Immunostimulatory bacterial delivery platform and its use for delivery of therapeutic products
Modified immunostimulatory bacteria accumulate in tumor cells to express therapeutic products, addressing immune evasion and enhancing anti-cancer responses, thus overcoming limitations of current cancer immunotherapies.
Patent Information
- Application Number
- JP2025184585
- Authority / Receiving Office
- JP · JP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2020-03-16
- Filing Date
- 2025-10-31
- Publication Date
- 2026-02-10
- Estimated Expiration
- Not applicable · inactive patent
AI Technical Summary
Current cancer immunotherapies face challenges in overcoming immune tolerance and evading autoimmune toxicities, while tumors develop mechanisms to evade immune surveillance and mutate resistance to existing treatments.
Immunostimulatory bacteria with modified genomes to accumulate in tumor-resident immune cells, expressing therapeutic products like IL-2, IL-12, and STING pathway agonists under eukaryotic promoters, reducing toxicity and enhancing anti-cancer responses.
The bacteria effectively deliver therapeutic products to the tumor microenvironment, stimulating robust anti-cancer responses and overcoming immune evasion, while minimizing systemic toxicity.
Smart Images

Figure 2026021469000001_ABST
Abstract
Description
[Technical Field]
[0001] Related Applications The benefit of priority is claimed to be based on co-pending U.S. Provisional Application No. 62 / 990,404, filed March 16, 2020, entitled "TUMOR-SPECIFIC IMMUNOSTIMULATORY BACTERIA DELIVERY PLATFORM," applicant Actym Therapeutics, Inc., and inventors Laura Hix Glickman, Christopher D. Thanos, Alexandre Charles Michel Iannello, Chris Rae, and Haixing Kehoe.
[0002] The present application also claims the benefit of priority to co-pending U.S. Provisional Application No. 62 / 962,162, filed January 16, 2020, entitled "TUMOR-SPECIFIC IMMUNOSTIMULATORY BACTERIA DELIVERY PLATFORM," applicant Actym Therapeutics, Inc., and inventors Laura Hix Glickman, Christopher D. Thanos, Alexandre Charles Michel Iannello, Chris Rae, and Haixing Kehoe.
[0003] The present application also claims the benefit of priority to co-pending U.S. Provisional Application No. 62 / 934,503, filed November 12, 2019, entitled "TUMOR-SPECIFIC IMMUNOSTIMULATORY BACTERIA DELIVERY PLATFORM," applicant Actym Therapeutics, Inc., and inventors Laura Hix Glickman, Christopher D. Thanos, Alexandre Charles Michel Iannello, Chris Rae, and Haixing Kehoe.
[0004] This application is related to co-pending International Application No. PCT / US2020 / 020240, filed February 27, 2020, entitled "IMMUNOSTIMULATORY BACTERIA ENGINEERED TO COLONIZE TUMORS, TUMOR-RESIDENT IMMUNE CELLS, AND THE TUMOR MICROENVIRONMENT," applicant Actym Therapeutics, Inc., and inventors Christopher D. Thanos, Laura Hix Glickman, Justin Skoble, Alexandre Charles Michel Iannello, and Haixing Kehoe.
[0005] This application is also related to co-pending U.S. Provisional Application No. 62 / 962,140, filed January 16, 2020, entitled "IMMUNOSTIMULATORY BACTERIA ENGINEERED TO COLONIZE TUMORS, TUMOR-RESIDENT IMMUNE CELLS, AND THE TUMOR MICROENVIRONMENT," applicant Actym Therapeutics, Inc., and inventors Christopher D. Thanos, Laura Hix Glickman, Justin Skoble, Alexandre Charles Michel Iannello, and Haixing Kehoe.
[0006] This application is also related to co-pending U.S. Provisional Application No. 62 / 934,478, filed November 12, 2019, entitled "IMMUNOSTIMULATORY BACTERIA ENGINEERED TO COLONIZE TUMORS AND THE TUMOR MICROENVIRONMENT," applicant Actym Therapeutics, Inc., and inventors Christopher D. Thanos, Laura Hix Glickman, Justin Skoble, and Alexandre Charles Michel Iannello.
[0007] This application is also related to International Application No. PCT / US2018 / 041713, filed July 11, 2018 (published January 17, 2019 as WO 2019 / 014398), and co-pending U.S. Patent Application No. 16 / 033,187, filed July 11, 2018 (published January 17, 2019 as U.S. Patent Application Publication No. 2019 / 0017050 A1), each entitled "ENGINEERED IMMUNOSTIMULATORY BACTERIAL STRAINS AND USES THEREOF," which applications claim priority to U.S. Provisional Application No. 62 / 531,327, filed July 11, 2017, and U.S. Provisional Application No. 62 / 648,380, filed March 26, 2018, respectively. Where permitted, the subject matter of each of these applications is incorporated by reference in its entirety.
[0008] This application is also related to co-pending International Application No. PCT / US2019 / 041489, filed July 11, 2019 (published January 16, 2020 as WO 2020 / 014543), and co-pending U.S. patent application Ser. No. 16 / 520,155, filed July 23, 2019 (each entitled "ENGINEERED IMMUNOSTIMULATORY BACTERIAL STRAINS AND USES THEREOF"), which applications claim priority to U.S. Provisional Application No. 62 / 789,983, filed January 8, 2019, and U.S. Provisional Application No. 62 / 828,990, filed April 3, 2019, respectively.
[0009] This application is also related to U.S. Provisional Application No. 62 / 811,521, filed February 27, 2019, and U.S. Patent Application No. 62 / 828,990, filed April 3, 2019.
[0010] The immunostimulatory bacteria provided in each of these applications can be modified as described in the present application, and such bacteria are incorporated herein by reference. Where permitted, the subject matter of each of these applications is incorporated by reference in its entirety.
[0011] Incorporation by reference of electronically provided sequence listings An electronic version of the Sequence Listing is filed herewith, the contents of which are incorporated by reference in their entirety. The electronic file was created on November 11, 2020. The size is 687 kilobytes and is titled 1707SEQPC1.txt. A revised Sequence Listing is filed electronically herewith, the contents of which are incorporated by reference in their entirety. The electronic file was created on March 26, 2021. The size is 687 kilobytes and is titled 1707SEQPC2.txt.
[0012] FIELD OF THE INVENTION Provided are attenuated immunostimulatory bacteria having genomes that have been modified to, for example, reduce toxicity and improve antitumor activity, by increasing accumulation in the tumor microenvironment, particularly in tumor-resident myeloid cells, improving resistance to complement inactivation, reducing immune cell death, promoting adaptive immunity, and enhancing T cell function. Increased phagocyte colonization improves delivery of the encoded therapeutic product to the tumor microenvironment and tumor, allowing for systemic administration of the immunostimulatory bacteria, among other routes. [Background technology]
[0013] The field of cancer immunotherapy has made great strides, as evidenced by the clinical success of anti-CTLA-4, anti-PD-1, and anti-PD-L1 immune checkpoint antibodies [see, e.g., Buchbinder et al. (2015) J. Clin. Invest. 125:3377-3383; Hodi et al. (2010) N. Engl. J. Med. 363(8): 711-723; and Chen et al. (2015) J. Clin. Invest. 125:3384-3391]. Tumors have evolved a significantly immunosuppressive environment. Tumors initiate multiple mechanisms to evade immune surveillance, reprogram antitumor immune cells to suppress immunity, and continually mutate resistance to current cancer therapies [see, e.g., Mahoney et al. (2015) Nat. Rev. Drug Discov. 14(8): 561-584]. Overcoming immune tolerance and designing immunotherapies and cancer treatments that avoid but limit the autoimmune-related toxicities of current immunotherapies is a challenge in the field of immuno-oncology. Therefore, additional and innovative immunotherapies and other treatments are needed. Summary of the Invention
[0014] Provided herein are immunostimulatory bacteria that contain genome modification and a plasmid that encodes one or more therapeutic products, such as anti-cancer therapeutic agents or related treatments.Genome modification causes the immunostimulatory bacteria to accumulate in tumor-resident immune cells within the tumor microenvironment, where the encoded therapeutic products are expressed.The immunostimulatory bacteria provided herein encode one or more complementary products that stimulate, induce or produce a robust anti-cancer response in subjects.
