up to 10%, ± up to 5%, or ± up to 1%.

[0045] The term "percent identity," as used herein in the context of two or more nucleic acids or proteins, refers to two or more sequences or subsequences having a specified percentage of nucleotides or amino acids that are identical or identical (e.g., about 60% sequence identity, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a particular region when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using the BLAST or BLAST 2.0 sequence comparison algorithm with default parameters, as described below, or by manual alignment and visual inspection. See, e.g., the NCBI website at ncbi.nlm.nih.gov / BLAST. Such sequences are said to be "substantially identical." This definition also refers to, or can apply to, sequence complements. This definition includes sequences that have deletions and / or additions, as well as sequences that have substitutions. Sequence identity can be calculated using published techniques and widely available computer programs, such as the GCS program package (Devereux et al., Nucleic Acids Res. 12:387, 1984), BLASTP, BLASTN, FASTA (Atschul et al., J Mol Biol 215:403, 1990). Sequence identity can be measured using sequence analysis software, such as the Sequence Analysis Software Package of the Genetics Computer Group at the University of Wisconsin Biotechnology Center (1710 University Avenue, Madison, Wis. 53705), using its specified parameters.

[0046] As used herein, the term "pharmaceutically acceptable excipient" refers to any suitable substance that provides a pharmaceutically acceptable carrier, additive, or diluent for administration of a compound(s) of interest to a subject. As such, "pharmaceutically acceptable excipient" can encompass substances referred to as pharmaceutically acceptable diluents, pharmaceutically acceptable additives, and pharmaceutically acceptable carriers. As used herein, the term "pharmaceutically acceptable carrier" includes, but is not limited to, saline, solvents, dispersions, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. Supplementary active compounds (e.g., antibiotics and additional therapeutic agents) can also be incorporated into the compositions.

[0047] As used herein, a "subject" or "individual" includes animals, such as humans (e.g., human individuals) and non-human animals. In some embodiments, a "subject" or "individual" is a patient under a physician's care. Thus, a subject can be a human patient or individual who has, is at risk of, or is suspected of having a health condition of interest (e.g., cancer) and / or one or more symptoms of a health condition. A subject can also be an individual who has been diagnosed as being at risk for a health condition of interest at the time of diagnosis or thereafter. The term "non-human animal" includes all vertebrates, e.g., mammals, e.g., rodents, e.g., mice, non-human primates, and other mammals, e.g., sheep, dogs, cows, chickens, and non-mammals, e.g., amphibians, reptiles, etc.

[0048] Aspects and embodiments of the present disclosure described herein are understood to include aspects and embodiments that "comprising," "consisting of," and "consisting essentially of." As used herein, "comprising" is synonymous with "including," "containing," or "characterized by" and is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. As used herein, "consisting of" excludes any unspecified element, step, or ingredient in a claimed composition or method. As used herein, "consisting essentially of" does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claimed composition or method. Any recitation of the term "comprising" herein, particularly in a description of a component of a composition or a description of a step of a method, is understood to encompass compositions and methods that consist essentially of, and consist of, the recited components or steps.

[0049] All genes, gene names, and gene products disclosed herein are intended to correspond to homologs from any species to which the compositions and methods disclosed herein are applicable. Thus, the term includes, but is not limited to, genes and gene products from humans and mice. Where a gene or gene product from a particular species is disclosed, it is understood that this disclosure is intended as exemplary only and is not to be construed as limiting unless the relevant context clearly indicates otherwise. Thus, for example, with respect to a gene or gene product disclosed herein, which in some embodiments refers to a mammalian nucleic acid and amino acid sequence, is intended to encompass homologous and / or orthologous genes and gene products from other animals, including, but not limited to, other mammals, fish, amphibians, reptiles, and birds. In some embodiments, the genes, nucleic acid sequences, amino acid sequences, peptides, polypeptides, and proteins are human. The term "gene" is also intended to encompass variants thereof.

[0050] It will be understood that certain features of the present disclosure, which are, for clarity, described in the context of separate embodiments, can also be provided in combination in a single embodiment. Conversely, various features of the present disclosure, which are, for brevity, described in the context of a single embodiment, can also be provided separately or in any suitable subcombination. All combinations of the embodiments relating to the present disclosure are specifically embraced by the present disclosure and are disclosed herein as if all combinations were individually and explicitly disclosed. In addition, all subcombinations of the various embodiments and elements thereof are also specifically embraced by the present disclosure and are disclosed herein as if each such subcombination was individually and explicitly disclosed herein. self-replicating RNA

[0051] As understood by those skilled in the art, the term "self-replicating RNA" refers to an RNA molecule that contains all the genetic information necessary to direct its own self-amplification or replication within a permissive cell. To direct its own replication, srRNA generally (1) encodes a polymerase, replicase, or other protein that can interact with viral or host cell-derived proteins, nucleic acids, or ribonucleoproteins to catalyze the RNA amplification process; and (2) contains cis-acting RNA sequences required for the replication and transcription of RNA encoded in the subgenomic replicon. These sequences can be bound to the self-encoded protein, or to a non-self-encoded cell-derived protein, nucleic acid, or ribonucleoprotein, or to a complex between any of these components during the replication process. In some embodiments of the present disclosure, alphavirus srRNA constructs generally contain the following elements: 5' viral or defective interfering RNA sequence(s) required in cis for replication, sequences encoding biologically active alphavirus nonstructural proteins (e.g., nsP1, nsP2, nsP3, and nsP4), a subgenomic promoter (sg) for the subgenomic RNA (sgRNA), 3' viral sequences required in cis for replication, and optionally a polyadenylation region (poly(A)). In these cases, the subgenomic promoter (sg) directing expression of the heterologous sequence can be included in the srRNA constructs of the present disclosure.

[0052] Furthermore, the term srRNA generally refers to a molecule of positive polarity or "message" sense, and the srRNA may be of a length different from that of any known naturally occurring alphavirus. In some embodiments of the present disclosure, the srRNA does not contain at least a portion of the coding sequence for one or more alphavirus structural proteins; and / or the sequence encoding the structural genes may be replaced with heterologous sequence. In those cases where the srRNA is packaged into recombinant alphavirus particles, it may contain one or more sequences, so-called packaging signals, that function to initiate interactions with alphavirus structural proteins leading to particle formation.

[0053] The srRNA constructs of the present disclosure generally have a length of at least about 2 kb. For example, the srRNA has a length of at least about 2 kb, at least about 3 kb, at least about 4 kb, at least about 5 kb, at least about 6 kb, at least about 7 kb, at least about 8 kb, at least about 9 kb, at least about 10 kb, at least about 11 kb, at least about 12 kb, or more than 12 kb. In some embodiments, the srRNA is about 4 kb to about 20 kb, about 4 kb to about 18 kb, about 5 kb to about 16 kb, about 6 kb to about 14 kb, about 7 kb to about 12 kb, about 8 kb to about 16 kb, about 9 kb to about 14 kb, about 10 kb to about 18 kb, about 11 kb to about 16 kb, about 5 kb to about 18 kb, about 6 kb to about 20 kb, about 5 kb to about 10 kb, about 5 kb to about 8 kb, about 5 kb to about 7 kb, or about 5 kb to about 6 kb. kb, about 6 kb to about 12 kb, about 6 kb to about 11 kb, about 6 kb to about 10 kb, about 6 kb to about 9 kb, about 6 kb to about 8 kb, about 6 kb to about 7 kb, about 7 kb to about 11 kb, about 7 kb to about 10 kb, about 7 kb to about 9 kb, about 7 kb to about 8 kb, about 8 kb to about 11 kb, about 8 kb to about 10 kb, about 8 kb to about 9 kb, about 9 kb to about 11 kb, about 9 kb to about 10 kb, or about 10 kb to about 11 kb. In some embodiments, the srRNA has a length of about 6 kb to about 14 kb. In some embodiments, the srRNA has a length of about 6 kb to about 16 kb. Eastern Equine Encephalitis Virus (EEEV)

[0054] Eastern equine encephalitis virus (EEEV) is a mosquito-borne virus belonging to the Alphavirus genus, a group of genetically, structurally, and serologically related viruses in the Togavirus family. Currently, the Alphavirus genus includes Sindbis virus (SINV), Semliki Forest virus (SFV), Ross River virus (RRV), Venezuelan equine encephalitis virus (VEEV), and Eastern equine encephalitis virus (EEEV), all of which are closely related and can infect a variety of vertebrates, including mammals, rodents, fish, and birds, as well as large mammals such as humans and horses, and invertebrates such as insects. EEEV, in particular, has been extensively studied, and its life cycle and replication patterns have been well characterized. Further information on this topic can be found, for example, in Corrin T. et al., Vector-Borne and Zoonotic Diseases, Vol. 21, No. 5, 2021. Additionally, alphaviruses have been shown to replicate very efficiently in animal cells, making them useful as vectors for the production of proteins and nucleic acids in such cells. Transmission between species and individuals occurs primarily via mosquitoes, contributing alphaviruses to the collection of arboviruses, or arthropod-borne viruses.

[0055] Each of these alphaviruses has a single-stranded RNA genome of positive polarity enclosed in an enveloped nucleocapsid containing viral spike proteins. Alphavirus particles are enveloped and tend to be spherical (although slightly polymorphic) with an isometric nucleocapsid. The alphavirus genome is a single-stranded RNA of positive polarity approximately 11-12 kb in length, with two open reading frames: a 5' cap, a 3' polyA tail, and two open reading frames, one encoding a nonstructural protein with enzymatic function, and the second encoding viral structural proteins (e.g., capsid protein CP, E1 glycoprotein, E2 glycoprotein, E3 protein, and 6K protein). For example, EEEV has a single-stranded, positive-sense RNA of approximately 11.7 kb that is capped at the 5' end and polyadenylated at the 3' end. EEEV is transmitted by the bite of infected mosquitoes, and most transmission occurs in low-lying areas with hardwood trees and wetlands where mosquito larvae infest. As its name suggests, EEEV can infect horses and cause fever, behavioral changes, and other symptoms of encephalitis. Wild birds are the primary reservoir of EEEV. However, infection is often fatal to horses.

[0056] The 5' two-thirds of the alphavirus genome encodes numerous nonstructural proteins required for viral RNA transcription and replication. These proteins are translated directly from RNA and, together with cellular proteins, form the RNA-dependent RNA polymerase, essential for viral genome replication and transcription of subgenomic RNA. Four nonstructural proteins (nsP1-4) are produced as a single polyprotein and constitute the viral replication machinery. Polyprotein processing is highly regulated, and cleavage at the P2 / 3 junction affects the use of RNA templates during genome replication. This site is located at the bottom of a narrow cavity and is not easily accessible. Upon cleavage, nsP3 creates a ring structure surrounding nsP2. These two proteins have an extensive interface. Mutations in nsP2 that produce noncytopathic viruses or temperature-sensitive phenotypes cluster at the P2 / P3 interface region. P3 mutations opposite the location of nsP2 noncytopathic mutations prevent efficient cleavage of P2 / 3. This may affect RNA infectivity and alter viral RNA production levels.

[0057] The 3' third of the genome contains a subgenomic RNA that serves as a template for translation of all structural proteins required for viral particle formation: the core nucleocapsid protein C, and the envelope proteins P62 and E1, which assemble as a heterodimer. The viral membrane-anchored surface glycoproteins are involved in receptor recognition and membrane fusion for entry into target cells. The subgenomic RNA is transcribed from the p26S subgenomic promoter located at the 3' end of the RNA sequence encoding the nsP4 protein. Proteolytic maturation of P62 into E2 and E3 leads to changes in the viral surface. E1, E2, and sometimes E3 glycoprotein "spikes" together form E1 / E2 dimers or E1 / E2 / E3 trimers, with E2 extending from the center to the apex, E1 filling the apex space, and E3, if present, at the head of the spike. When the virus is exposed to the acidity of the endosome, E1 dissociates from E2 to form an E1 homotrimer. This is necessary for the fusion step to drive the cellular and viral membranes together. The alphavirus glycoprotein E1 is a class II viral fusion protein, structurally distinct from the class I fusion proteins found in influenza virus and HIV. The E2 glycoprotein functions to interact with the nucleocapsid through its cytoplasmic domain, while its ectodomain is responsible for binding to cellular receptors. Most alphaviruses lose the peripheral protein E3, but in Semliki virus it remains associated with the viral surface.