[0015] Provided herein are immunostimulatory bacteria containing a plasmid encoding a therapeutic product or combination of therapeutic products under the control of a eukaryotic promoter. The genome of the bacteria has been modified, e.g., a) deletion, disruption, or inactivation of all or a sufficient portion of the gene, whereby the bacterium is modified to produce pentaacylated lipopolysaccharide (LPS); The genome of an immunostimulatory bacterium is modified by deletion or disruption of all or a sufficient portion of a gene, thereby modifying the bacterium to produce pentaacylated lipopolysaccharide (LPS); and / or deletion, disruption or inactivation of hexaacylated lipopolysaccharide, such that it is substantially reduced to at least 10-fold or absent compared to wild-type bacteria; b) deletion, disruption, or inactivation of all or a sufficient portion of the gene, whereby the bacterium is attenuated in recognition by the Toll-like receptors (TLR), TLR2, TLR4, and TLR5; c) deletion, disruption or inactivation of all or a sufficient portion of the gene so that the bacterium does not activate the synthesis of curli and / or cellulose; d) deletion, disruption or inactivation of all or a sufficient portion of the gene so that the bacterium does not activate the synthesis of secreted asparaginase; e) deletion, disruption, or inactivation of all or a sufficient portion of a gene, thereby rendering the bacterium auxotrophic for purines, adenosine, or ATP; f) deletion, disruption or inactivation of all or a sufficient portion of the gene, whereby the bacterium loses its flagellum; g) deletion, disruption, or inactivation of all or a sufficient portion of the gene, whereby the bacterium is modified to specifically infect tumor-resident myeloid cells; h) deletion, disruption, or inactivation of all or a sufficient portion of the gene, whereby the bacterium is modified to specifically infect tumor-resident myeloid cells and is unable to replicate within the tumor-resident myeloid cells; and i) Deletion or disruption or inactivation of either or both of lppA and lppB, which reduces or eliminates lipoprotein expression at the membrane, thereby increasing expression of the encoded therapeutic protein within the tumor microenvironment and / or tumor-resident immune cells. The amino acid sequence may contain one, two, or more modifications selected from the following:
[0016] For example, the immunostimulatory bacteria contain modifications, including deletions, insertions, and substitutions, of a), d), and f), or modifications c) and d), or modifications a), c), d), e), and f), or modifications a), c), d), e), f), and i), or modifications a), d), f), and i), or modifications c), d), and i), or modifications f) and i), or modifications a) through i), or modifications a), b), d), and f), or modifications a), b), c), and d), and other combinations of a) through i).
[0017] In all embodiments, the immunostimulatory bacteria may also or further comprise a deletion or disruption of the gene encoding the flagellum, thereby causing the bacteria to express flagellin - (fliC - / fljB - ) and do not produce flagella, whereas wild-type bacteria have flagella. The immunostimulatory bacteria may be auxotrophic for purines, e.g., auxotrophic for adenosine, or auxotrophic for adenosine, adenine, and / or ATP. The immunostimulatory bacteria may also be auxotrophic for purI. - The immunostimulatory bacteria may also be pagP. - The immune-stimulating bacteria may also be asd - (Aspartate semialdehyde dehydrogenase - ), for example, the bacterium can be an aspartate semialdehyde dehydrogenase (asd) gene by disruption or deletion of all or part of the endogenous gene encoding aspartate semialdehyde dehydrogenase (asd). -The bacterium can encode aspartate semialdehyde dehydrogenase (asd) on a plasmid under the control of a bacterial promoter, thereby preventing endogenous asd expression. The immune-stimulating bacterium can also encode msbB. - or pagP - / msbB - For example, the immune stimulating bacteria may be asd - , purI - , msbB - , flagellin - (fliC - / fljB - ), and pagP - or asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), and pagP - In some embodiments, the immunostimulatory bacteria may be ansB. - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), and pagP - is.
[0018] Provided are immunostimulatory bacteria containing a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, or encoding multiple products under the control of multiple eukaryotic promoters or a single promoter. The genome of the immunostimulatory bacteria has been modified by deletion of a sufficient portion of a gene or disruption of a gene, such that the bacterium contains ansB. - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), and pagP- The immunostimulatory bacteria provided herein also include those in which the genes lppA (lpp1) and / or lppB (lpp2), which encode the major outer membrane lipoproteins Lpp1 (LppA) and Lpp2 (LppB), respectively, have been deleted or disrupted to eliminate or substantially reduce expression of the encoded lipoproteins. In particular, the bacterium may be one or more of the following: lppA - and lppB - Provided are plasmids containing an anti-cancer therapeutic agent under the control of eukaryotic regulatory sequences, including lppA. - and lppB - For example, the immunostimulatory bacterium is an ansB - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), pagP - , lppA - , and lppB - It could be.
[0019] In embodiments herein, the therapeutic product is an anti-cancer therapeutic or therapeutic agent used in cancer treatment. The encoded product may be operably linked to a nucleic acid encoding a secretion signal, such that upon expression, the therapeutic product is secreted, e.g., from tumor-resident immune cells.
[0020] Additionally, any of the immunostimulatory bacteria may have one or more genes or operons deleted or inactivated that are involved in Salmonella pathogenicity island 1 (SPI-1) invasion, such that the immunostimulatory bacteria do not invade or infect epithelial cells. For example, the one or more genes / operons are selected from avrA, hilA, hilD, invA, invB, invC, invE, invF, invG, invH, invI, invJ, iacP, iagB, spaO, spaQ, spaR, spaS, orgA, orgB, orgC, prgH, prgI, prgJ, prgK, sicA, sicP, sipA, sipB, sipC, sipD, sirC, sopB, sopD, sopE, sopE2, sprB, and sptP.
[0021] The plasmid in the immunostimulatory bacterium may be present at low or medium copy number. The plasmid may contain a medium to low copy number origin of replication, for example, a low copy number origin of replication. In some embodiments, the plasmid is present at a higher copy number. Typically, a medium copy number is less than 150 or less than about 150 and more than 20 or more than about 20, or 20 or 25 to 150; a low copy number is less than 25, or less than 20, or less than about 25, or less than about 20 copies. In particular, a low to medium copy number is less than about 150 copies, or less than 150 copies; a low copy number is less than about 25 copies, or less than 25 copies.
[0022] Provided are nucleic acid constructs, which are nucleic acid molecules encoding products such as proteins, designed to be introduced into cells or plasmids for expression of the encoded products. The constructs contain nucleic acids encoding multiple anti-cancer products as polycistronic sequences under the control of a single promoter. The promoter can be a eukaryotic promoter. Other eukaryotic regulatory sequences, such as enhancers, nucleic acids encoding protein export signals, such as secretion signals, other regulatory sequences, such as terminators, including bacterial terminators that prevent readthrough from bacterial promoters on the construct, and the specific configuration and order of nucleic acid open reading frames and / or genetic elements encoding the products are provided and described herein. In the constructs, the polycistronic sequences can include signals or encoded signals, such as peptides, that result in expression of the separate products encoded by the polycistronic construct. An example of such a peptide is the 2A family of viral peptides. The constructs include such peptides or other signals between each open reading frame encoding each product. 2A peptides include one or more of T2A, P2A, E2A, or F2A.
[0023] Anti-cancer products include anything used in the treatment of cancer or anything that promotes, assists, stimulates, or facilitates an anti-cancer response in a subject. Typically, anti-cancer products are proteins. The encoded product includes one or more immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment. Exemplary encoded products include immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment, such as any selected from one or more of the following: IL-2, IL-7, IL-12p70 (IL-12p40+IL-12p35), IL-15, IL-2 with reduced binding to IL-2Ra, IL-15 / IL-15R alpha chain complex, IL-18, IL-21, IL-23, IL-36γ, IL-2 modified to not bind to IL-2Ra, CXCL9, CXCL10, CXCL11, IL-15R ... Interferon-α, interferon-β, interferon-γ, CCL3, CCl4, CCL5, proteins involved in, causing, or enhancing T cell recruitment / persistence, costimulatory proteins such as CD40, CD40 ligand (CD40L), CD28, OX40, OX40 ligand (OX40L), 4-1BB, 4-1BB ligand (4-1BBL) (which may have modifications that facilitate correct orientation in the cell (i.e., cytoplasmic domain within the cytoplasm), including forms of costimulatory proteins that have deleted or truncated cytoplasmic domains that abolish immunosuppressive reverse signaling); members of the B7-CD28 family, CD47 antagonists, anti-IL-6 antibodies or IL-6 binding decoy receptors, TGF-beta polypeptide antagonists (including soluble TGF-beta receptors and TGF-beta antagonists), and members of the tumor necrosis factor receptor (TNFR) superfamily.