[0058] Alphavirus replication has been reported to occur on membranous surfaces within host cells. In the first step of the infectious cycle, the 5' end of the genomic RNA is translated into a polyprotein (nsP1-4) with RNA polymerase activity, which generates a negative strand complementary to the genomic RNA. In the second step, the negative strand is used as a template to produce two RNAs: (1) a positive genomic RNA corresponding to the genome of a secondary virus, which then translates to produce other nsP proteins and acts as the viral genome; and (2) a subgenomic RNA encoding the viral structural proteins that form the infectious particle. The positive genomic RNA / subgenomic RNA ratio is regulated by proteolytic autocleavage of the polyprotein into nsP1, nsP2, nsP3, and nsP4. In reality, viral gene expression occurs in two stages. The first stage is primarily the synthesis of the positive and negative genomic strands. In the second stage, synthesis of the subgenomic RNA is virtually exclusive, resulting in the production of large amounts of structural proteins. Estrogen receptor 1 (ESR1)

[0059] Estrogens are steroid hormones that function as the primary female hormone. Estrogen receptor 1 (ESR1) encodes estrogen receptor α (ERα), and estrogen receptor 2 (ESR2) encodes estrogen receptor β (ERβ). The biological effects of estrogen are largely mediated by its binding to and activation of ERα and ERβ (members of the nuclear receptor superfamily of transcription factors characterized by highly conserved DNA- and ligand-binding domains). Previous studies suggest that estrogen is involved in breast tumorigenesis, ovarian, and endometrial carcinogenesis. Approximately 70% of all breast cancers are classified as estrogen receptor-positive (ER+) and depend on constitutive estrogen receptor signaling. Various classes of endocrine (anti-estrogen) therapies (including selective estrogen receptor modulators (SERMS), down-regulators, and aromatase inhibitors (AIs)) are effective adjuvant treatments for these cancers, but approximately 50% of women ultimately relapse and die from metastatic ER+ disease. Thus, despite the advent of newer treatments (e.g., AIs), the recurrence rate in ER+ breast cancer remains high, especially in cases where metastasis has occurred. Significantly, all patients who develop metastatic ER+ disease progress to endocrine therapy-refractory disease. At this stage, no therapy exists for ER+ breast cancer. Human epidermal growth factor 2 (HER2)

[0060] The human epidermal growth factor receptor (HER) family, consisting of HER1 (also known as EGFR), HER2, HER3, and HER4, drives the progression of many epithelial malignancies (Roskoski R., Jr. The ErbB / HER family of protein-tyrosine kinases and cancer. Pharmacol Res 2014;79:34-74). HER2, also known as Erb-B2 (erythroblastic oncogene B homolog 2), CD340, or p185, is a 185-kD oncoprotein encoded by the ERBB2 gene. It consists of three domains, including an intracellular domain with tyrosine kinase properties, a transmembrane domain, and an extracellular domain. HER2 is the preferred dimerization partner for other HER proteins, such as HER3, with which it heterodimerizes. Dimerization with HER2 leads to autophosphorylation of tyrosine residues within the cytoplasmic domain of the receptor, initiating various signaling pathways. HER2 has tumor-promoting functions in several cancers, and HER2 amplification or overexpression is associated with enhanced disease recurrence and poor prognosis. Treatment of HER2-amplified breast cancer with HER2-targeted tyrosine kinase inhibitors (TKIs) leads to increased HER3 expression and downstream signaling, resulting in treatment resistance. Human epidermal growth factor 3 (HER3)

[0061] Overexpression of HER3 in cancers of the breast, lung, stomach, head and neck, ovary, and melanoma is associated with poor prognosis (Takikita M et al., Membranous expression of Her3 is associated with a decreased survival in head and neck squamous cell carcinoma. J Transl Med 2011; 9:126; Chiu et al., HER-3 overexpression is prognostic of reduced breast cancer survival: A study of 4046 patients. Ann Surg 2010; 251(6):1107-16; Hayashi et al., High expression of HER3 is associated with a decreased survival in gastric cancer. Clin Cancer Res 2008; 14(23):7843-9; Giltnane et al., Quantitative multiplexed analysis of ErbB family coexpression for primary breast cancer prognosis in a large retrospective cohort. Cancer 2009; Begnami et al., Prognostic implications of altered human epidermal growth factor receptors (HERs) in gastric carcinomas: HER2 and HER3 are predictors of poor outcome. J Clin Oncol 2011; 29(22):3030-6; Reschke et al., HER3 is a determinant for poor prognosis in melanoma, Clin Cancer Res2 008; 14(16):5188-97; Lee et al., Assessment of Her-1, Her-2, and Her-3 expression and Her-2 amplification in advanced-stage ovarian carcinoma. Int J Gynecol Pathol 2005), but because it lacks catalytic kinase activity and is not transforming by itself, it is not a proven therapeutic target. However, HER3 is thought to function as a signaling substrate for other HER proteins with which it heterodimerizes (Musgrove et al., Biological determinants of endocrine resistance in breast cancer. Nat Rev Cancer 2009; 9(9):631-43; Tovey et al., Can molecular markers predict when to implement treatment with aromatase inhibitors in invasive breast cancer? Clin Cancer Res 2005; 11(13):4835-42). PIK3CA

[0062] Pathological activation of the PI3K pathway is common to the most frequent signaling events associated with cellular transformation, cancer, and metastasis (Cancer Genome Atlas Network. Comprehensive molecular portraits of human breast tumors. Nature 2012; Mollon L, Aguilar A, Anderson E, et al. A systematic literature review of the prevalence of PIK3CA mutations and mutation hotspots in HR+ / HER2-metastatic breast cancer. Cancer Res 2018; 78: Suppl 13:1207-1207. Abstract; Goncalves MD, Hopkins BD, Cantley LC. Phosphatidyl inositol 3-kinase, growth disorders, and cancer. N Engl J Med 2018; 379: 2052-2062). This is exemplified by frequent activating mutations in PIK3CA and loss of PTEN functionality in common cancers such as breast, colon, and ovarian cancer. Approximately 40% of patients with HR-positive, HER2-negative breast cancer have activating mutations in the gene PIK3CA, including hyperactivation of the α isoform (p110α) of phosphatidylinositol 3-kinase (PI3K). Compositions of the present disclosure

[0063] As described in more detail below, one aspect of the present disclosure relates to nucleic acid constructs containing a sequence encoding a modified genome or srRNA of the alphavirus Eastern Equine Encephalitis Virus (EEEV), wherein at least a portion of the nucleic acid sequence encoding the viral structural proteins of the modified EEEV genome or srRNA has been replaced with a coding sequence for a polypeptide construct comprising: a) a coding sequence for estrogen receptor 1 (ESR1) or a mutant thereof; b) a coding sequence for PI3K or a mutant thereof; c) a coding sequence for HER2 or a mutant thereof; and d) a coding sequence for HER3 or a mutant thereof. Also provided are recombinant cells and cell cultures genetically engineered to contain the nucleic acid constructs disclosed herein. nucleic acid construct

[0064] As described in more detail below, one aspect of the present disclosure relates to a nucleic acid construct comprising a nucleic acid sequence encoding a modified genome or srRNA of Eastern Equine Encephalitis Virus (EEEV), wherein at least a portion of the nucleic acid sequence encoding a viral structural protein of the modified EEEV genome or srRNA has been replaced with a coding sequence for a polypeptide construct comprising: a) a coding sequence for ESR1 or a mutant thereof; b) a coding sequence for PI3K or a mutant thereof; c) a coding sequence for HER2 or a mutant thereof; and d) a coding sequence for HER3 or a mutant thereof. Recombinant cells and cell cultures genetically engineered to contain the nucleic acid constructs disclosed herein are also provided. In some embodiments, the coding sequence of the nucleic acid construct can be operably linked, e.g., placed under the control of elements required for expression (e.g., promoter sequences), which allow expression of the srRNA construct in a host cell, or a subject, or an ex vivo cell-free expression system.

[0065] The terms "nucleic acid molecule" and "polynucleotide" are used interchangeably herein and refer to both RNA and DNA molecules, including RNA molecules, including cDNA, genomic DNA, synthetic DNA, and DNA, or nucleic acid analogs. Nucleic acid molecules can be double-stranded or single-stranded (e.g., sense or antisense strands). Nucleic acid molecules may contain unconventional or modified nucleotides. The terms "polynucleotide sequence" and "nucleic acid sequence," as used herein, interchangeably refer to the sequence of a polynucleotide molecule. The nomenclature for nucleotide bases defined in 37 CFR §1.822 is used herein.

[0066] Nucleic acid molecules of the present disclosure can be of any length, including, for example, about 1.5 Kb to about 50 Kb, about 5 Kb to about 40 Kb, about 5 Kb to about 30 Kb, about 5 Kb to about 20 Kb, or about 10 Kb to about 50 Kb, e.g., about 15 Kb to 30 Kb, about 20 Kb to about 50 Kb, about 20 Kb to about 40 Kb, about 5 Kb to about 25 Kb, or about 30 Kb to about 50 Kb.

[0067] Non-limiting exemplary embodiments of nucleic acid constructs of the present disclosure may include one or more of the following features: In some embodiments, the nucleic acid construct comprises a nucleic acid sequence encoding a modified EEEV genome or srRNA, wherein the modified EEEV genome or srRNA lacks at least a portion of the nucleic acid sequence encoding one or more structural proteins of the unmodified EEEV genome or srRNA, e.g., the modified EEEV genome or srRNA does not include at least a portion of the coding sequence for one or more EEEV structural proteins, CP, E1, E2, E3, and 6K. Both pathogenic and non-pathogenic EEEV strains are suitable. Non-limiting examples of EEEV strains suitable for the compositions and methods of the present disclosure include EEEV792138, 783372, BeAn5122, BeAr300851, BeAr436087, C-49, FL91-4679, FL93-939, GML903836, MP-9, PE6, and V105-00210. Additional suitable EEEV strains include, but are not limited to, those listed on the Virus Pathogen Resource website (ViPR; publicly available at www.viprbrc.org / brc / vipr_genome_search.spg?method=SubmitForm&blockId=868&decorator=toga). In some embodiments, the modified EEEV genome or srRNA is derived from EEEV strain FL93-939.

[0068] Non-limiting exemplary embodiments of nucleic acid constructs of the present disclosure can include one or more of the following features: In some embodiments, the modified EEEV genome or srRNA lacks at least a portion of the nucleic acid sequence encoding one or more viral structural proteins CP, E1, E2, E3, and 6K of the unmodified EEEV genome or srRNA. In some embodiments, the modified EEEV genome or srRNA lacks some or all of the sequence encoding CP. In some embodiments, the modified EEEV genome or srRNA lacks some or all of the sequence encoding E1. In some embodiments, the modified EEEV genome or srRNA lacks some or all of the sequence encoding E2. In some embodiments, the modified EEEV genome or srRNA lacks some or all of the sequence encoding E3. In some embodiments, the modified EEEV genome or srRNA lacks some or all of the sequence encoding 6K. In some embodiments, the modified EEEV genome or srRNA lacks some or all of the sequence encoding a combination of CP, E1, E2, E3, and 6K. Some embodiments of the present disclosure provide modified EEEV genomes or srRNAs in which the coding sequences for the nonstructural proteins nsP1, nsP2, nsP3, and nsP4 of the unmodified EEEV genome or srRNA are present, but at least a portion or all of the sequences encoding one or more structural proteins (e.g., CP, E1, E2, E3, and 6K) of the EEEV genome or srRNA are absent. Some embodiments of the present disclosure provide modified EEEV genomes or srRNAs in which the coding sequences for the nonstructural proteins nsP1, nsP2, nsP3, and nsP4 of the unmodified EEEV genome or srRNA are present, but at least a portion or all of the sequences encoding one or more structural proteins (e.g., CP, E1, E2, E3, and 6K) of the EEEV genome or srRNA are absent.

[0069] In some embodiments, the modified viral genome or srRNA lacks a substantial portion of the nucleic acid sequence encoding one or more viral structural proteins. Those skilled in the art will understand that a substantial portion of a nucleic acid sequence encoding a viral structural polypeptide can include sufficient viral structural polypeptide-encoding nucleic acid sequence to allow for putative identification of the polypeptide, either by manual evaluation of the sequence by one skilled in the art or by computer-automated sequence comparison and identification using algorithms such as BLAST (see, e.g., "Basic Local Alignment Search Tool"; Altschul SF et al., J. Mol. Biol. 215:403-410, 1993). Thus, a substantial portion of a nucleotide sequence includes sufficient sequence to allow for specific identification and / or isolation of a nucleic acid fragment comprising the sequence. For example, a substantial portion of a nucleic acid sequence can include at least about 20%, e.g., about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or about 95% of the full-length nucleic acid sequence. As noted above, the present disclosure provides nucleic acid molecules and constructs lacking partial or complete nucleic acid sequences encoding one or more viral structural proteins. Those skilled in the art, having the benefit of the sequences disclosed herein, can readily use all or a substantial portion of the disclosed sequences in the compositions and methods of the present disclosure. Accordingly, the present application includes the complete sequences disclosed herein, e.g., those set forth in the accompanying sequence listing, as well as substantial portions of those sequences as defined above.

[0070] In some embodiments, the modified EEEV genome or srRNA lacks the entire sequence encoding the viral structural proteins, e.g., the modified EEEV genome or srRNA does not include the nucleic acid sequences encoding the structural proteins of the viral unmodified genome or srRNA.

[0071] The nucleic acid constructs of the present disclosure further include coding sequences for polypeptide constructs that replace at least a portion of the nucleic acid sequence encoding the viral structural proteins or srRNA of the modified EEEV genome. In principle, the nucleic acid constructs disclosed herein generally include coding sequences for any number of polypeptide constructs. In some embodiments, the nucleic acid constructs disclosed herein can include coding sequences for at least one, at least two, at least three, at least four, at least five, or at least six polypeptide constructs. A coding sequence for a polypeptide construct refers to a construct of genetic material that includes a coding sequence and sufficient regulatory information to direct the proper transcription and / or translation of the coding sequence in a cell in vivo and / or ex vivo. The coding sequence for a polypeptide construct can be inserted into a vector and / or target to a desired host cell. Thus, in some embodiments, the term "coding sequence for a polypeptide construct" can be used interchangeably with the term "expression construct." In some embodiments, the coding sequence of a polypeptide construct may be a nucleic acid construct comprising either or a combination of a gene encoding a protein or functional RNA, operably linked to regulatory elements such as, for example, a promoter and / or a termination signal, and optionally other nucleic acid sequences that affect the transcription or translation of the gene.

[0072] The nucleic acid constructs described herein include coding sequences for ESR1 or its variants, PI3K or its variants, HER2 or its variants, and HER3 or its variants, which encode polypeptides containing epitopes capable of eliciting an immune response. ESR1, PI3K, HER2, and HER3 variants may each include coding sequences for polypeptides having the same or essentially the same amino acid sequence as a reference protein (e.g., ESR1, PI3K, HER2, or HER3), except for at least one amino acid modification, e.g., deletion, insertion, or substitution. Amino acid substitutions may be conservative, preferably at non-essential amino acid residues within the protein. A "conservative amino acid substitution" is one in which an amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues with similar side chains are known in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). A variant of a protein may have an amino acid sequence that is at least about 80%, 90%, 95%, or 99%, preferably at least about 90%, more preferably at least about 95%, identical to the amino acid sequence of the protein. Preferably, the variant is a functional variant of the protein that retains the same function as the protein. The term "variant" when used in reference to a nucleic acid sequence refers to a nucleic acid sequence that differs from another, usually related, nucleotide sequence by one or more nucleotides.Thus, the term "variant" can refer to a change in one or more nucleotides of a reference nucleic acid, including the insertion of one or more new nucleotides, the deletion of one or more nucleotides, and the substitution of one or more existing nucleotides. Variants can also include point mutations, multiple mutations, single nucleotide polymorphisms (SNPs), deletions, insertions, and translocations. Thus, variants of the coding sequences described herein include, for example, nucleic acids encoding polypeptides that can be full-length, mutated, truncated, inactive, peptide / epitope, or combinations thereof, of ESR1, PI3K, HER2, and / or HER3.

[0073] The full-length amino acid sequence of ESR1 is set forth in SEQ ID NO:1 as follows: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAFGSNGLGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPA FYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLM IKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMMLLATSSRFRMMNLQGEEFV CLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGPATV

[0074] In some embodiments, the coding sequence for ESR1 in the nucleic acid constructs described herein encodes the amino acid sequence of SEQ ID NO: 1. In some embodiments, the nucleic acid constructs of the present disclosure comprise a nucleic acid sequence encoding ESR1 having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 1. In some embodiments, the coding sequence for ESR1 encodes smaller portions of the amino acid sequence of SEQ ID NO: 1. These smaller portions can comprise at least 8, 10, 12, 14, 16, 18, 20, 30, or more amino acids of SEQ ID NO: 1. Exemplary portions of ESR1 useful in the constructs disclosed herein include those in Table 1 below: Table 1 [Table 1]

[0075] In some embodiments, a nucleic acid construct of the present disclosure comprises a nucleic acid sequence encoding a portion of ESR1 having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NOs: 11-16.

[0076] In some embodiments, the coding sequences of the nucleic acid polypeptide constructs described herein comprise one or more molecular modifications. Exemplary types of molecular modifications of the coding sequences described herein can be one or more deletions, substitutions, insertions, duplications, mutations, frameshift mutations, splice mutations, or combinations thereof.

[0077] In some embodiments, one or more molecular modifications are organized into multiple modification cassettes. In some embodiments, multiple modification cassettes are arranged in tandem along the length of the coding sequence. In some embodiments, the length and amino acid composition of the modification cassettes can be optimized to achieve a desired activity or property of the coding sequence or its variants. In some embodiments, one modification cassette of the multiple modification cassettes contains about 2 to about 50 amino acid residues, for example, about 5 to about 45, about 10 to about 40, about 15 to about 30, about 20 to about 50, about 2 to about 30, about 3 to about 25, about 4 to about 20, about 5 to about 15, about 6 to about 10, about 3 to about 15, about 4 to about 10, about 5 to about 30, about 2 to about 5, about 3 to about 5, or about 4 to about 8 amino acid residues. In some embodiments, one modification cassette of the multiple modification cassettes contains 31 amino acid residues. In some embodiments, one modification cassette of the plurality of modification cassettes comprises 1, 2, 3, 4, 5 or more molecular modifications.

[0078] In some embodiments, the ESR1 variants described herein comprise one or more molecular modifications that promote ligand-independent receptor activity. These variants are activating mutations in the ligand-binding domain of ESR1 that render the estrogen receptor insensitive to hormone therapy. In some embodiments, the one or more molecular modifications comprise an activating mutation selected from the group consisting of K303R, E380Q, Y537C, Y537S, Y537N, and D538G at a position corresponding to the amino acid sequence of SEQ ID NO: 1.

[0079] In some embodiments, one or more molecular modifications are operably linked to each other by a linker. The linker is a peptide linker, which links two adjacent modification cassettes together as described herein. In some embodiments, the length and amino acid composition of the peptide linker sequence can be optimized to alter the orientation, flexibility, and / or proximity of the modification cassettes relative to each other to achieve a desired activity or property of ESR1 or an ESR1 variant.

[0080] In some embodiments, the polypeptide linker comprises a single polypeptide chain sequence comprising about 1 to about 30 amino acid residues (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or so amino acid residues). In some embodiments, the linker sequence comprises about 2 to 30, about 3 to 25, about 4 to 20, about 5 to 15, about 6 to 10, about 3 to 15, about 4 to 10, about 5 to 30, about 2 to 5, about 3 to 5, or about 4 to 8 amino acid residues.

[0081] In some embodiments, the length and amino acid composition of the linker peptide sequence can be optimized to alter the orientation, flexibility, and / or proximity of the modification cassettes relative to one another to achieve a desired activity or property of the encoded polypeptide. In some embodiments, the orientation, flexibility, and / or proximity of the modification cassettes relative to one another can be altered as a "tuning" tool to achieve tuning effects that will enhance or decrease the activity of the encoded polypeptide or encoded polypeptide variant. In certain embodiments, the linker contains only glycine and / or serine residues (e.g., a serine-glycine linker). Examples of such polypeptide linkers include Gly, Ser; Gly Ser; Gly Gly Ser; Ser Gly Gly; Gly Gly Gly Ser; Ser Gly Gly Gly; Gly Gly Gly Gly Ser; Ser Gly Gly Gly Gly; Gly Gly Gly Gly Gly Gly Ser; Ser Gly Gly Gly Gly Gly; Gly Gly Gly Gly Gly Gly Gly; (Gly Gly Gly Gly Ser)n, where n is one or more integers; and (Ser Gly Gly Gly Gly)n, where n is one or more integers. In some embodiments, the polypeptide linker is modified so that the amino acid sequence Gly Ser Gly (GSG), which occurs at the junction of traditional Gly / Ser linker polypeptide repeats, is absent. In some embodiments, the peptide linker includes an amino acid sequence selected from the group consisting of SEQ ID NOs: 25-29.

[0082] In some embodiments, the coding sequence of a polypeptide construct of a nucleic acid construct described herein encodes a variant of ESR1 comprising a portion of the ESR1 amino acid sequence operably linked with a GGGGS linker (underlined). Exemplary amino acid sequences include the amino acid sequence of SEQ ID NO:2, as follows: MEHLYSMKCKNVVPLCDLLLEMLDAHRLHAP GGGGS PGFVDLTLHDQVHLLQCAWLEILMIGLVWRS GGGGS AANLWPSPLMIKRSKRNSLALSLTADQMVSA GGGGS MEHLYSMKCKNVVPLSDLLLEMLDAHRLHAP GGGGS MEHLYSMKCKNVVPLYGLLLEMLDAHRLHAP GGGGS MEHLYSMKCKNVVPLNDLLLEMLDAHRLHAP GGGGS An exemplary illustration of this type of configuration is shown in FIG.

[0083] In some embodiments, the nucleic acid construct of the present disclosure includes a nucleic acid sequence encoding ESR1 that has at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:2.

[0084] As noted above, the nucleic acid constructs described herein also include a coding sequence for PI3K or a variant thereof.

[0085] The full-length amino acid sequence of PI3K is set forth in SEQ ID NO:3:

[0086] In some embodiments, the coding sequence for PI3K in the nucleic acid constructs described herein encodes the amino acid sequence of SEQ ID NO: 3. In some embodiments, the nucleic acid constructs of the present disclosure include a nucleic acid sequence encoding PI3K that has at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 3. In some embodiments, the coding sequence for PI3K encodes smaller portions of the amino acid sequence of SEQ ID NO: 3. These smaller portions can include at least 8, 10, 12, 14, 16, 18, 20, or more amino acids of SEQ ID NO: 3. Exemplary portions of ESR1 useful in the constructs disclosed herein include those in Table 2 below: Table 2 [Table 2]

[0087] In some embodiments, the nucleic acid construct of the present disclosure comprises a nucleic acid sequence encoding a portion of PI3K having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NOs: 17-20.

[0088] In some embodiments, the coding sequence of the polypeptide construct in the nucleic acid described herein encodes a PI3K mutant comprising one or more molecular modifications that promote ligand-independent receptor activity. These mutants are activating mutations in the ligand-binding domain of PI3K. In some embodiments, the one or more molecular modifications comprise an activating mutation selected from the group consisting of E542K, E545K, H1047L, and H1047R of the amino acid sequence of SEQ ID NO: 3.

[0089] In some embodiments, one or more molecular modifications are operably linked to one another by a linker. Linkers suitable for use in the polypeptide constructs described herein are described above. In some embodiments, the peptide linker comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 25-29.

[0090] In some embodiments, the coding sequence of a polypeptide construct of a nucleic acid construct described herein encodes a variant of PI3K comprising a portion of the amino acid sequence of PI3K operably linked by a GGGGS linker (underlined). Exemplary amino acid sequences include the amino acid sequence of SEQ ID NO:4, as follows: MDKEQLKAISTRDPLSKITEQEKDFLWSHRHY GGGGS EQEALEYFMKQMNDALHGGWTTKMDWIFHTIK GGGGS QLKAISTRDPLSEITKQEKDFLWSHRHYCVT GGGGS EQEALEYFMKQMNDARHGGWTTKMDWIFHTIK GGGGS

[0091] In some embodiments, the nucleic acid construct of the present disclosure includes a nucleic acid sequence encoding a PI3K having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:4.

[0092] As noted above, the nucleic acid constructs described herein also include a coding sequence for HER2 or a variant thereof.

[0093] In some embodiments, the coding sequence of the polypeptide construct in the nucleic acid described herein encodes a truncated HER2 mutant comprising the extracellular and transmembrane domains of HER2 as described in Crosby et al., “Vaccine-Induced Memory CD8+ T Cells Provide Clinical Benefit in HER2-Expressing Breast Cancer: A Mouse to Human Translational Study,” Clinical Cancer Research 25(9):2725-2736 (2019).

[0094] In some embodiments, the truncated HER2 variant comprises the amino acid sequence of SEQ ID NO:5: MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTI LWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKC SKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPE DECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCTHSPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK

[0095] In some embodiments, the nucleic acid construct of the present disclosure includes a nucleic acid sequence encoding a HER2 variant having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:5.

[0096] As noted above, the nucleic acid constructs described herein also include a coding sequence for HER3 or a variant thereof.

[0097] In some embodiments, the coding sequence of the polypeptide construct in the nucleic acid described herein encodes a kinase-inactive HER3 mutant described in Osada et al., "Vaccination Targeting Human HER3 Alters the Phenotype of Infiltrating T Cells and Responses to Immune Checkpoint Inhibition," Oncoimmunology 6(6):e1315495 (2017).

[0098] In some embodiments, the kinase-inactive HER3 mutant comprises the amino acid sequence of SEQ ID NO:6:

[0099] In some embodiments, the nucleic acid construct of the present disclosure includes a nucleic acid sequence encoding a HER3 variant having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:6.

[0100] In some embodiments, the coding sequences of ESR1 or a variant thereof, PI3K or a variant thereof, HER2 or a variant thereof, and HER3 or a variant thereof comprise the coding sequence of a single peptide (e.g., a monogene construct). In some embodiments, the coding sequences of ESR1 or a variant thereof, PI3K or a variant thereof, HER2 or a variant thereof, and HER3 or a variant thereof comprise the coding sequence of multiple polypeptides, e.g., a polygene (e.g., a bigene or trigene). In some embodiments, each of the coding sequences of ESR1 or a variant thereof, PI3K or a variant thereof, HER2 or a variant thereof, and HER3 or a variant thereof is operably linked to a separate promoter sequence. In some embodiments, the coding sequences of ESR1 or a variant thereof, PI3K or a variant thereof, HER2 or a variant thereof, and HER3 or a variant thereof are operably linked to each other in a single open reading frame (e.g., within a polycistronic ORF). In some embodiments, the coding sequences of a polycistronic ORF are operably linked to a promoter sequence. In some embodiments, at least one of the promoter sequences is a subgenomic (sg) promoter. In some embodiments, the sg promoter is a 26S genomic promoter.