[0024] Other products include IFN-α, IFN-β, GM-CSF, IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, IL-23, IL-12p70 (IL-12p40 + IL-12p35), IL-15 / IL-15R alpha chain complex, IL-36 gamma, IL-2 with reduced binding to IL-2Ra, IL-2 modified to not bind IL-2Ra, CXCL9, CXCL10 (IP-10), CXCL11, CCL3, CCL4, CCL5, molecules involved in T cell recruitment and / or persistence, CD40, CD40 ligand (CD40L), and O. The constructs include immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment, selected from one or more of X40, OX40 ligand (OX40L), 4-1BB, 4-1BB ligand (4-1BBL), cytoplasmic domain-deleted (4-1BBLΔcyt) or partially cytoplasmic domain-deleted 4-1BBL (the cytoplasmic domain is deleted or truncated to abolish immunosuppressive counter-signaling), members of the B7-CD28 family, and members of the tumor necrosis factor receptor (TNFR) superfamily. For example, the constructs may contain nucleic acids encoding 4-1BBL with deleted or partially deleted cytoplasmic domains or with partially deleted cytoplasmic domains and amino acid modifications such that the resulting 4-1BBL assumes the appropriate orientation when expressed in cells [see SEQ ID NOs: 389-392 and the detailed description below, which provide exemplary modified 4-1BBL mutants with truncated cytoplasmic domains.
[0013] In this construct, residues are replaced with positively charged residues (i.e., K and L) to provide proper orientation when expressed in cells. The cytoplasmic domain is sufficiently truncated to eliminate or reduce immunosuppressive reverse signaling. Thus, constructs containing nucleic acids encoding 4-1BBL with a deleted or partially deleted cytoplasmic domain, or modified 4-1BBL with a truncated and modified cytoplasmic domain, are provided; the sequences of 4-1BBL are set forth in SEQ ID NOs: 389-392, and the sequences are exemplified in the detailed description and examples below.Constructs also include the following products and product combinations: one or more of IL-12, or IL-15, or IL12p70, or IL-15 / IL-15R alpha chain complex; cytokines and STING pathway agonists; cytokines, STING pathway agonists, and costimulatory molecules or immune checkpoint inhibitors; cytokines, STING pathway agonists, and TGF-beta polypeptide antagonists; cytokines, STING pathway agonists, TGF-beta polypeptide antagonists, and costimulatory molecules (receptors or ligands) or immune checkpoint inhibitors; and STING pathway agonist is any product that increases type I interferon expression through activation of STING pathway.Examples include constructs encoding stimulator of interferon genes (STING) polypeptides, or variants or chimeras thereof, as detailed herein.One of the constructs includes the following combination: anti-CTLA-4 antibody and STING polypeptide, IL-15 and STING polypeptides, 4-1BBL and STING polypeptides, TGF beta decoy receptor or polypeptide antagonist and STING polypeptide, IL-12 and STING polypeptides, anti-CTLA-4 antibody, IL-15, and STING polypeptide, 4-1BBL, IL-15, and STING polypeptides, TGF beta decoy receptor or polypeptide antagonist, IL-15, and STING polypeptide, anti-CTLA-4 antibody, IL-12, and STING polypeptide, 4-1BBL, IL-12, and STING polypeptides, TGF beta decoy receptor or polypeptide antagonist, IL-12, and STING polypeptide, anti-CTLA-4 antibodies, IL-15, TGF-beta decoy receptor or polypeptide antagonists, and STING polypeptides, 4-1BBL, IL-15, TGF beta decoy receptor or polypeptide antagonist, and STING polypeptide, anti-CTLA-4 antibodies, IL-12, TGF-beta decoy receptor or polypeptide antagonists, and STING polypeptides, 4-1BBL, IL-12, TGF beta decoy receptor or polypeptide antagonist, and STING polypeptide, anti-CTLA-4 antibody, IL-12, IL-15, and STING polypeptide, 4-1BBL, IL-12, IL-15, and STING polypeptides, TGF beta decoy receptor or polypeptide antagonists, IL-12, IL-15, and STING polypeptides, TGF beta decoy receptor or polypeptide antagonists, IL-12, IL-15, and STING polypeptides, anti-CTLA-4 antibodies, IL-12, IL-15, TGF-beta decoy receptor or polypeptide antagonists, and STING polypeptides; 4-1BBL, IL-12, IL-21, TGF beta decoy receptor or polypeptide antagonist, and STING polypeptide, anti-CTLA-4 antibodies, IL-12, IL-15, and TGF-beta decoy receptor or polypeptide antagonists, 4-1BBL, IL-12, IL-21, and TGF beta decoy receptor or polypeptide antagonists, IL-12, IL-15, and STING polypeptides, IL-15, IL-21, and STING polypeptides, IL-12, IL-21, and STING polypeptides, anti-CTLA-4 antibody, IL-15, IL-21, and STING polypeptide, anti-CTLA-4 antibody, IL-12, IL-21, and STING polypeptide, 4-1BBL, IL-15, IL-21, and STING polypeptides, 4-1BBL, IL-12, IL-21, and STING polypeptides, anti-CTLA-4 antibody and IL-15, anti-CTLA-4 antibodies, IL-15, and TGF-beta decoy receptor or polypeptide antagonists, 4-1BBL and IL-15, 4-1BBL, IL-15, and TGF beta decoy receptor or polypeptide antagonists, anti-CTLA-4 antibody and IL-12, anti-CTLA-4 antibodies, IL-12, and TGF-beta decoy receptor or polypeptide antagonists, 4-1BBL and IL-12, 4-1BBL, IL-12, and TGF beta decoy receptor or polypeptide antagonists, anti-CTLA-4 antibodies and TGF beta decoy receptor or polypeptide antagonists, 4-1BBL and TGF beta decoy receptor or polypeptide antagonists, IL-15 and TGF beta decoy receptor or polypeptide antagonists, IL-12 and TGF beta decoy receptor or polypeptide antagonists, IL-12, IL-15 and TGF beta decoy receptor or polypeptide antagonists, and IL-15, IL-21, and TGF-beta decoy receptor or polypeptide antagonists and encoding a combination of therapeutic products selected from the anti-CTLA-4 antibody is an scFv or scFv-Fc; STING polypeptides include wild-type STING, or mutant STING polypeptides, or chimeric STING polypeptides, and chimeric STING proteins having amino acid substitutions that confer, for example, a gain of function; 4-1BBL is cytoplasmic domain-deleted 4-1BBL, cytoplasmic domain-modified 4-1BBL, cytoplasmic domain-truncated 4-1BBL, or cytoplasmic domain-truncated modified 4-1BBL.