[0101] In some embodiments, the coding sequences for ESR1 or a variant thereof, PI3K or a variant thereof, HER2 or a variant thereof, and HER3 or a variant thereof can be directly or indirectly linked to each other (e.g., via one or more connector sequences). For example, in some embodiments, the coding sequences can be directly linked to each other, e.g., adjacent to each other. In some embodiments, at least two of the coding sequences (e.g., 2, 3, 4, or 5) are operably linked to each other by one or more connector sequences. In some embodiments, the length and amino acid composition of the connector sequences can be optimized to alter the orientation, flexibility, and / or proximity of the polypeptides relative to each other to achieve a desired activity or property of the encoded proteins. In some embodiments, one connector sequence of the multiple connector sequences comprises one or more coding sequences for autoproteolytic peptide sequences. Generally, any proteolytic cleavage site known in the art can be incorporated into the nucleic acid molecules of the present disclosure and can be, for example, a proteolytic cleavage sequence that is cleaved after production by a protease. Additional suitable proteolytic cleavage sites also include proteolytic cleavage sequences that are cleavable after the addition of an external protease. As used herein, the term "autoproteolytic peptide" refers to a "self-cleaving" peptide that has autoproteolytic activity and can cleave itself from a larger polypeptide moiety. Initially identified in the picornavirus family member foot-and-mouth disease virus (FMDV), several autoproteolytic peptides (e.g., "2A-like" peptides from equine rhinitis A virus (E2A), porcine teschovirus-1 (P2A), and Zosea asigna virus (T2A)) have subsequently been identified, and their proteolytic activity has been demonstrated in various ex vitro, in vitro, ex vivo, and in vivo eukaryotic cell systems. Thus, the concept of an autoproteolytic peptide is accessible to those skilled in the art, and many naturally occurring autoprotease systems have been identified.Well-studied autoprotease systems include, for example, viral proteases, developmental proteins (e.g., HetR, Hedgehog proteins), RumA autoprotease domain, UmuD, etc. Non-limiting examples of autoproteolytic peptides suitable for the compositions and methods of the present disclosure include one or more autoproteolytic cleavage sequences from calcium-dependent serine endoprotease (furin), porcine teschovirus-1 2A (P2A), foot-and-mouth disease virus (FMDV) 2A (F2A), equine rhinitis A virus (ERAV) 2A (E2A), zosea asignavirus 2A (T2A), cytoplasmic polyhedrosis virus 2A (BmCPV2A), flacherie virus 2A (BmIFV2A), or combinations thereof.

[0102] In some embodiments, the coding sequences of ESR1 or a mutant thereof, PI3K or a mutant thereof, HER2 or a mutant thereof, and HER3 or a mutant thereof are operably linked to each other by one or more internal ribosome entry site (IRES) coding sequences. An IRES or "internal ribosome entry site" is a sequence located between polycistronic genes that allows for the production of an expression product from a second gene by internal initiation of translation of a dicistronic mRNA. It promotes direct internal ribosome entry to the initiation codon, such as ATG, of a cistron (protein-coding region), resulting in cap-independent translation of the gene. See, e.g., Jackson et al., 1990. Trends Biochem Sci 15(12):477-83 and Jackson and Kaminski, 1995. RNA 1(10):985-1000. In some embodiments, the IRES can be a viral IRES, a cellular IRES, or an artificial IRES. Examples of IRES commonly used by those skilled in the art include those described in U.S. Patent No. 6,692,736. In some embodiments, the IRES is selected from Kaposi's sarcoma-associated herpesvirus (KSHV) IRES, hepatitis virus IRES, pestivirus IRES, cryopreservative virus IRES, rhopharynx paucivirus IRES, fibroblast growth factor IRES, platelet-derived growth factor IRES, vascular endothelial growth factor IRES, insulin-like growth factor IRES, picornavirus IRES, encephalomyocarditis virus (EMCV) IRES, Pim-1 IRES, p53 IRES, Apaf-1 IRES, TDP2 IRES, L-myc IRES, and c-myc IRES. In some embodiments, the IRES is available from EMCV.

[0103] Those skilled in the art will understand that various configurations of the coding sequences of ESR1 or its variants, PI3K or its variants, HER2 or its variants, and HER3 or its variants, the sequence encoding the autoproteolytic peptide, or the IRES can be utilized, so long as the expression of ESR1 or its variants, PI3K or its variants, HER2 or its variants, and HER3 or its variants is appropriately maintained. These sequences are typically configured so that the polypeptide encoded by the gene of interest is released from the protease and other sequences after cleavage by the autoprotease.

[0104] The term "operably linked," as used herein, refers to a functional linkage between two or more sequences. For example, an operable linkage between a polynucleotide of interest and a regulatory sequence (e.g., a promoter) is a functional linkage that permits expression of the polynucleotide of interest. In this sense, the term "operably linked" refers to the positioning of a regulatory region and a coding sequence to be transcribed such that the regulatory region is effective to regulate the transcription or translation of the coding sequence of interest. In some embodiments disclosed herein, the term "operably linked" refers to a configuration in which a regulatory sequence is positioned appropriately relative to a sequence encoding a polypeptide or functional RNA such that the control sequence directs or regulates the expression or cellular localization of the mRNA encoding the polypeptide, the polypeptide, and / or the functional RNA. Thus, a promoter is operably linked to a nucleic acid sequence if it is capable of mediating transcription of the nucleic acid sequence. Operably linked elements may or may not be contiguous.

[0105] Basic techniques for operably linking two or more sequences of DNA together are well known to those of skill in the art, and such methods are described in many standard molecular biology manuals (see, e.g., Maniatis et al., "Molecular Cloning: A Laboratory Manual" 2nd ed. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; and Gibson et al., Nature Methods 6:343-45, 2009).

[0106] As shown in FIG. 3 , T cell responses to various one-gene, two-gene, and four-gene constructs with various sequences of "gene 1," "gene 2," "gene 3," or "gene 4" (PI3K is not shown in FIG. 3 because it does not generate a response in BALB / c mice) were measured. It should be understood that in some embodiments, "gene 1," "gene 2," "gene 3," or "gene 4" can be ESR1 or a mutant thereof. Similarly, in some embodiments, "gene 1," "gene 2," "gene 3," or "gene 4" can be HER2 or a mutant thereof. In other embodiments, "gene 1," "gene 2," "gene 3," or "gene 4" can be HER3 or a mutant thereof. In some embodiments, "gene 1," "gene 2," "gene 3," or "gene 4" can be PI3K or a mutant thereof. Exemplary configurations of nucleic acid constructs described herein are shown in Table 3. Table 3. [Table 3-1] [Table 3-2] [Table 3-3] [Table 3-4]

[0107] In some embodiments, the construct is selected from the group consisting of pRB-136, pRB-146, pRB-151, and pRB-153.

[0108] In some embodiments, the nucleic acid sequence has at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 7-10.

[0109] In some embodiments, the coding sequence of the polypeptide construct comprises, in the 5' to 3' direction, the following: a) a coding sequence for a mutant of PI3K comprising one or more molecular modifications selected from E542K, H1047L, E545K, and H1047R, wherein the molecular modifications are operably linked by a GGGGS linker; b) a coding sequence for the autoproteolytic peptide P2A; c) a coding sequence for a mutant of HER2 comprising its extracellular domain and transmembrane domain; d) a coding sequence for the autoproteolytic peptide P2A; e) a coding sequence for a kinase-inactive mutant of HER3; f) a coding sequence for an internal ribosome entry site (IRES); and g) a coding sequence for a mutant of ESR1 comprising one or more molecular modifications selected from Y537C, E380Q, K303R, Y537S, D538G, and Y537N, wherein the molecular modifications are operably linked by a GGGGS linker.

[0110] In some embodiments, the coding sequences of ESR1, PI3K, HER2, and / or HER3 are redesigned and / or optimized for desired properties, such as enhanced stability, potency, and expression (e.g., translation efficiency), which in turn can maximize the impact of producing, delivering, and administering biotherapeutics. For example, in some embodiments, the coding sequences are optimized for expression at levels higher than those of a reference coding sequence. With regard to sequence optimization of nucleotide sequences, the degeneracy of the genetic code provides the possibility of replacing at least one base in a protein-encoding gene sequence with a different base without changing the amino acid sequence of the polypeptide produced from the gene. Thus, the nucleic acid constructs of the present disclosure can also have any base sequence that is altered from any of the polynucleotide sequences disclosed herein by substitutions related to the degeneracy of the genetic code. References describing codon usage are readily available. In some embodiments, polynucleotide sequence variants may be generated for a variety of reasons, such as to optimize expression for a particular host (e.g., changing the codon usage in an alphavirus mRNA to one preferred for humans, non-human primates, hamsters, mice, or other organisms, such as monkeys). Thus, in some embodiments, coding sequences are optimized for expression in target host cells through expression-optimized codon usage. Techniques for constructing synthetic nucleic acid sequences encoding genes with optimally preferred codons for host cell expression can be determined by techniques well known in the art through computational methods that analyze the commonality of codon usage and their relative abundance for encoding native proteins in the host cell genome. A codon usage database (http: / / www.kazusa.or.jp / codon) can be used to generate codon-optimized sequences for a mammalian cellular environment.Additionally, various software tools are available for converting sequences from one organism to the optimal codon usage of another host organism, such as the JCat Codon Optimization Tool (www.jcat.de), the Integrated DNA Technologies (IDT) Codon Optimization Tool (https: / / www.idtdna.com / CodonOpthttps: / / www.idtdna.com / CodonOpt), and the Optimizer Online Codon Optimization Tool (http: / / genomes.urv.es / OPTIMIZER). Such synthetic sequences may be constructed by techniques known in the art for the construction of synthetic nucleic acid molecules and may be obtained from various commercial vendors.

[0111] In some embodiments, the coding sequence of a GOI is optimized for enhanced RNA stability and / or expression. RNA stability is generally related to the "half-life" of the RNA. "Half-life" relates to the period required to remove half of the activity, amount, or number of molecules. In the context of the present disclosure, the half-life of an RNA is an indicator of the stability of the RNA. The half-life of an RNA may affect the "expression period" of the RNA. Additional information regarding principles, strategies, and methods for enhancing RNA stability can be found, for example, in Leppek K. et al., Combinatorial optimization of mRNA structure, stability, and translation for RNA-based therapeutics. bioRxiv. (Preprint). Mar 30, 2021. doi: 10.1101 / 2021.03.29.437587. Recombinant cells

[0112] The nucleic acid constructs of the present disclosure can be introduced into host cells to produce recombinant cells containing the nucleic acid molecules. Accordingly, prokaryotic or eukaryotic cells containing a nucleic acid construct encoding a modified EEEV genome as described herein are also a feature of the present disclosure. In a related aspect, some embodiments disclosed herein relate to methods of transforming cells, including introducing a nucleic acid construct provided herein into a host cell, such as an animal cell, followed by methods of selecting or screening for transformed cells. Introduction of the nucleic acid constructs of the present disclosure into cells can be achieved by methods known to those of skill in the art, such as viral infection, transfection, conjugation, protoplast fusion, lipofection, electroporation, nucleofection, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran-mediated transfection, liposome-mediated transfection, particle gun technology, direct microinjection, nanoparticle-mediated nucleic acid delivery, and the like.

[0113] In one aspect, some embodiments of the present disclosure relate to recombinant cells, e.g., recombinant animal cells, comprising a nucleic acid construct disclosed herein. The nucleic acid construct can be stably integrated into the host genome, episomally replicated, or present in the recombinant host cell as a minicircle expression vector for stable or transient expression. Thus, in some embodiments of the present disclosure, the nucleic acid construct is maintained and replicated in the recombinant host cell as an episomal unit. In some embodiments, the nucleic acid construct is stably integrated into the genome of the recombinant cell. Stable integration can be achieved by classical random genome recombination techniques or more precise genome editing techniques, such as guide RNA-directed CRISPR / Cas9 or TALEN genome editing. In some embodiments, the nucleic acid construct is present in the recombinant host cell as a minicircle expression vector for stable or transient expression.

[0114] In some embodiments, the recombinant cell is a prokaryotic cell, such as the bacterium E. coli, or a eukaryotic cell, such as an insect cell (e.g., a mosquito cell or an Sf21 cell), or a mammalian cell (e.g., a COS cell, an NIH 3T3 cell, or a HeLa cell). In some embodiments, the cell is in vivo. In some embodiments, the cell is ex vivo. In some embodiments, the cell is in vitro. In some embodiments, the recombinant cell is a eukaryotic cell. In some embodiments, the recombinant cell is an animal cell. In some embodiments, the animal cell is a vertebrate cell or an invertebrate cell. In some embodiments, the recombinant cell is a mammalian cell. In some embodiments, the recombinant cells are selected from the group consisting of SV40-transformed monkey kidney CV1 cells (COS-7), human embryonic kidney cells (e.g., HEK 293 or HEK 293 cells), baby hamster kidney cells (BHK), mouse Sertoli cells (e.g., TM4 cells), monkey kidney cells (CV1), human cervical carcinoma cells (HeLa), canine kidney cells (MDCK), buffalo rat hepatocytes (BRL3A), human lung cells (W138), human hepatocytes (Hep G2), mouse mammary tumor (MMT 060562), TRI cells, FS4 cells, Chinese hamster ovary cells (CHO cells), African green monkey kidney cells (Vero cells), human A549 cells, human cervical cells, human CHME5 cells, human PER.C6 cells, NS0 mouse myeloma cells, selected from the group consisting of human epidermal laryngeal cells, human fibroblast cells, human HUH-7 cells, human MRC-5 cells, human muscle cells, human lymphatic endothelial cells, human astrocyte cells, human macrophage cells, human RAW264.7 cells, mouse 3T3 cells, mouse L929 cells, mouse connective tissue cells, mouse muscle cells, and rabbit kidney cells.

[0115] In some embodiments, the recombinant cell is an insect cell, e.g., a cell of an insect cell line. In some embodiments, the recombinant cell is an Sf21 cell. Additional suitable insect cell lines include, but are not limited to, established cell lines from the insect orders Diptera, Lepidoptera, and Hemiptera, and can be derived from different tissue sources. In some embodiments, the recombinant cell is a cell of a lepidopteran insect cell line. Over the past few decades, the availability of lepidopteran insect cell lines has increased by approximately 50 lines per decade. More information on available lepidopteran insect cell lines can be found, for example, in Lynn DE, Available lepidopteran insect cell lines. Methods Mol Biol. 2007; 388: 117-38, incorporated herein by reference. In some embodiments, the recombinant cell is a mosquito cell, e.g., a cell of a mosquito species within the genera Anopheles (An), Culex (Cx), and Stegomyia. Exemplary mosquito cell lines suitable for the compositions and methods described herein include cell lines from the following mosquito species: Aedes aegypti, Aedes albopictus, Aedes pseudoscutellaris, Aedes triseriatus, Aedes vexans, Anopheles gambiae, Anopheles stephensi, Anopheles albimanus, Culex quinquefasciatus, Culex theileri, Culex tritaeniorhynchus, Culex bitaeniorhynchus, and Toxorhynchites amboinensis. Suitable mosquito cell lines include, but are not limited to, CCL-125, Aag-2, RML-12, C6 / 26, C6 / 36, C7-10, AP-61, AtGRIP-1, AtGRIP-2, UM-AVE1, Mos.55, Sua1B, 4A-3B, Mos.43, MSQ43, and LSB-AA695BB. In some embodiments, the mosquito cells are cells of the C6 / 26 cell line.

[0116] In another aspect, provided herein are cell cultures and culture media comprising at least one recombinant cell disclosed herein. Generally, the culture media can be any suitable culture medium for culturing the cells described herein. Techniques for transforming the wide variety of host cells and species described above are known in the art and described in the technical and scientific literature. Accordingly, cell cultures comprising at least one recombinant cell disclosed herein are also within the scope of this application. Suitable methods and systems for generating and maintaining cell cultures are known in the art.

[0117] Recombinant polypeptides produced by the methods disclosed herein are also within the scope of this disclosure.

[0118] Non-limiting exemplary embodiments of the disclosed methods for producing a recombinant polypeptide can include one or more of the following features: In some embodiments, the methods for producing a recombinant polypeptide of the present disclosure further include isolating and / or purifying the produced polypeptide. In some embodiments, the methods for producing a polypeptide of the present disclosure further include structurally modifying the produced polypeptide to increase its half-life. Pharmaceutical Composition

[0119] The nucleic acid constructs, recombinant cells, and recombinant polypeptides of the present disclosure can be incorporated into compositions (including pharmaceutical compositions). Such compositions generally comprise one or more of the nucleic acid constructs, recombinant cells, and recombinant polypeptides described and provided herein, and a pharmaceutically acceptable excipient, e.g., a carrier. In some embodiments, the compositions of the present disclosure are formulated for the prevention, treatment, or management of a health condition, such as cancer. For example, the compositions of the present disclosure can be formulated as prophylactic compositions, therapeutic compositions, or pharmaceutical compositions comprising a pharmaceutically acceptable excipient, or a mixture thereof. In some embodiments, the compositions of the present disclosure are formulated for use as a vaccine. In some embodiments, the compositions of the present application are formulated for use as an adjuvant.

[0120] Thus, in one aspect, provided herein is a pharmaceutical composition comprising a pharmaceutically acceptable excipient and: a) a nucleic acid construct of the present disclosure; b) a recombinant cell of the present disclosure; and / or c) a recombinant polypeptide of the present disclosure.

[0121] Non-limiting exemplary embodiments of the pharmaceutical composition of the present disclosure may include one or more of the following features: The nucleic acid construct of the present disclosure may be used in a naked form or may be formulated with a delivery vehicle. An exemplary route for use in a free form is, for example, as a nucleic acid inserted into a vector. For example, as described in more detail below, the nucleic acid constructs described herein may be used as vaccines.

[0122] In some embodiments, provided herein are compositions comprising a nucleic acid construct disclosed herein and a pharmaceutically acceptable excipient. In some embodiments, provided herein are compositions comprising a recombinant cell disclosed herein and a pharmaceutically acceptable excipient. In some embodiments, a composition comprises a recombinant polypeptide disclosed herein and a pharmaceutically acceptable excipient.

[0123] In some embodiments, the compositions of the present disclosure are formulated for the prevention, treatment, or management of a condition, such as cancer. For example, the compositions of the present disclosure can be formulated as a prophylactic composition, a therapeutic composition, or a pharmaceutical composition containing pharmaceutically acceptable excipients, or a mixture thereof.

[0124] For use in the pharmaceutical compositions of the present disclosure, the nucleic acids or recombinant cells described herein can be formulated in or with a delivery vehicle. Exemplary delivery vehicles suitable for the compositions and methods of the present disclosure include, but are not limited to, liposomes (e.g., neutral or anionic liposomes), microspheres, immune stimulating complexes (ISCOMS), lipid-based nanoparticles (LNPs), polymeric nanoparticles, viral replicon particles (VRPs), or those conjugated to biologically active ligands, which facilitate delivery and / or stimulate the immune response. These compounds are readily available to those skilled in the art; see, for example, Liposomes: A Practical Approach, RCP New Ed, IRL Press (1990). Adjuvants other than liposomes and the like are also used and are known in the art. Adjuvants may protect the antigen (e.g., srRNA construct) from rapid dissemination by sequestering it in localized deposits, or they may contain substances that stimulate the host to secrete factors or other components that are chemotactic for macrophages of the immune system. An appropriate choice can be made by one skilled in the art, e.g., from those described below.

[0125] Thus, in some embodiments, compositions of the present disclosure may include one or more of the following: physiological buffer, liposomes, lipid-based nanoparticles (LNPs), polymeric nanoparticles, viral replicon particles (VRPs), microspheres, immune stimulating complexes (ISCOMs), conjugates of bioactive ligands, or any combination thereof.

[0126] In some embodiments, the nucleic acid constructs of the present disclosure can be delivered to cells or subjects via lipid-based nanoparticles (LNPs). LNPs are generally less immunogenic than viral particles. Many people have pre-existing immunity to viral particles, but not to LNPs. In addition, adaptive immune responses to LNPs are unlikely to occur, which allows for repeated administration of LNPs.

[0127] Suitable lipids for the compositions and methods described herein are cationic lipids, ionizable cationic lipids, anionic lipids, or neutral lipids.

[0128] In some embodiments, the LNPs of the present disclosure can include one or more ionizable lipids. As used herein, the term "ionizable lipid" refers to a lipid that is cationic or becomes ionizable (protonated) when the pH is reduced below the pKa of the lipid's ionizable group, but is more neutral at higher pH values. At pH values ​​below the pKa, the lipid can bind to negatively charged nucleic acids (e.g., oligonucleotides). As used herein, the term "ionizable lipid" includes lipids that acquire a positive charge upon a pH reduction from physiological pH, as well as any of the many lipid species that carry a net positive charge at a selected pH, such as physiological pH. Permanently cationic lipids, such as DOTMA, have proven too toxic for clinical use. The ionizable lipid may be present in the lipid formulations according to embodiments in a ratio of about 30 to about 70 mol% in some embodiments, about 30 mol% in other embodiments, about 40 mol% in other embodiments, about 45 mol% in other embodiments, about 47.5 mol% in other embodiments, about 50 mol% in still other embodiments, and about 60 mol% in still other cases ("mol%" refers to the percentage of the total number of moles of a particular component). In this paragraph, the term "about" refers to a range of plus or minus 5 mol%. DODMA or 1,2-dioleyloxy-3-dimethylaminopropane is an ionizable lipid, as is DLin-MC3-DMA or O-(Z,Z,Z,Z-heptatriaconta-6,9,26,29-tetraen-19-yl)-4-(N,N-dimethylamino) ("MC3").

[0129] Exemplary ionizable lipids suitable for the compositions and methods of the present disclosure include those described in PCT Publications WO2020252589A1 and WO2021000041A1, U.S. Patent Nos. 8,450,298 and 10,844,028, and Love KT et al., Proc Natl Acad Sci USA, Feb. 2, 2010 107 (5) 1864-1869, which are incorporated by reference in their entireties. Thus, in some embodiments, the LNPs of the present disclosure include one or more lipid compounds described in Love KT et al., supra, 2010, such as C16-96, C14-110, and C12-200. In some embodiments, the LNPs include an ionizable cationic lipid selected from the group consisting of ALC-0315, C12-200, LN16, MC3, MD1, SM-102, and any combination thereof. In some embodiments, the LNPs of the present disclosure include C12-200. The structure of C12-200 lipids is known in the art and is described, for example, in U.S. Patent Nos. 8,450,298 and 10,844,028, which are incorporated herein by reference in their entireties. In some embodiments, C12-200 is combined with cholesterol, C14-PEG2000, and DOPE. In some embodiments, C12-200 is combined with DSPC and DMG-PEG2000.

[0130] In some embodiments, LNPs of the present disclosure comprise one or more cationic lipids. Suitable cationic lipids include, but are not limited to, 98N12-5, C12-200, C14-PEG2000, DLin-KC2-DMA (KC2), DLin-MC3-DMA (MC3), XTC, MD1, and 7C1. In some embodiments, LNPs of the present disclosure comprise one or more neutral lipids. Non-limiting examples of neutral lipids suitable for the compositions and methods of the present disclosure include DPSC, DPPC, POPC, DOPE, and SM. In some embodiments, LNPs of the present disclosure comprise one or more ionizable lipid compounds described in PCT Publications WO2020252589A1 and WO2021000041A1, which are incorporated by reference in their entireties.

[0131] A number of other lipids or lipid combinations known in the art can be used to prepare LNPs. Non-limiting examples of lipids suitable for use in preparing LNPs include DOTMA, DOSPA, DOTAP, DMRIE, DC-cholesterol, DOTAP-cholesterol, GAP-DMORIE-DPyPE, and GL67A-DOPE-DMPE-polyethylene glycol (PEG). Non-limiting examples of cationic lipids include 98N12-5, C12-200, C14-PEG2000, DLin-KC2-DMA (KC2), DLin-MC3-DMA (MC3), XTC, MD1, 7C1, and any combination thereof. Non-limiting examples of neutral lipids include DPSC, DPPC, POPC, DOPE, and SM. Non-limiting examples of PEG-modified lipids include PEG-DMG, PEG-CerC14, and PEG-CerC20.

[0132] In some embodiments, the LNPs of the present disclosure include at least one lipid selected from the group consisting of C12-200, C14-PEG2000, DOPE, DMG-PEG2000, DSPC, DOTMA, DOSPA, DOTAP, DMRIE, DC-cholesterol, DOTAP-cholesterol, GAP-DMORIE-DPyPE, and GL67A-DOPE-DMPE-polyethylene glycol (PEG). In some embodiments, C12-200 is combined with cholesterol, C14-PEG2000, and DOPE. In some embodiments, C12-200 is combined with DSPC and DMG-PEG2000.

[0133] In some embodiments, the lipid to nucleic acid mass ratio in the LNP delivery system is about 100:1 to about 3:1, about 70:1 to about 10:1, or 16:1 to 4:1. In some embodiments, the lipid to nucleic acid mass ratio in the LNP delivery system is about 16:1 to about 4:1. In some embodiments, the lipid to nucleic acid mass ratio in the LNP delivery system is about 20:1. In some embodiments, the lipid to nucleic acid mass ratio in the LNP delivery system is about 8:1. In some embodiments, the lipid-based nanoparticles have an average diameter of less than about 1000 nm, about 500 nm, about 250 nm, about 200 nm, about 150 nm, about 100 nm, about 75 nm, about 50 nm, or about 25 nm. In some embodiments, the LNPs have an average diameter ranging from about 70 nm to 100 nm. In some embodiments, the LNPs have an average diameter ranging from about 88 nm to about 92 nm, 82 nm to about 86 nm, or about 80 nm to about 95 nm.