[0025] Other constructs include: IL-2 and IL-12p70; IL-2 and IL-21; IL-2, IL-12p70, and STING gain-of-function (GOF) mutants; IL-2, IL-21, and STING GOF mutants; IL-2, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt) (Δcyt is a deletion of the cytoplasmic domain); IL-2, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα and STING GOF mutants; IL-15 / IL-15Rα, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα and IL-12p70; IL-15 / IL-15Rα and IL-21; IL-15 / IL-15Rα, IL-12p70, and STING GOF mutants; IL-15 / IL-15Rα, IL-21, and STING GOF mutants; IL-15 / IL-15Rα, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and IL-21; IL-12p70, IL-21, and STING GOF mutants; IL-12p70, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and STING GOF mutants; IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and IL-18; IL-12p70, IL-18, and STING GOF mutants; IL-12p70, IL-18, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or antagonist polypeptides, IL-2, and IL-12p70; TGF-β decoy receptor or antagonist polypeptides, IL-2 and IL-21; TGF-β decoy receptor or antagonist polypeptides, IL-2, IL-12p70, and STING GOF mutants; TGF-β decoy receptor or antagonist polypeptides, IL-2, IL-21, and STING GOF mutants; TGF-β decoy receptor or antagonist polypeptides, IL-2, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or antagonist polypeptides, IL-2, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or antagonist polypeptides, IL-15 / IL-15Rα, and STING GOF mutants; TGF-β decoy receptor or antagonist polypeptides, IL-15 / IL-15Rα, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or antagonist polypeptides, IL-15 / IL-15Rα, and IL-12p70; TGF-β decoy receptor or antagonist polypeptides, IL-15 / IL-15Rα, and IL-21; TGF-β decoy receptor or antagonist polypeptides, IL-15 / IL-15Rα, IL-12p70, and STING GOF mutants; TGF-β decoy receptor or antagonist polypeptides, IL-15 / IL-15Rα, IL-21, and STING GOF mutants; TGF-β decoy receptor or antagonist polypeptides, IL-15 / IL-15Rα, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or antagonist polypeptides, IL-15 / IL-15Rα, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or antagonist polypeptides, IL-12p70, and IL-21; TGF-β decoy receptor or antagonist polypeptides, IL-12p70, IL-21, and STING GOF mutants; TGF-β decoy receptor or antagonist polypeptides, IL-12p70, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or antagonist polypeptide and IL-12p70; TGF-β decoy receptor or antagonist polypeptides, IL-12p70, and STING GOF mutants; TGF-β decoy receptor or antagonist polypeptides, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or antagonist polypeptides, IL-12p70, and IL-18; TGF-β decoy receptor or antagonist polypeptides, IL-12p70, IL-18, and STING GOF mutants; TGF-β decoy receptor or antagonist polypeptides, IL-12p70, IL-18, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor and STING GOF mutant; anti-CTLA-4 antibody, IL-2, and IL-12p70; anti-CTLA-4 antibody, IL-2, and IL-21; anti-CTLA-4 antibody, IL-2, IL-12p70, and STING GOF mutants; anti-CTLA-4 antibody, IL-2, IL-21, and STING GOF mutants; anti-CTLA-4 antibody, IL-2, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-2, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-15 / IL-15Rα, and STING GOF mutant; anti-CTLA-4 antibody, IL-15 / IL-15Rα, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-15 / IL-15Rα, and IL-12p70; anti-CTLA-4 antibody, IL-15 / IL-15Rα, and IL-21; anti-CTLA-4 antibody, IL-15 / IL-15Rα, IL-12p70, and STING GOF mutants; anti-CTLA-4 antibody, IL-15 / IL-15Rα, IL-21, and STING GOF mutants; anti-CTLA-4 antibody, IL-15 / IL-15Rα, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-15 / IL-15Rα, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-12p70, and IL-21; anti-CTLA-4 antibody, IL-12p70, IL-21, and STING GOF mutants; anti-CTLA-4 antibody, IL-12p70, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody and IL-12p70; anti-CTLA-4 antibody, IL-12p70, and STING GOF mutant; anti-CTLA-4 antibody, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-12p70, and IL-18; anti-CTLA-4 antibody, IL-12p70, IL-18, and STING GOF mutants; anti-CTLA-4 antibody, IL-12p70, IL-18, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies and STING GOF mutants; CD40 agonist, IL-2, and IL-12p70; CD40 agonist, IL-2, and IL-21; CD40 agonist, IL-2, IL-12p70, and STING GOF mutants; CD40 agonist, IL-2, IL-21, and STING GOF mutants; CD40 agonist, IL-2, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt), CD40 agonist, IL-2, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, and STING GOF mutants; CD40 agonist, IL-15 / IL-15Rα, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, and IL-12p70; CD40 agonist, IL-15 / IL-15Rα, and IL-21; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, and STING GOF mutants; CD40 agonist, IL-15 / IL-15Rα, IL-21, and STING GOF mutants; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-12p70, and IL-21; CD40 agonist, IL-12p70, IL-21, and STING GOF mutants; CD40 agonist, IL-12p70, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist and IL-12p70; CD40 agonist, IL-12p70, and STING GOF mutants; CD40 agonist, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-12p70, and IL-18; CD40 agonist, IL-12p70, IL-18, and STING GOF mutants; CD40 agonist, IL-12p70, IL-18, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); and CD40 agonists and STING GOF mutants and those encoding a combination of therapeutic products selected from 4-1BBL is a cytoplasmic domain-deleted 4-1BBL (4-1BBLΔcyt), a cytoplasmic domain-modified 4-1BBL, a cytoplasmic domain-truncated 4-1BBL, or a cytoplasmic domain-truncated and modified 4-1BBL; The anti-CTLA-4 antibody is an scFv or scFv-Fc.
[0026] Exemplary STING polypeptides include chimeric polypeptides comprising human STING polypeptides with C-terminal tails from various species that have been modified to result in increased or constitutive expression of type I interferon, or that have lower NF-κB signaling activity than that of human STING, e.g., the TRAF6-binding site in the CTT may be deleted, and the human STING protein has the sequence set forth in any of SEQ ID NOs: 305-309. Specific combinations of encoded products include those in which the encoded therapeutic protein comprises IL-12p70 and Tasmanian devil-derived CTT and a chimeric human STING polypeptide with amino acid substitutions that result in increased or constitutive expression of type I interferon, or a STING polypeptide with amino acid substitutions that result in increased or constitutive expression of type I interferon, and in which the mutation that results in increased or constitutive expression of type I interferon is a gain-of-function mutation. Examples include STING proteins or polypeptides with substitutions described in the detailed description, such as amino acid substitutions in a STING polypeptide corresponding to R284G or N154S / R284G, with reference to any of SEQ ID NOS: 305-309, which represent the human STING protein, for alignment. These constructs may additionally encode IL-36γ and / or immune checkpoint inhibitor antibodies. The antibodies described herein include their antigen-binding portions and any of various antibody forms, including, but not limited to, scFv and scFv-Fc (generally IgG Fc), where the presence of Fc multimerizes the resulting product to have two chains. Targeted immune checkpoints include, but are not limited to, CTLA-4, PD-1, or PD-L1, and antibody forms include scFv and scFV-Fc two-chain polypeptides.
[0027] Provided are plasmids containing the constructs described above and throughout the disclosure herein, including bacterial plasmids in which the constructs are operably linked to eukaryotic transcriptional regulatory sequences.
[0028] Provided are compositions, e.g., pharmaceutical compositions, that contain a mixture of anti-cancer protein products encoded by constructs or plasmids as the only anti-cancer protein in the composition. Thus, provided herein are compositions that contain complementary combinations of therapeutic proteins; mixtures contain unique combinations of agents. Combinations include the combinations of agents provided and described herein.
[0029] Also provided are immunostimulatory bacteria containing any construct and / or plasmid.The construct and plasmid can be provided in any immunostimulatory bacteria provided herein, including any of those discussed above and below, or can be introduced into any immunostimulatory bacteria.The construct and plasmid can also be introduced into suitable bacteria known in the art, such as those described in International Publication No. 2020 / 172461 and International Publication No. 2020 / 172462, and U.S. Patent No. 10,449,237, U.S. Patent No. 10,286,051, and U.S. Patent No. 9,616,114.
[0030] The immunostimulatory bacteria provided herein include genomic modifications, such as deletions, disruptions, and modifications, such as changing the orientation of all or part of a gene, such that a functional gene product is not expressed. Among the immunostimulatory bacteria provided are those in which the resulting bacterium lacks msbB. - / purI - In some embodiments, the bacterium is modified to be msbB. - and purI - and thereby, msbB - gene and / or purI -At least the entire length of the coding portion of the gene is deleted. Alternatively, the bacterial genome can be modified to cause the bacterium to lack flagella. This occurs in bacteria that normally express flagella, such as the gene in Salmonella or fliC in other species. - / fljB - The gene equivalent to msbB may be deleted or otherwise modified so that a functional gene product is not expressed. Also, the bacterium may be modified to be an adenosine auxotroph and / or to lack msbB. - / pagP - Also provided are immunostimulatory bacteria and pharmaceutical compositions containing the same, wherein the bacteria do not express L-asparaginase II, thereby causing the bacteria to be modified to be ansB. - is.
[0031] Provided are immunostimulatory bacteria containing a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacteria has been modified by the deletion or disruption of all or a sufficient portion of a gene such that the bacterium does not activate the synthesis of a secreted asparaginase, an example of such a bacterium is one in which the asparaginase is L-asparaginase II, encoded by the gene ansB.
[0032] msbB - and purI - It is shown herein that the gene is not completely deleted in the parent strain VNP20009, which is the msbB gene. In the immunostimulatory bacteria provided, the bacterial genome contains msbB. - gene and purI - The strain is modified so that at least the entire coding portion of the gene is deleted. The strain is fitter, faster, and / or grows better than the parent strain. In all embodiments herein, the bacteria can be modified so that the native asd gene product is inactive or not expressed. To aid in producing the strain, the asd gene is encoded on a plasmid under the control of a prokaryotic promoter, such as an inducible promoter.
[0033] In an embodiment, the strain is a bacterium lacking flagella that is pagP - ,ansB - , and csgD - The bacterium also contains a modification such that purI - and asd - Therefore, what is provided is already msbB - and purI - and / or modified parent strains with other modifications, particularly strains that are also LPS-modifying Δasd / ΔFLG / ΔpagP / ΔansB / ΔcsgD. Strains can also be adenosine auxotrophs or adenosine and adenine auxotrophs.
[0034] Encoded therapeutic products include nucleic acids and proteins. A plasmid can encode two or more therapeutic products. Exemplary products include, but are not limited to, cytokines, proteins that constitutively induce type I interferon (IFN), and costimulatory receptors or ligands. Further exemplary combinations are described below. In some embodiments, the costimulatory molecule lacks all or part of the cytoplasmic domain for expression on antigen-presenting cells (APCs), thereby enabling the truncated molecule to constitutively signal T cells via costimulatory receptor binding but not counter-regulatory signaling to antigen-presenting cells (APCs) due to the deleted, truncated, or otherwise modified cytoplasmic domain or portion thereof. Other products include enzymes that activate therapeutic proteins, such as those that activate prodrugs. As described herein below, the immunostimulatory bacteria provided herein encode anti-cancer therapeutics comprising a combination of therapeutic products that are combined to provide a robust anti-cancer response. The encoded proteins include each of the products described above and below, as well as combinations of products from different classes. Included are costimulatory proteins, such as 4-1BBL, particularly those with truncated or deleted cytoplasmic domains that eliminate immunosuppressive counter-signaling and any compensatory mutations that ensure the resulting protein is properly oriented within the cell membrane when expressed intracellularly. Other products include STING pathway agonists that induce or cause constitutive expression of type I interferons. Such products include STING proteins, particularly the modified and chimeric STING proteins provided and described herein.One or more cytokines, such as IL-12, IL-15, IL-21, IL-12p70 (IL-12p40 + IL-12p35), IL-2 with reduced binding to IL-2Ra, IL-15 / IL-15R alpha chain complex, and others, such as IL-18, IL-21, IL-23, and IL-36γ, may also be encoded on the plasmid. In addition to costimulatory products, STING pathway agonist proteins, such as STING, cytokines, and antibodies, including checkpoint inhibitor antibodies, including anti-CTLA-4 antibodies, may also be encoded on the plasmid. Antibodies may be in scFv and scFvs-Fc two-chain forms, as well as other forms. Additionally, TGF-beta antagonists and TGF-beta receptor decoys may be included among the products.
[0035] The encoded therapeutic product can be operably linked to a nucleic acid encoding a regulatory sequence recognized by a eukaryotic host, e.g., a secretion signal that causes secretion from a cell or plasmid containing the bacterium. In embodiments in which the immunostimulatory bacterium encodes two or more products, expression of each product can be under the control of a separate promoter. Alternatively, two or more products can be expressed under the control of a single promoter, with each product separated, for example, by an internal ribosome entry site (IRES) or a nucleic acid encoding a 2A peptide, causing separate expression of each of the therapeutic products. Exemplary 2A peptides are T2A, F2A, E2A, or P2A, which can be flanked by the nucleic acid encoding the therapeutic product to cause separate expression of the therapeutic products expressed under the control of a single promoter. The therapeutic product is expressed under the control of a eukaryotic promoter, e.g., an RNA polymerase II promoter or an RNA polymerase III promoter. These include viral promoters, RNA polymerase II promoters, or mammalian RNA polymerase II promoters, such as, but not limited to, the cytomegalovirus (CMV) promoter, SV40 promoter, Epstein-Barr virus (EBV) promoter, herpesvirus promoter, adenovirus promoter, elongation factor-1 (EF-1) alpha promoter, UBC promoter, PGK promoter, CAGG promoter, adenovirus 2 or 5 late promoter, EIF4A1 promoter, CAG promoter, or CD68 promoter. The plasmid may further include other eukaryotic regulatory sequences for controlling expression of the therapeutic product, such as a terminator and / or promoter selected from SV40, human growth hormone (hGH), bovine growth hormone (BGH or bGH), MND (a synthetic promoter containing the U3 region of a modified MoMuLV LTR with a myeloproliferative sarcoma virus enhancer), chicken beta-globin, and rbGlob (rabbit globin) genes. Other regulatory sequences include a polyA tail, a woodchuck hepatitis virus (WHP) posttranscriptional regulatory element (WPRE), and a hepatitis B virus posttranscriptional regulatory element (HPRE).Additional regulatory elements may be included, for example, bacterial terminators inserted within appropriate loci as described herein to reduce or eliminate readthrough from bacterial promoters.
[0036] Encoded therapeutic products include anything recited herein in the original claims, such as nucleic acids encoding proteins, or variants thereof, that are part of an intracellular DNA / RNA sensor pathway that leads to the expression of type I interferon (IFN). Type I IFNs include interferon-α and interferon-β. Variants include those that, when expressed in a subject, lead to constitutive expression of type I IFN. These include gain-of-function (GOF) variants that do not require an intracellular nucleic acid, nucleotide, dinucleotide, or cyclic dinucleotide to result in the expression of type I IFN. Examples of these proteins include proteins selected from STING, RIG-I, MDA-5, IRF-3, IRF-7, TRIM56, RIP1, Sec5, TRAF3, TRAF2, TRAF6, STAT1, LGP2, DDX3, DHX9, DDX1, DDX9, DDX21, DHX15, DHX33, DHX36, DDX60, and SNRNP200, and mutants thereof, that have increased activity or result in constitutive expression of type I interferon (IFN). Mutants include mutants of STING, RIG-I, IRF-3, or MDA5 in which one or more serine (S) or threonine (T) residues that are phosphorylated as a result of viral infection are replaced with aspartic acid (D), whereby the resulting mutant is a phosphomimetic that constitutively induces type I IFN, and any of those known to those of skill in the art and / or described herein. Examples of variants include those in which the mutations are selected as follows: a) in STING, with reference to SEQ ID NOS: 305-309: S102P, V147L, V147M, N154S, V155M, G166E, C206Y, G207E, S102P / F279L, F279L, R281Q, R284G, R284S, R284M, R284K, R284 T, R197A, D205A, R310A, R293A, T294A, E296A, R197A / D205A, S272A / Q273A, R310A / E316A, E316A , E316N, E316Q, S272A, R293A / T294A / E296A, D231A, R232A, K236A, Q273A, S358A / E360A / S366A,b) in MDA5, with reference to SEQ ID NO: 310: T331I, T331R, A489T, R822Q, G821S, A946T, R337G, D393V, G495R, R720Q, R779H, R779H, D393V, G495R, R720Q ... c) in RIG-I, one or both of E373A and C268F, with reference to SEQ ID NO: 311; and d) in IRF-3, S396D, with reference to SEQ ID NO: 312, e.g., S102P, V147L, V147M, N154S, V155M, G166E, C206Y, G20 7E, S102P / F279L, F279L, R281Q, R284G, R284S, R284M, R284K, R284T, R197A, D205A, R310A, R293A, T294A, E296A, R197A / D205A, S272A / Q273A, R310A / E316A, E316A, E316N, E316Q, S272A, R293A / T294A / E296A, D231 Mutant STING containing one or more amino substitutions selected from A, R232A, K236A, Q273A, S358A / E360A / S366A, D231A / R232A / K236A / R238A, S358A, E360A, S366A, R238A, R375A, N154S / R284G, and S324A / S326A, as well as conservative substitutions and combinations thereof.