[0134] In some embodiments, the compositions of the present disclosure are formulated in liposomes. In some embodiments, the compositions of the present disclosure are formulated in lipid-based nanoparticles (LNPs). In some embodiments, the compositions of the present disclosure are formulated in polymeric nanoparticles.

[0135] As previously described, neural lipids, also known as "structured lipids" or "helper lipids," can be incorporated into lipid formulations and lipid particles in some embodiments. The lipid formulations and lipid particles can contain one or more structured lipids at about 10-40 mol% of the composition. Suitable structured lipids support particle formation during manufacturing. A structured lipid refers to any one of a number of lipid species that exist in either anionic, uncharged, or neutral zwitterionic form at physiological pH. Exemplary structured lipids include diacylphosphatidylcholine, diacylphosphatidylethanolamine, diacylphosphatidylglycerol, ceramide, sphingomyelin, dihydrosphingomyelin, cephalin, and cerebrosides.

[0136] Exemplary structured lipids include zwitterionic lipids, such as distearoylphosphatidylcholine (DSPC), dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC), dioleoyl-phosphatidylethanolamine (DOPE), palmitoyloleoylphosphatidylcholine (POPC), palmitoyloleoyl-phosphatidylethanolamine (POPE), and dioleoyl-phosphatidylethanolamine 4-(N-maleimidomethyl)-cyclohexane-1-carboxylate (DOPE-mal), dipalmitoylphosphatidylethanolamine (DPPE), dimyristoylphosphoethanolamine (DMPE), distearoyl-phosphatidylethanolamine (DSPE), 16-O-monomethyl PE, 16-O-dimethyl PE, 18-1-trans PE, 1-stearoyl-2-oleoyl-phosphatidylethanolamine (SOPE), and 1,2-dielideyl-sn-glycero-3-phosphoethanolamine (trans DOPE).

[0137] In another embodiment, the structured lipid can be any lipid that is negatively charged at physiological pH. These lipids include phosphatidylglycerols, such as dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG), palmitoyloleoylphosphatidylglycerol (POPG), cardiolipin, phosphatidylinositol, diacylphosphatidylserine, diacylphosphatidic acid, and other anionic modifying groups attached to neutral lipids. Other suitable structured lipids include glycolipids (e.g., monosialoganglioside GM1).

[0138] Stabilizers may be included in lipid formulation embodiments to ensure the integrity of the mixture. Stabilizers are a class of molecules that disrupt or aid in the formation of hydrophobic-hydrophilic interactions between molecules. Suitable stabilizers include, but are not limited to, polysorbate 80 (also known as Tween 80, IUPAC name 2-[2-[3,4-bis(2-hydroxyethoxy)oxolan-2-yl]-2-(2-hydroxyethoxy)ethoxy]ethyl octadec-9-enoate), Myrj 52 (polyoxyethylene (40) stearate), and Brij™ S10 (polyoxyethylene (10) stearyl ether). Polyethylene glycol-conjugated lipids may also be used. Stabilizers may be used alone or in combination with each other.

[0139] In some embodiments, the stabilizer comprises about 0.1-3 mol% of the total lipid mixture. In some embodiments, the stabilizer comprises about 0.5-2.5 mol% of the total lipid mixture. In some embodiments, the stabilizer is present at greater than 2.5 mol%. In some embodiments, the stabilizer is present at 5 mol%. In some embodiments, the stabilizer is present at 10 mol%. In some embodiments, the stabilizer is present at about 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, etc. In other embodiments, the stabilizer is present at 2.6-10 mol% of the lipid mixture. In other embodiments, the stabilizer is present at greater than 10 mol% of the lipid mixture.

[0140] Steroids may also be included in the lipid composition for certain applications, and lipid particles made therefrom contain sterols, such as cholesterol or plant sterols.

[0141] In some embodiments, the therapeutic compositions described herein, e.g., nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions, are incorporated into therapeutic compositions for use in methods of preventing or treating a subject who has cancer, is suspected of having cancer, or may be at high risk for developing cancer.

[0142] In some embodiments, the composition is an immunogenic composition, e.g., a composition capable of stimulating an immune response in a subject. In some embodiments, the immunogenic composition is formulated as a vaccine. In some embodiments, the pharmaceutical composition is formulated as an adjuvant. In some embodiments, the immunogenic composition is formulated as a biotherapeutic agent, e.g., a vehicle for gene delivery of various biologically active molecules. Non-limiting examples of biotherapeutics include cytokines, chemokines, and other soluble immunomodulators, enzymes, peptide and protein agonists, peptide and protein antagonists, hormones, receptors, antibodies and antibody derivatives, growth factors, transcription factors, and gene silencing / editing molecules. In some embodiments, the pharmaceutical composition is formulated as an adjuvant.

[0143] In some embodiments, the immunogenic composition is substantially non-immunogenic or minimally immunogenic (e.g., a composition that minimally stimulates an immune response in a subject). In some embodiments, the non-immunogenic or minimally immunogenic composition is formulated as a biotherapeutic. In some embodiments, the pharmaceutical composition is formulated for one or more of intranasal, transdermal, intraperitoneal, intramuscular, intranodal, intratumoral, intraarticular, intravenous, subcutaneous, intravaginal, and oral administration.

[0144] Pharmaceutical compositions suitable for injection include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, NJ), or phosphate buffered saline (PBS), tris (tromethamine), and HEPES. In these cases, the composition should be sterile and fluid to the extent that easy syringability exists. The composition should be stable under the conditions of manufacture and storage and preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof. Proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants, such as sodium dodecyl sulfate. Prevention of microbial action can be achieved by various antibacterial and antifungal agents, such as parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, etc. In many cases, it is common to include isotonic agents, such as sugars, mannitol, sorbitol, sucrose, trehalose, and / or polyalcohols such as sodium chloride, in the composition. In some embodiments, the composition contains tris and sucrose. Prolonged absorption of injectable compositions can be achieved by including in the composition an agent that delays absorption, such as aluminum monostearate and gelatin.

[0145] Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle containing a basic dispersion medium and the required other ingredients from those enumerated above.

[0146] In some embodiments, the composition is formulated for one or more of intranasal, transdermal, intramuscular, intratumoral, intranodal, intravenous, intraperitoneal, oral, intravaginal, or intracranial administration. Methods of the present disclosure

[0147] Administration of any one of the therapeutic compositions described herein, e.g., nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions, can be used to treat associated health conditions, such as, for example, cancer. In some embodiments, the nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions described herein are useful for eliciting an immune response in a subject in need thereof. In some embodiments, the nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions described herein can be incorporated into a therapeutic agent for use in a method of treating a subject at, suspected of, or potentially at high risk of developing one or more associated health conditions. Exemplary health conditions or diseases can include, but are not limited to, breast cancer. In some embodiments, the subject is a patient under a physician's care.

[0148] Non-limiting examples of breast cancers suitable for the methods of the present disclosure include ductal carcinoma of the breast, lobular carcinoma of the breast, undifferentiated carcinoma of the breast, lobular sarcoma of the breast, angiosarcoma of the breast, and primary lymphoma of the breast. Breast cancers may include stage I, II, IIIA, IIIB, IIIC, and IV breast cancer. Breast ductal carcinoma may include the invasive cancer types invasive carcinoma in situ with predominantly intraductal component, inflammatory breast cancer, and ductal carcinoma of the breast. Breast ductal carcinoma may include invasive lobular carcinoma with predominantly intraductal component, invasive lobular carcinoma, and invasive lobular adenocarcinoma. Breast cancers may include Paget's disease, extramammary Paget's disease, Paget's disease with intraductal carcinoma, and Paget's disease with invasive ductal carcinoma. Breast cancers may include breast neoplasms with histological and ultrastructural heterogeneity (e.g., mixed cell types). Breast cancers can be classified as basal-like, luminal A, luminal B, ERBB2 / Her2+ or normal breast-like molecular subtypes.

[0149] Thus, in one aspect, provided herein is a method for eliciting an immune response in a subject in need thereof, the method comprising administering to the subject a composition comprising: a) a nucleic acid construct of the present disclosure; b) a recombinant cell of the present disclosure; c) a recombinant polypeptide of the present disclosure; and / or d) a pharmaceutical composition of the present disclosure.

[0150] In another aspect, provided herein is a method for preventing and / or treating a condition in a subject in need thereof, the method comprising prophylactically or therapeutically administering to the subject a composition comprising: a) a nucleic acid construct of the present disclosure; b) a recombinant cell of the present disclosure; c) a recombinant polypeptide of the present disclosure; and / or d) a pharmaceutical composition described in any one of the present disclosure.

[0151] In some embodiments, the condition is cancer. In some embodiments, the cancer is breast cancer. In some embodiments, the subject has or is suspected of having cancer.

[0152] In some embodiments, the disclosed compositions are formulated to be compatible with their intended route of administration. For example, the nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions of the present disclosure can be given orally, by inhalation, or via a parenteral route. Examples of parenteral administration routes include, for example, intramuscular, intratumoral, intraocular, intravenous, intranodal, intradermal, subcutaneous, transdermal (topical), transmucosal, intravaginal, and intrarectal administration. In some embodiments, the compositions are administered intramuscularly. In some embodiments, the compositions are administered intratumorally. Solutions or suspensions used for parenteral administration may contain the following components: a sterile diluent such as water for injection, saline, fixed oils, polyethylene glycol, glycerin, propylene glycol, or other synthetic solvents; an antibacterial agent such as benzyl alcohol or methylparaben; an antioxidant such as ascorbic acid or sodium bisulfite; a chelating agent such as ethylenediaminetetraacetic acid (EDTA); a buffer such as acetate, citrate, phosphate, tris, or sucrose; and a tonicity adjuster such as sodium chloride or dextrose. The pH may be adjusted with an acid or base such as monobasic and / or dibasic sodium phosphate, hydrochloric acid, or sodium hydroxide (e.g., a pH of about 7.2 to 7.8, e.g., 7.5). Parenteral formulations may be enclosed in ampoules, disposable syringes, or multiple-dose vials made of glass or plastic.

[0153] Therapeutic compositions described herein, e.g., nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions, can be administered one or more times daily to one or more times weekly, including once every other day. Treatment of a subject with a therapeutically effective amount of the subject's nucleic acid construct, recombinant cells, recombinant polypeptide, and / or pharmaceutical composition of the present disclosure can include a single treatment or can include a series of treatments. In some embodiments, the composition is administered in one to two, two to three, or three to four doses administered at weekly intervals, e.g., one to two weeks, two to three weeks, or three to four weeks apart. This can be followed by additional administrations every one, two, three, or four months. In some embodiments, three doses can be administered intramuscularly at three to four week intervals, followed by intramuscular administration every three months. Alternatively, the composition can be administered at shorter intervals, e.g., every 8 hours for 5 days, followed by a rest period of 2-14 days, e.g., 9 days, followed by administration every 8 hours for another 5 days. With regard to nucleic acid constructs and recombinant polypeptides, the therapeutically effective amount (e.g., effective dosage) of the nucleic acid construct or recombinant polypeptide of the present disclosure will depend on the nucleic acid construct or recombinant polypeptide selected.

[0154] As noted above, a therapeutically effective amount includes an amount of a therapeutic composition that is sufficient to promote a particular effect when administered to a subject with a health condition, such as, for example, a person suffering from, suspected of having, or at risk for, cancer, etc. In some embodiments, an effective amount includes an amount sufficient to prevent or delay the onset of, alter the course of, (e.g., without limitation, slow the progression of) or reverse a symptom of a disease.

[0155] A treatment is considered effective if at least any one or all of the signs or symptoms of a disease are improved or ameliorated. Efficacy can also be measured by a reduction in an individual's deterioration (e.g., the progression of the disease is stopped or at least slowed) as assessed by the need for hospitalization or medical intervention. Methods for measuring these indicators are known to those of skill in the art and / or described herein. Treatment includes any treatment of a disease in a subject or animal (some non-limiting examples include humans or mammals), including (1) inhibiting the disease, e.g., halting or slowing the progression of symptoms; or (2) relieving the disease, e.g., causing regression of symptoms; and (3) preventing or reducing the likelihood that symptoms will develop.

[0156] In some embodiments, the nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions of the present disclosure can be administered to a subject in a composition with a pharmaceutically acceptable carrier and in an amount effective to stimulate an immune response. Generally, a subject is immunized with an initial series of injections (or administered via one of the other routes described below), followed by boosters to enhance the protection provided by the original series. The initial series of injections and subsequent boosters are administered at such doses and for such periods as are necessary to stimulate an immune response in the subject. In some embodiments of the disclosed methods, the subject is a mammal. In some embodiments, the mammal is a human subject.