[0037] The immunostimulatory bacteria may also encode immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment, including, but not limited to, cytokines, chemokines, or costimulatory molecules, such as IL-2, IL-7, IL-12p70 (IL-12p40 + IL-12p35), IL-15, IL-36 gamma, IL-2 with reduced binding to IL-2Ra, IL-15 / IL-15R alpha chain complex, IL-18, IL-21, IL-23, IL-2 modified to not bind to IL-2Ra, CXCL9, CXCL10, CXCL11, interferon-α, interferon-β, interferon-γ, CCL3, CCl4, CCL5, and proteins involved in T cell recruitment and / or persistence. or a protein that causes or enhances these, CD40, CD40 ligand (CD40L), CD28, OX40, OX40 ligand (OX40L), 4-1BB, 4-1BB ligand (4-1BBL), a member of the B7-CD28 family, a CD47 antagonist, an anti-IL-6 antibody or IL-6 that binds to a decoy receptor, a TGF-beta polypeptide antagonist, and a member of the tumor necrosis factor receptor (TNFR) superfamily. A costimulatory molecule selected from CD40, CD40 ligand, CD28, OX40, OX40 ligand, 4-1BB, and 4-1BB ligand can be truncated so that the molecule lacks the cytoplasmic domain (or a portion thereof) for expression on antigen-presenting cells (APCs); due to the deleted or partially deleted or truncated cytoplasmic domain that eliminates immunosuppressive counter-signaling, the truncated gene product can transmit constitutive immunostimulatory signaling to T cells through costimulatory receptor binding, but cannot transmit counter-regulatory signaling to antigen-presenting cells (APCs). Other such proteins include TGF-beta polypeptide antagonists, such as anti-TGF-beta antibodies or antibody fragments, anti-TGF-beta receptor antibodies or antibody fragments, soluble TGF-beta antagonist polypeptides, or TGF-beta binding decoy receptors.
[0038] The plasmid may encode a therapeutic antibody or antigen-binding fragment thereof, such as a Fab, Fab', F(ab')2, single-chain Fv (scFv), scFv-Fc, Fv, dsFv, nanobody, diabody fragment, or single-chain antibody. Examples include, but are not limited to, antagonists of PD-1, PD-L1, CTLA-4, VEGF, VEGFR2, or IL-6.
[0039] In some embodiments, the immunostimulatory bacteria provided herein contain a plasmid encoding two or more therapeutic proteins selected from: a) an immunostimulatory protein that confers or contributes to an anti-tumor immune response in the tumor microenvironment; b) one or more proteins that are part of a cytoplasmic DNA / RNA sensor pathway that leads to the expression of type I interferon (IFN), or a mutant thereof with increased activity that increases the expression of type I IFN, or a mutant thereof that leads to constitutive expression of type I IFN; and c) an anti-cancer antibody or antigen-binding portion thereof. For example, the immunostimulatory protein may be a costimulatory molecule that lacks a cytoplasmic domain or portion thereof sufficient for expression on antigen-presenting cells (APCs), such that the truncated costimulatory molecule can transmit constitutive immunostimulatory signaling to T cells through costimulatory receptor binding but cannot transmit counter-regulatory signaling to antigen-presenting cells (APCs). In some embodiments, the immunostimulatory bacteria encode at least two therapeutic products selected from a cytokine, a protein that constitutively induces type I IFN, a costimulatory molecule, and an anti-cancer antibody or antigen-binding portion thereof, which may be under the control of a single promoter. For example, expression of nucleic acids encoding at least two or all of the products is under the control of a single promoter, and the nucleic acid encoding each product is separated by a nucleic acid encoding a 2A peptide, which, upon translation, results in separate expression of each product. The nucleic acid encoding each product can be operably linked to a nucleic acid encoding a sequence that directs secretion of the expressed product from the cell.
[0040] Provided are immunostimulatory bacteria encoding two or more therapeutic products, at least one product selected from a) and at least one product selected from b), wherein a) is selected from IL-2, IL-7, IL-12p70 (IL-12p40+IL-12p35), IL-15, IL-23, IL-36 gamma, IL-2 with reduced binding to IL-2Ra, IL-15 / IL-15R alpha chain complex, IL-18, IL-2 modified to not bind IL-2Ra, CXCL9, CXCL10, CXCL11, interferon alpha, interferon beta, CCL3, CCL4, CCL5, or a compound that is involved in or causes T cell recruitment and / or persistence or a) is an enhancing protein, CD40, CD40 ligand (CD40L), OX40, OX40 ligand (OX40L), 4-1BB, 4-1BB ligand (4-1BBL), a member of the B7-CD28 family, a TGF-beta polypeptide antagonist, or a member of the tumor necrosis factor receptor (TNFR) superfamily, and b) is STING, RIG-I, MDA-5, IRF-3, IRF-5, IRF-7, TRIM56, RIP1, Sec5, TRAF3, TRAF2, TRAF6, STAT1, LGP2, DDX3, DHX9, DDX1, DDX9, DDX21, DHX15, DHX33, DHX36, DDX60, or SNRNP200. It may also encode one or more of a TGF-beta inhibitory antibody, a TGF-beta binding decoy receptor, an anti-IL6 antibody, and an IL-6 binding decoy receptor.
[0041] Examples of combinations of encoded therapeutic products include the following combinations of therapeutic products: IL-2 and IL-12p70; IL-2 and IL-21; IL-2, IL-12p70, and STING GOF mutant; IL-2, IL-21, and STING GOF mutant; IL-2, IL-12p70, STING GOF mutant, and 4-1BBL (including 4-1BBL Δcyt (Δcyt is a deletion of the cytoplasmic domain) and 4-1BBL with a truncated cytoplasmic domain (4-1BBLcyt trunc)); IL-2, IL-21, STING GOF mutant, and 4-1BBL (including 4-1BBL Δcyt and 4-1BBL with a truncated cytoplasmic domain); IL-15 / IL-15Rα and STING GOF mutant; IL-15 / IL-15Rα, STING GOF mutants, and 4-1BBL (containing 4-1BBLΔcyt and 4-1BBLcyt trunc); IL-15 / IL-15Rα and IL-12p70; IL-15 / IL-15Rα and IL-21; IL-15 / IL-15Rα, IL-12p70, and STING GOF mutants; IL-15 / IL-15Rα, IL-21, and STING GOF mutants; IL-15 / IL-15Rα, IL-12p70, STING GOF mutants, and 4-1BBL (containing 4-1BBLΔcyt and 4-1BBLcyt trunc); IL-15 / IL-15Rα, IL-21, STING GOF mutants, and 4-1BBL (containing 4-1BBLΔcyt and 4-1BBLcyt trunc). trunc); IL-12p70 and IL-21; IL-12p70, IL-21, and STING GOF mutant; IL-12p70, IL-21, STING GOF mutant, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); IL-12p70 and STING GOF mutant; IL-12p70, STING GOF mutant, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); IL-12p70 and IL-18; IL-12p70, IL-18, and STING GOF mutant;IL-12p70, IL-18, STING GOF mutant, and 4-1BBL (including 4-1BBL Δcyt and 4-1BBL cyt trunc); TGF-β decoy receptor, IL-2, and IL-12p70; TGF-β decoy receptor, IL-2, and IL-21; TGF-β decoy receptor, IL-2, IL-12p70, and STING GOF mutant; TGF-β decoy receptor, IL-2, IL-21, and STING GOF mutant; TGF-β decoy receptor, IL-2, IL-12p70, STING GOF mutant, and 4-1BBL (including 4-1BBL Δcyt and 4-1BBL cyt trunc); TGF-β decoy receptor, IL-2, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); TGF-β decoy receptor, IL-15 / IL-15Rα, and STING GOF mutants; TGF-β decoy receptor, IL-15 / IL-15Rα, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); TGF-β decoy receptor, IL-15 / IL-15Rα, and IL-12p70; TGF-β decoy receptor, IL-15 / IL-15Rα, and IL-21; TGF-β decoy receptor, IL-15 / IL-15Rα, IL-12p70, and STING GOF mutants; TGF-β decoy receptor, IL-15 / IL-15Rα, IL-21, and STING GOF mutants; TGF-β decoy receptor, IL-15 / IL-15Rα, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); TGF-β decoy receptor, IL-15 / IL-15Rα, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); TGF-β decoy receptor, IL-12p70, and IL-21; TGF-β decoy receptor, IL-12p70, IL-21, and STING GOF mutants; TGF-β decoy receptor, IL-12p70, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc);TGF-β decoy receptor and IL-12p70; TGF-β decoy receptor, IL-12p70, and STING GOF mutant; TGF-β decoy receptor, IL-12p70, STING GOF mutant, and 4-1BBL (including 4-1BBL Δcyt and 4-1BBL cyt trunc); TGF-β decoy receptor, IL-12p70, and IL-18; TGF-β decoy receptor, IL-12p70, IL-18, and STING GOF mutant; TGF-β decoy receptor, IL-12p70, IL-18, STING GOF mutant, and 4-1BBL (including 4-1BBL Δcyt and 4-1BBL cyt trunc); TGF-β decoy receptor and STING GOF mutants; anti-CTLA-4 antibodies, IL-2, and IL-12p70; anti-CTLA-4 antibodies, IL-2, and IL-21; anti-CTLA-4 antibodies, IL-2, IL-12p70, and STING GOF mutants; anti-CTLA-4 antibodies, IL-2, IL-21, and STING GOF mutants; anti-CTLA-4 antibodies, IL-2, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); anti-CTLA-4 antibodies, IL-2, IL-21, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and STING GOF mutants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and STING GOF mutants, and 4-1BBL (4-1BBLΔcyt, and 4-1BBL with a truncated cytoplasmic domain); anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and IL-12p70; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and IL-21; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-12p70, and STING GOF mutants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-21, and STING GOF mutants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-12p70, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc);Anti-CTLA-4 antibody, IL-15 / IL-15Rα, IL-21, STING GOF mutant, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); anti-CTLA-4 antibody, IL-12p70, and IL-21; anti-CTLA-4 antibody, IL-12p70, IL-21, and STING GOF mutant; anti-CTLA-4 antibody, IL-12p70, IL-21, STING GOF mutant, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); anti-CTLA-4 antibody and IL-12p70; anti-CTLA-4 antibody, IL-12p70, and STING GOF mutant; anti-CTLA-4 antibody, IL-12p70, and STING GOF mutant; anti-CTLA-4 antibody, IL-12p70, STING GOF mutant, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc). anti-CTLA-4 antibodies, IL-12p70, and IL-18; anti-CTLA-4 antibodies, IL-12p70, IL-18, and STING GOF mutants; anti-CTLA-4 antibodies, IL-12p70, IL-18, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt truncs); anti-CTLA-4 antibodies and STING GOF mutants; CD40 agonists, IL-2, and IL-12p70; CD40 agonists, IL-2, and IL-21; CD40 agonists, IL-2, IL-12p70, and STING GOF mutants; CD40 agonists, IL-2, IL-21, and STING GOF mutants; CD40 agonists, IL-2, IL-12p70, and STING GOF mutants, and 4-1BBL (containing 4-1BBLΔcyt and 4-1BBLcyt trunc), CD40 agonist, IL-2, IL-21, STING GOF mutants, and 4-1BBL (containing 4-1BBLΔcyt and 4-1BBLcyt trunc); CD40 agonist, IL-15 / IL-15Rα, and STING GOF mutants; CD40 agonist, IL-15 / IL-15Rα, STING GOF mutants, and 4-1BBL (containing 4-1BBLΔcyt and 4-1BBLcyt trunc); CD40 agonist, IL-15 / IL-15Rα, and IL-12p70;CD40 agonist, IL-15 / IL-15Rα, and IL-21; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, and STING GOF mutant; CD40 agonist, IL-15 / IL-15Rα, IL-21, and STING GOF mutant; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, STING GOF mutant, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); CD40 agonist, IL-15 / IL-15Rα, IL-21, STING GOF mutant, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc) CD40 agonist, IL-12p70, and IL-21; CD40 agonist, IL-12p70, IL-21, and STING GOF mutant; CD40 agonist, IL-12p70, IL-21, STING GOF mutant, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); CD40 agonist and IL-12p70; CD40 agonist, IL-12p70, and STING GOF mutant; CD40 agonist, IL-12p70, STING GOF mutant, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); CD40 agonist, IL-12p70, and IL-18; CD40 agonist, IL-12p70, IL-18, and STING GOF mutants; CD40 agonist, IL-12p70, IL-18, STING GOF mutants, and 4-1BBL (including 4-1BBLΔcyt and 4-1BBLcyt trunc); and either CD40 agonist and STING GOF mutants.
[0042] In all combinations involving 4-1BBL, the 4-1BBL molecule may be a full-length protein (e.g., see SEQ ID NOs: 389 and 393 for human and mouse 4-1BBL, respectively); a 4-1BBL mutant with a deleted cytoplasmic domain (4-1BBLΔcyt; e.g., see SEQ ID NOs: 390 and 394 for human and mouse 4-1BBLΔcyt, respectively); a 4-1BBL mutant with a truncated (i.e., not completely deleted) cytoplasmic domain (4-1BBLcyt trunc; e.g., see SEQ ID NOs: 391-392 and 395-396 for exemplary human and mouse 4-1BBLcyt trunc mutants); or a 4-1BBL molecule with an altered cytoplasmic domain in which one or more Ser residues that serve as phosphorylation sites (e.g., Ser5 and Ser8 for SEQ ID NO: 389 for human 4-1BBL) have been replaced at the appropriate locus with residues that reduce or eliminate reverse signaling). In addition, all combinations that include an anti-CTLA-4 antibody may include an anti-CTLA-4 antibody fragment, such as an anti-CTLA-4 scFv (e.g., see SEQ ID NOs: 403 and 404 for exemplary human and mouse anti-CTLA-4 scFv fragments, respectively), or an anti-CTLA-4 scFv-Fc (e.g., see SEQ ID NOs: 402 and 405 for exemplary human and mouse anti-CTLA-4 scFv-Fc fragments, respectively).
[0043] Also provided are modified non-human stimulator of interferon genes (STING) proteins and STING protein chimeras, as well as delivery vehicles, pharmaceutical compositions, cells encoding or containing these STING proteins, and uses thereof, and methods for treating cancer, all of which are described herein. In particular, the immunostimulatory bacteria provided herein encode the modified non-human STING proteins, non-human STING proteins, and chimeras described herein. These STING proteins encoded by the immunostimulatory bacteria are provided herein and described throughout. Provided herein are the following:
[0044] 1. Modified non-human STING proteins, which have lower NF-κB activation than human STING proteins and optionally higher type I interferon activation activity compared to wild-type (WT) human STING proteins. These non-human STING proteins are modified to contain mutations that increase activity or act constitutively in the absence of intracellular nucleic acid signaling. The mutations are typically amino acid mutations that occur in human interferonopathies, such as those previously described for human STING. Corresponding mutations are introduced into the non-human species STING protein, and the corresponding amino acid residues are identified by alignment. In some embodiments, the TRAF6 binding site in the C-terminal tail (CTT) of the STING protein is deleted to reduce NF-κB signaling activity.
[0045] 2. Chimeric modified STING proteins, particularly human STING proteins, in which the CTT (C-terminal tail) region in a STING protein from one species, e.g., human, is replaced by a CTT from a STING protein from another species that has lower NF-κB signaling activity and / or higher type I IFN signaling activity than human STING, and the TRAF6 binding site may be deleted in these chimeras.
[0046] 3. Also, a modified STING protein of 2 containing the mutation of 1.
[0047] 4. A delivery vehicle, such as an immunostimulatory bacterium, any of those provided herein or known to those skilled in the art, encoding any of the modified STING proteins of 1 to 3, including, for example, exosomes, nanoparticles, minicells, cells, liposomes, lysosomes, oncolytic viruses, and other viral vectors.
[0048] 5. A delivery vehicle, e.g., an immunostimulatory bacterium, any of those provided herein or known to one of skill in the art, including, for example, exosomes, nanoparticles, minicells, cells, liposomes, lysosomes, oncolytic viruses, and other viral vectors, encoding unmodified STING from a non-human species, wherein the STING protein has reduced NF-κB signaling activity compared to human STING, and, optionally, increased type I interferon stimulating / signaling activity compared to human STING.
[0049] 6. Cells (if human, non-zygotic), such as cells used in cell therapy, e.g., T cells and stem cells, and cells used to produce any of the STING proteins 1-3.
[0050] 7. A pharmaceutical composition containing any one of the STING proteins of 1 to 3, or the delivery vehicles of 4 and 5, or the cells of 6.
[0051] 8. Uses and methods of treating cancer by administering any of 1 to 7 as described herein for immune stimulating bacteria.
[0052] Assays and methods for assessing NF-κB activity (signaling activity) and type I interferon-stimulating activity or interferon-β-stimulating activity of STING are described herein and are known to those skilled in the art. Exemplary methods include those described in de Oliveira Mann et al. (2019) Cell Reports 27:1165-1175, which describes, inter alia, the interferon-β and NF-κB signaling activity of STING proteins from various species, including humans, thereby identifying STING proteins from various species that have lower NF-κB activity than human STING, as well as those with interferon-β activity comparable to or higher than human STING. de Oliveira Mann et al. (2019) provide a species alignment to identify domains of STING in each species, including the CTT domain [see also Supplemental Information for de Oliveira Mann et al. (2019)].