[0157] As noted above, pharmaceutically acceptable carriers suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. In these cases, the compositions must be sterile and fluid to the extent that easy syringability exists. The compositions must also be stable under the conditions of manufacture and storage and preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, etc.), suitable mixtures thereof, and vegetable oils. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants. The prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.

[0158] Sterile injectable solutions can be prepared by incorporating the nucleic acid constructs, recombinant cells, and / or recombinant polypeptides, as required, in the required vehicle in an appropriate solvent with one or a combination of ingredients enumerated above, followed by filtered sterilization.

[0159] When the nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions are properly protected, as described above, they may be orally administered, for example, with an inert diluent or an assimilable edible carrier. The nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions and other ingredients may also be enclosed in hard or soft shell gelatin capsules, compressed into tablets, or incorporated directly into the individual's diet. For oral therapeutic administration, the active compound may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like. Additional treatments

[0160] In some embodiments, the compositions described herein are administered individually to a subject as a monotherapy (monotherapy) or as a first therapy in combination with at least one additional therapy (e.g., a second therapy). In some embodiments, the second therapy is selected from the group consisting of chemotherapy, radiation therapy, immunotherapy, hormone therapy, toxin therapy, targeted therapy, and surgery. In some embodiments, the second therapy is selected from the group consisting of chemotherapy, radiation therapy, immunotherapy, hormone therapy, toxin therapy, or surgery. In some embodiments, the first and second therapies are administered concomitantly. In some embodiments, the first therapy is administered simultaneously with the second therapy. In some embodiments, the first and second therapies are administered sequentially. In some embodiments, the first treatment is administered before the second therapy. In some embodiments, the first therapy is administered after the second therapy. In some embodiments, the first therapy is administered before and / or after the second therapy. In some embodiments, the first and second therapies are administered in alternation. In some embodiments, the first and second therapies are administered together in a single formulation. kit

[0161] Also provided herein are various kits for carrying out the methods described herein, as well as instructions for their manufacture and use. In particular, some embodiments of the present disclosure provide kits for inducing an immune response in a subject. Some other embodiments relate to kits for methods of treating cancer in a subject in need of treatment. For example, in some embodiments, provided herein are kits that include one or more of the nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions provided and described herein, and written instructions for producing and using them.

[0162] In some embodiments, the kit of the present disclosure further comprises one or more means useful for administering any one of the provided nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions to a subject. For example, in some embodiments, the kit of the present disclosure further comprises one or more syringes (including pre-filled syringes) and / or catheters (including pre-filled syringes) used to administer any one of the provided nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions to a subject. In some embodiments, the kit can comprise one or more additional therapeutic agents that can be administered simultaneously or sequentially with other kit components for a desired purpose, for example, to diagnose, prevent, or treat a health condition in a subject in need of diagnosis, prevention, or treatment.

[0163] Any of the above-described kits can further comprise one or more additional reagents, wherein the additional reagents can be selected from a dilution buffer; a reconstitution solution, a wash buffer, a control reagent, a control expression vector, a negative control, a positive control, a reagent suitable for the in vitro production of the provided nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or a pharmaceutical composition of the present disclosure.

[0164] In some embodiments, the components of the kit can be packaged in separate containers. In some other embodiments, the components of the kit can be combined in a single container. Thus, in some embodiments of the present disclosure, the kit includes one or more of the nucleic acid constructs, recombinant cells, recombinant polypeptides, and / or pharmaceutical compositions provided and described herein in one container (e.g., in a sterile glass or plastic vial), and an additional therapeutic agent in another container (e.g., in a sterile glass or plastic vial).

[0165] In another embodiment, the kit comprises, in a single common container, a combination of compositions described herein, including one or more nucleic acid constructs, recombinant cells, and / or recombinant polypeptides of the present disclosure, optionally in combination with one or more additional therapeutic agents formulated together in a pharmaceutical composition.

[0166] Where the kit includes a pharmaceutical composition for parenteral administration to a subject, the kit can include a device for performing such administration (e.g., an injection device or catheter). For example, the kit can include one or more of the above-mentioned hypodermic needles or other injection devices containing one or more nucleic acid constructs, recombinant cells, and / or recombinant polypeptides of the present disclosure.

[0167] In some embodiments, the kit can further include instructions for using the kit components to practice the methods disclosed herein. For example, the kit can include a package insert containing information about the pharmaceutical compositions and dosage forms included in the kit. Typically, such information will assist patients and physicians in effectively and safely using the enclosed pharmaceutical compositions and dosage forms. For example, the following information about the combinations disclosed herein may be provided in the package insert: pharmacokinetics, pharmacodynamics, clinical trials, efficacy parameters, indications and usage, contraindications, warnings, precautions, adverse reactions, overdosage, appropriate usage and dosage, method of delivery, suitable storage conditions, references, manufacturer / distributor information, and intellectual property information.

[0168] The instructions for carrying out the method are generally recorded on a suitable recording medium. For example, the instructions can be printed on a substrate such as paper or plastic. The instructions can be present in the kit as a package insert, on a label on the container of the kit or its components (e.g., associated with the packaging or subpackaging), etc. The instructions can be present as an electronic storage data file present on a suitable computer-readable storage medium, such as a CD-ROM, floppy disk, flash drive, etc. In some instances, the actual instructions are not present in the kit, but means for obtaining the instructions from a remote information source (e.g., via the Internet) can be provided. An example of this embodiment is a kit that includes a web address where the instructions can be viewed and / or from which the instructions can be downloaded. As with the instructions, this means for obtaining the instructions can be recorded on a suitable substrate.

[0169] All publications and patent applications mentioned in this disclosure are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.

[0170] Any reference cited herein is not admitted to constitute prior art. The discussion of the references states what their authors assert, and applicants reserve the right to challenge the accuracy and relevance of the cited documents. Although many sources of information, including scientific journal articles, patent documents, and textbooks, have been referenced herein, it is expressly understood that this reference is not an admission that any of these documents form part of the common general knowledge in the art.

[0171] The general method discussion provided herein is for illustrative purposes only. Other alternative methods and substitutions will be apparent to those skilled in the art upon review of this disclosure, and are to be included within the spirit and scope of this application.

[0172] Further embodiments are disclosed in more detail in the following examples, which are provided by way of illustration and are not intended to limit the scope of the disclosure or claims. [Example]

[0173] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, cell biology, biochemistry, nucleic acid chemistry, and immunology, which are well known to those of skill in the art. Such techniques are described, for example, in Sambrook, J., & Russell, DW (2012). Molecular Cloning: A Laboratory Manual (4th ed.). Cold Spring Harbor, NY: Cold Spring Harbor Laboratory and Sambrook, J., & Russell, DW (2001). Molecular Cloning: A Laboratory Manual (3rd ed.). Cold Spring Harbor, NY: Cold Spring Harbor Laboratory (collectively referred to herein as "Sambrook"); Ausubel, FM (1987). Current Protocols in Molecular Biology. New York, NY: Wiley (including appendices through 2014); Bollag, DM et al. (1996). Protein Methods. New York, NY: Wiley-Liss; Huang, L. et al. (2005). Nonviral Vectors for Gene Therapy. San Diego: Academic Press; Kaplitt, MG et al. (1995). Viral Vectors: Gene Therapy and Neuroscience Applications. San Diego, CA: Academic Press; Lefkovits, I. (1997). The Immunology Methods Manual: The Comprehensive Sourcebook of Techniques. San Diego, CA: Academic Press; Doyle, A. et al. (1998). Cell and Tissue Culture: Laboratory Procedures in Biotechnology.New York, NY: Wiley; Mullis, KB, Ferre, F. & Gibbs, R. (1994). PCR: The Polymerase Chain Reaction. Boston: Birkhauser Publisher; Greenfield, EA (2014). Antibodies: A Laboratory Manual (2nd ed.). New York, NY: Cold Spring Harbor Laboratory Press; Beaucage, SL et al. (2000). Current Protocols in Nucleic Acid Chemistry. New York, NY: Wiley, (including supplements for 2014); and Makrides, SC (2003). Gene Transfer and Expression in Mammalian Cells. Amsterdam, NL: Elsevier Sciences BV, etc. (The disclosures of the above references are incorporated herein by reference).

[0174] Further embodiments are disclosed in more detail in the following examples, which are provided by way of illustration and are not intended to limit the scope of the disclosure or claims. Example 1. Construction of EEEV vector

[0175] This example describes experiments performed to construct a base EEEV vector (e.g., without a heterologous gene) that is subsequently used to construct EEEV vectors expressing a gene(s) of interest (e.g., ESR1 or a mutant thereof, PI3K or a mutant thereof, HER2 or a mutant thereof, and HER3 or a mutant thereof).

[0176] The base EEEV vector (i.e., without the heterologous gene of interest) was constructed as follows: The base EEEV vector was synthesized de novo with a 4-4 kb portion (Twist Bioscience) derived from the reference sequence (Genbank EF151502) with several modifications. Silent mutations G301A, A3550C, G4516A, G5725A, and G7399A were incorporated to eliminate restriction enzyme cleavage sites. A unique restriction enzyme cleavage site (SpeI, 5'-A'CTAG, T-3') was incorporated in place of the coding sequence of the native EEEV structural gene (where the 5'A corresponds to the position of the ATG start codon of the structural polyprotein, and the 3'T corresponds to the position of the TAA stop codon of the structural polyprotein). For the subsequent Gibson Assembly® procedure (Gibson et al., Nat. Methods 6, 343-345, 2009), a 5' adapter sequence (5'-CTGGAGACGTGGAGGAGAACCCTGGACCT-3'; SEQ ID NO: 21) was inserted upstream of the SpeI site, and a 3' adapter sequence (5'-GACCGCTACGCCCCAATGACCCGACCAGC-3'; SEQ ID NO: 22) was inserted downstream of the SpeI site. A bacteriophage T7 RNA polymerase promoter (5'-TAATACGACTCACTATAG-3'; SEQ ID NO: 23) was included upstream of the EEEV genomic sequence, and downstream was a poly(A) sequence followed by a SapI site (which cuts upstream of the recognition site). Immediately downstream of the SapI site is a T7 termination sequence (5'-AACCCCTCTCTAAACGGAGGGGTTTTTTT-3'; SEQ ID NO: 24) followed by a unique restriction enzyme cleavage site (NotI, 5'-GC'GGCC,GC-3'), which was combined with the linearized pYL backbone and the four synthetic fragments in a five-piece Gibson Assembly® reaction to yield the EEEV-based vector.

[0177] Construction of EEEV vectors containing heterologous genes was performed as follows: the base EEEV vector was linearized by SpeI digestion. ESR1, PI3K, HER2, and HER3 variants were computationally codon-optimized / refactored for human expression and de novo synthesized with the EMCV IRES (GeneArt, IDT). The synthesized products were amplified using primers that added either 5' and 3' adapter sequences to the ends of the genes or sequences homologous to the P2A sequence and / or adjacent gene inserts. Digestion and PCR products were combined using the Gibson Assembly® procedure to obtain the final vectors. Example 2. In vitro evaluation of modified EEEV vectors

[0178] This example describes the results of in vitro experiments performed to evaluate the expression levels of the synthetic EEEV replicon constructs described in Example 1 above and to investigate any differential behavior (e.g., replication and protein expression) thereof.

[0179] In vitro transcription: RNA was prepared by in vitro transcription from a SapI-linearized plasmid template using bacteriophage T7 polymerase with either a 5' ARCA cap (HiScribe™ T7 ARCA mRNA kit, NEB) or uncapped transcription (HiScribe™ T7 High Yield RNA Synthesis Kit, NEB), followed by addition of a 5' Cap 1 (Vaccinia Capping System, mRNA Cap 2'-O-Methyltransferase, NEB). RNA was then purified using phenol / chloroform extraction or column purification (Monarch® RNA Cleanup Kit, NEB). RNA concentration was determined by absorbance at 260 nm (Nanodrop, Thermo Fisher Scientific).

[0180] Replication: RNA was transfected into BHK-21 or Vero cells (e.g., 4D-Nucleofector™, Lonza) by electroporation. 15–22 hours after transfection, cells were fixed and permeabilized (eBioscience™ Foxp3 / Transcription Factor Staining Buffer Set, Invitrogen) and stained with a PE-conjugated anti-dsRNA mouse monoclonal antibody (J2, Scicons). The frequency of dsRNA+ cells and the mean fluorescence intensity (MFI) of dsRNA in individual cells were quantified by fluorescence flow cytometry.

[0181] Protein expression: RNA was transfected into BHK-21 or Vero cells (e.g., 4D-Nucleofector™, Lonza) by electroporation. ESR1: Cells were harvested 15–22 h posttransfection and lysed with RIPA buffer. Lysate protein concentrations were normalized and then probed by immunoblot with an anti-ERα rabbit antibody (A300-497A, Bethyl) and imaged using an AF800-conjugated anti-rabbit goat antibody (A32735, Thermo) (Figure 2A). Fluorescence signals from cell samples transformed with a synthetic monogene EEEV replicon expressing ESR1 were used to normalize expression levels to assess relative ESR1 expression from panels of two- and four-gene replicons (Figure 2B). PI3K: Cells were harvested 15–22 h posttransfection and lysed with RIPA buffer. Lysate protein concentrations were normalized and then probed by immunoblot with anti-PI3KCA rabbit antibody (PA587398, Thermo) and imaged using AF800-conjugated anti-rabbit goat antibody (A32735, Thermo) (Figure 2C). Fluorescent signals from cell samples transformed with a synthetic monogene EEEV replicon expressing PI3K were used to normalize expression levels to assess relative PI3K expression from panels of two- and four-gene replicons (Figure 2B). HER2: At 15–22 h posttransfection, cells were fixed and permeabilized (eBioscience™ Foxp3 / Transcription Factor Staining Buffer Set, Invitrogen) and stained with AF488-conjugated anti-HER2 mouse monoclonal antibody (24D2, Biolegend). The mean fluorescence intensity (MFI) of AF488 was used as a readout for HER2 expression. The MFI of cells transformed with a synthetic monogene EEEV replicon expressing HER2 was used to normalize expression levels to assess relative HER2 expression from panels of two-gene and four-gene replicons ( Fig. 2E ).HER3: At 15–22 h posttransfection, cells were fixed and permeabilized (eBioscience™ Foxp3 / Transcription Factor Staining Buffer Set, Invitrogen) and stained using an APC-conjugated anti-HER3 mouse monoclonal antibody (2 IB4C3, Biolegend). The mean fluorescence intensity (MFI) of APC was used as a readout for HER3 expression. The MFI of cells transformed with a synthetic monogenic EEEV replicon expressing HER3 was used to normalize expression levels to assess relative HER3 expression from panels of bigenic and tetragenic replicons (Figure 2F). Normalized ESR1, PI3K, HER2, and HER3 expression data from the tetragenic replicon were visualized by spider graph (Figure 2G). Example 3. In vivo evaluation of modified EEEV vectors

[0182] This example describes the results of in vivo experiments performed to evaluate any differential immune responses following vaccination with the synthetic EEEV replicon constructs described herein (e.g., both unformulated and LNP-formulated vectors).

[0183] In these experiments, a synthetic replicon construct derived from EEEV strain FL93-939 was designed and subsequently evaluated.

[0184] Mice and Injections: BALB / c mice were purchased from Charles River Labs, Envigo, or Jackson Laboratories. On the day of dosing, 0.01-10 μg of material was injected intramuscularly in divided doses into one or both quadriceps muscles. Vector was administered unformulated in saline or LNP-formulated. Animals were monitored for weight and other general observations throughout the course of the study. For immunogenicity studies, animals were dosed on day 0 only or on days 0 and 21.

[0185] LNP formulation: srRNA was formulated into lipid nanoparticles using a microfluidic mixer and analyzed for particle size and polydispersity using dynamic light scattering and encapsulation efficiency. Lipids were suspended in ethanol. For L1, RNA was suspended in 10 mM citrate buffer, pH 5.0, at a concentration of 172 μg / ml and mixed at a flow rate of 3:1 (aqueous:organic). For L2, RNA was suspended in 250 mM NaOAc, pH 4.0, at a concentration of 82 μg / ml and mixed at a flow rate of 3:1 (aqueous:organic).

[0186] ELISpot. To measure the magnitude of ESR1-, HER2-, or HER3-specific T cell responses, IFNγ ELISpot analysis was performed using the Mouse IFNγ ELISpot PLUS Kit (HRP) (MabTech) according to the manufacturer's instructions. Briefly, splenocytes were isolated and 5 × 10 6 Cells were resuspended to a concentration of 1000 cells / mL in medium containing ESR1, HER2, and HER3 as positive controls, a PMA / ionomycin-derived peptide, or DMSO as a mock stimulation. Linker Evaluation

[0187] Figure 1 shows the results of a mouse IFNγ detection ELISpot assay, as measured by spot-forming units corresponding to responder splenic T cells, 14 days after intramuscular injection of monogenic replicon RNA encoding ESR1 mutations with various sequences and internal linkers. The AAY, EAAAK, RVRR, GGGGS, and GPGPG linkers were tested in various sequences in ESR1 antigen cassettes containing the K303R, E380Q, Y537C, Y537S, Y537N, and D538G mutations. The rows for each cassette correspond to the following stimulation conditions with a single peptide in the following order: K303R, E380Q, Y537N, Y537S, Y537C, D538G, wild-type ESR1, and medium. The total T cell response (plotted as spot-forming units counted per million cells) is shown on the Y-axis. The GGGGS linker of sequence 1 generated the most robust T cell responses. Evaluation of gene number and rank

[0188] Figure 3 shows the results of a mouse IFNγ detection ELISpot assay, as measured by spot-forming units corresponding to responder splenic T cells, 35 days after two intramuscular injections of replicon RNA encoding ESR1, HER2, and HER3. Various constructs, either monogenic, digenic, or tetragenic, with various sequences and connecting sequences of ESR1, PI3K, HER2, and HER3 were tested to determine which configuration of genes within the construct produced the most robust T cell response upon stimulation. The Y-axis indicates the total T cell response. PI3K responses were not measured in this experiment because they do not produce a response in BALB / c mice. Evaluation of genetic and lipid formulation sequences

[0189] The results of a mouse ELISpot assay detecting IFNγ, as measured by spot-forming units corresponding to responder splenic T cells, 35 days after two intramuscular injections of replicon RNA either in saline or formulated in two different LNP compositions, L1 or L2, encoding ESR1, PI3K, HER2, and HER3, are shown in Figure 5. Various four-gene constructs with different replicon vector backbones were tested to determine which RNA replicon vector and formulation produced the most robust T cell response upon stimulation. Example 4. Efficacy against estrogen receptor-positive breast cancer

[0190] Two efficacy models are shown in Figure 6 to mimic two clinical scenarios. In the therapeutic model, a tumor cell line expressing the resistance mutation targeted by the vaccine is first implanted. This is followed by administration of the vaccination. This simulates the scenario of a treated patient with a pre-existing mutation. In the preventive model, the vaccination is administered before implantation of a tumor cell line encoding the resistance mutation contained in the vaccine. This scenario mimics a treated patient before the emergence of acquired mutations. Administration of replicon RNA encoding the mutation(s) expressed by the tumor cell line should elicit a robust T cell response in mice, leading to delayed tumor growth. If tumor growth is not delayed, this likely indicates that the tumor cell line has evolved to lose the targeted mutation and that the replicon RNA can exert selective pressure by the immune system to lose the activating mutation.

[0191] While certain alternatives of the present disclosure have been disclosed, it is to be understood that various modifications and combinations are possible and are contemplated within the true spirit and scope of the appended claims. Accordingly, no limitations are intended to the precise summary and disclosure presented herein.

Claims

1. 1. A nucleic acid construct comprising a nucleic acid sequence encoding a modified Eastern Equine Encephalitis Virus (EEEV) genome or self-replicating RNA (srRNA), wherein at least a portion of the nucleic acid sequence of the modified EEEV genome or srRNA that encodes a viral structural protein is as follows: a) the coding sequence of estrogen receptor 1 (ESR1) or a variant thereof; b) a coding sequence for PI3K or a variant thereof; c) a coding sequence for HER2 or a variant thereof; and d) the coding sequence of HER3 or a variant thereof; wherein the nucleic acid construct is replaced by a coding sequence for a polypeptide construct comprising:

2. 2. The nucleic acid construct of claim 1, wherein the modified EEEV genome or srRNA does not contain a nucleic acid sequence encoding a viral structural protein.

3. 2. The nucleic acid construct of claim 1, wherein the nucleic acid sequence encoding the modified EEEV or srRNA is operably linked to a promoter sequence.

4. 2. The nucleic acid construct of claim 1, wherein the coding sequences of (a) to (d) are operably linked to each other in a single open reading frame (ORF).

5. 2. The nucleic acid construct of claim 1, wherein the coding sequences of (a) to (d) are operably linked to each other by one or more connector sequences encoding an autoproteolytic peptide or an internal ribosome entry site (IRES).

6. 6. The nucleic acid construct of claim 5, wherein the autoproteolytic peptide comprises one or more autoproteolytic cleavage sequences derived from calcium-dependent serine endoprotease (furin), porcine teschovirus-1 2A (P2A), foot-and-mouth disease virus (FMDV) 2A (F2A), equine rhinitis A virus (ERAV) 2A (E2A), Zosea asignavirus 2A (T2A), cytoplasmic polyhedrosis virus 2A (BmCPV2A), flacherie virus 2A (BmIFV2A), or a combination thereof.

7. 6. The nucleic acid construct of claim 5, wherein the internal ribosome entry site (IRES) is derived from Kaposi's sarcoma-associated herpesvirus (KSHV) IRES, hepatitis virus IRES, pestivirus IRES, Cripavirus IRES, Rhopalocyptomycin IRES, fibroblast growth factor IRES, platelet-derived growth factor IRES, vascular endothelial growth factor IRES, insulin-like growth factor IRES, picornavirus IRES, encephalomyocarditis virus (EMCV) IRES, Pim-1 IRES, p53 IRES, Apaf-1 IRES, TDP2 IRES, L-myc IRES, and c-myc IRES.

8. 2. The nucleic acid construct of claim 1, wherein at least one of the coding sequences (a) to (d) comprises one or more molecular modifications.

9. The nucleic acid of claim 8, wherein the one or more molecular modifications are configured into multiple modification cassettes arranged in tandem along the length of the coding sequence.

10. The nucleic acid of claim 9, wherein the multiple modified cassettes are operably linked to each other by one or more linkers.

11. The nucleic acid construct of claim 8, wherein the coding sequence of the ESR1 mutant of (a) contains one or more molecular modifications that promote ligand-independent receptor activity.

12. 12. The nucleic acid construct of claim 11, wherein the one or more molecular modifications comprise an activating mutation selected from the group consisting of K303R, E380Q, Y537C, Y537S, Y537N, and D538G.

13. The nucleic acid construct of claim 8, wherein the PI3K mutant of (b) comprises one or more molecular modifications that promote ligand-independent receptor activity.

14. 14. The nucleic acid construct of claim 13, wherein the one or more molecular modifications comprise an activating mutation selected from the group consisting of E542K, E545K, H1047L, and H1047R.

15. The nucleic acid construct of claim 1, wherein the HER2 mutant in (c) comprises coding sequences for an extracellular domain and a transmembrane domain.

16. The nucleic acid construct of claim 1, wherein the HER3 mutant in (d) comprises a coding sequence for kinase-inactive HER3.

17. 2. The nucleic acid construct of claim 1, wherein the nucleic acid sequence has at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 7-10.

18. 2. The nucleic acid construct of claim 1, wherein the coding sequence of the polypeptide construct comprises, in the 5' to 3' direction, the following: a) a coding sequence for a mutant of PI3K comprising one or more activating mutations selected from E542K, H1047L, E545K, and H1047R; b) a coding sequence for the autoproteolytic peptide P2A; c) a coding sequence for a mutant of HER2 comprising its extracellular domain and transmembrane domain; d) a coding sequence for the autoproteolytic peptide P2A; e) a coding sequence for a kinase-inactive mutant of HER3; f) a coding sequence for an internal ribosome entry site (IRES); and g) a coding sequence for a mutant of ESR1 comprising one or more activating mutations selected from Y537C, E380Q, K303R, Y537S, D538G, and Y537N.

19. A recombinant cell comprising the nucleic acid construct of claim 1.

20. 20. The recombinant cell of claim 19, wherein the recombinant cell is a mammalian cell or an insect cell.

21. A pharmaceutical composition comprising a pharmaceutically acceptable excipient and the nucleic acid construct of claim 1.

22. 22. The pharmaceutical composition of claim 21, wherein the composition is formulated into a delivery system using a delivery vehicle, wherein the delivery system comprises a liposome, a viral replicon particle (VRP), a lipid-based nanoparticle (LNP), a polymeric nanoparticle, a physiological buffer, a microsphere, an immune stimulating complex (ISCOM), a conjugate of a biologically active ligand, or any combination thereof.

23. 23. The pharmaceutical composition of claim 22, wherein the lipids are present in a lipid to RNA mass ratio of about 100:1 to about 4:

1.

24. 23. The pharmaceutical composition of claim 22, wherein the lipid-based nanoparticles have an average diameter of about 25 nm to about 1000 nm.

25. 22. The pharmaceutical composition of claim 21, wherein the composition is formulated as a vaccine.

26. 10. A method for inducing an immune response or treating a condition in a subject in need thereof, comprising administering to the subject a composition comprising the nucleic acid construct of claim 1.

27. 27. The method of claim 26, wherein the method is a method of eliciting an immune response.

28. 27. The method of claim 26, wherein the method is a method for treating cancer.

29. 29. The method of claim 28, wherein the cancer is breast cancer.

30. 26. The method of claim 25, wherein the composition is administered to the subject individually as a monotherapy or as a first therapy in combination with at least one additional therapy.

Images