[0053] The non-human STING protein can be a STING protein from, but is not limited to, the following species: Tasmanian devil (Sarcophilus harrisii; SEQ ID NO: 349), marmoset (Callithrix jacchus; SEQ ID NO: 359), cow (Bos taurus; SEQ ID NO: 360), cat (Felis catus; SEQ ID NO: 356), ostrich (Struthio camelus australis; SEQ ID NO: 361), Japanese crested ibis (Nipponia nippon; SEQ ID NO: 362), coelacanth (Latimeria chalumnae; SEQ ID NOs: 363-364), wild boar (Sus scrofa; SEQ ID NO: 365), bat (Rousettus aegyptiacus; SEQ ID NO: 366), manatee (Trichechus manatus latirostris; SEQ ID NO: 367), chimaera (Callorhinchus milii; SEQ ID NO: 368), and mouse (Mus musculus; SEQ ID NO: 369). These vertebrate STING proteins readily activate immune signaling in human cells, indicating that the molecular mechanisms of STING signaling are shared among vertebrates [see de Oliveira Mann et al. (2019) Cell Reports 27:1165-1175].
[0054] The immunostimulatory bacteria provided herein are shown to be capable of infecting myeloid cells, such as tumor-resident and tissue-resident macrophages, retaining viability for at least a limited time, and / or converting macrophages having an M2 phenotype into M1 or M1-like macrophages with reduced or eliminated immunosuppressive properties and enhanced or added immunostimulatory, antitumor, or antiviral properties through their ability to deliver a plasmid encoding a therapeutic product that results in the expression of type I IFN and / or other immunostimulatory products, e.g., a gain-of-function (GOF) mutant that does not require an intracellular nucleic acid, nucleotide, dinucleotide, or cyclic dinucleotide to result in the expression of type I IFN. Provided are immunostimulatory bacteria containing a plasmid encoding a therapeutic product, wherein infection of macrophages, including human macrophages, with the bacteria converts M2 macrophages into M1 or M1-like phenotype macrophages. Provided are immunostimulatory bacteria containing a plasmid encoding a therapeutic product whose expression in macrophages results in or induces the conversion of M2 macrophages, e.g., human M2 macrophages, to an M1 or M1-like phenotype. Immunostimulatory bacteria with such properties include any of the bacteria provided herein that contain genomic modifications that result in infection of tumor-resident (in subjects with cancer) and tissue-resident myeloid cells. These genomic modifications include those that result in bacteria without flagella (wild-type bacteria have flagella) and others, such as pagP. - / msbB - Other modifications include those that result in the bacterium being an asparaginase. - These include modifications that enhance T cell activity by resulting in bacteria that are resistant to T cell antigens, and other modifications that alter lipopolysaccharide (LPS).
[0055] Included are immunostimulatory bacteria that encode therapeutic products within macrophages that promote, cause, or convert M2 macrophages to an M1 or M1-like phenotype. Exemplary therapeutic products are those that are part of an intracellular DNA / RNA sensor pathway that leads to type I interferon (IFN) expression, particularly constitutive expression. This includes gain-of-function (GOF) mutants of therapeutic products that are part of an intracellular DNA / RNA sensor pathway and do not require intracellular nucleic acids, nucleotides, dinucleotides, or cyclic dinucleotides to result in type I IFN expression, such as the mutants and non-human STING proteins described and provided herein. Immunostimulatory bacteria include any that can be modified as described herein, including the species described herein, e.g., Salmonella species and strains.
[0056] Also provided are immunostimulatory bacteria in which the encoded therapeutic product, e.g., protein, is linked to a moiety that confers improved pharmacological properties, e.g., pharmacokinetic or pharmacodynamic properties, e.g., extended serum half-life. Thus, provided are immunostimulatory bacteria in which the encoded therapeutic product comprises an Fc domain or a half-life extending moiety, e.g., human serum albumin or a portion thereof. Examples of half-life extension forms or methods include PEGylation, glycosylation modifications, sialylation, PASylation (modification with PAS amino acid polymers approximately 100 to 200 residues in length), ELPylation [see, e.g., Floss et al. (2010) Trends Biotechnol. 28(1): 37-45], HAPylation (modification with glycine homopolymers), fusion to human serum albumin, fusion to GLK, fusion to CTP, fusion to GLP, fusion to the constant fragment (Fc) domain of human immunoglobulin (IgG), fusion to transferrin, and non-structural polypeptides such as XTEN [also called rPEG, which is a genetic fusion of non-exact repeating peptide sequences containing A, E, G, P, S, and T; see, e.g., Schellenberger et al. (2009) Nat. Biotechnol. 27(12): 37-45]. 1186-1190], as well as other modifications and fusions that increase size, increase hydrodynamic radius, alter charge, or target receptors for recycling rather than clearance, and combinations of such modifications and fusions.
[0057] Also provided are immunostimulatory bacteria in which the encoded therapeutic product comprises a B7 protein transmembrane domain, or the therapeutic product is GPI-anchored by an endogenous or additional GPI anchor. The encoded therapeutic product may comprise a fusion to collagen.
[0058] The immunostimulatory bacteria in any and all embodiments may be of any suitable species. When referring to specific genes and genetic modifications, the genes and modifications correspond to those with reference to the genus Salmonella as an exemplary species. Examples of species and strains include Rickettsia, Klebsiella, Bordetella, Neisseria, Aeromonas, Francisella, Corynebacterium, Citrobacter, Chlamydia, Haemophilus, Includes strains of the genera Brucella, Mycobacterium, Mycoplasma, Legionella, Rhodococcus, Pseudomonas, Helicobacter, Vibrio, Bacillus, and Erysipelothrix.For example, Rickettsia rickettsiae, Rickettsia prowazekii, Rickettsia tsutsugamuchi, Rickettsia mooseri, Rickettsia sibirica, Bordetella bronchiseptica, Neisseria meningitidis, Neisseria gonorrhoeae, Aeromonas eucrenophila, Aeromonas salmonicida, Francisella tularensis, Corynebacterium ovis pseudotuberculosis, Citrobacter freundii, Chlamydia pneumoniae, Haemophilus somnus, Brucella abortus, Mycobacterium intracellulare, Legionella pneumophila, Rhodococcus equi, Pseudomonas aeruginosa, Helicobacter mustelae, Vibrio cholerae, Bacillus subtilis, Erysipelothrix rhusiopathiae rhusiopathiae, Yersinia enterocolitica, Rochalimaea quintana, and Agrobacterium tumefaciens.
[0059] Bacteria can be attenuated, or rendered less virulent or non-virulent by the modifications described herein. Exemplary bacteria include Salmonella species, such as Salmonella typhimurium strains. The immunostimulatory bacteria provided herein include those that endogenously encode and express, or have been modified to encode and express, a gene encoding complement killing resistance (rck), e.g., a Salmonella rck gene. Therapeutic E. coli are modified to encode rck and can be administered systemically. Also provided, described, and claimed herein are delivery vehicles, cells, pharmaceutical compositions, methods, uses, and cancer treatments, particularly in humans. Also provided are companion diagnostics and methods for selecting subjects for treatment, and methods for monitoring treatment. These are described below and in the claims, which are incorporated in their entireties into this section. [Brief explanation of the drawings]
[0060] [Figure 1] FIG. 1 shows an alignment of wild-type human (SEQ ID NO: 306) and Tasmanian devil (SEQ ID NO: 349) STING proteins. [Figure 2] FIG. 2 shows an alignment of wild-type human (SEQ ID NO: 306) and marmoset (SEQ ID NO: 359) STING proteins. [Figure 3] Figure 3 shows an alignment of wild-type human (SEQ ID NO: 306) and bovine (SEQ ID NO: 360) STING proteins. [Figure 4] Figure 4 shows an alignment of wild-type human (SEQ ID NO: 306) and feline (SEQ ID NO: 356) STING proteins. [Figure 5] Figure 5 shows an alignment of wild-type human (SEQ ID NO: 306) and ostrich (SEQ ID NO: 361) STING proteins. [Figure 6]Figure 6 shows an alignment of wild-type human (sequence number 306) and Japanese crested ibis (sequence number 362) STING proteins. [Figure 7] Figure 7 shows an alignment of wild-type human (SEQ ID NO: 306) and coelacanth (SEQ ID NO: 363) STING proteins. [Figure 8] Figure 8 shows an alignment of wild-type human (SEQ ID NO: 306) and zebrafish (SEQ ID NO: 348) STING proteins. [Figure 9] Figure 9 shows an alignment of wild-type human (SEQ ID NO: 305) and boar (SEQ ID NO: 365) STING proteins. [Figure 10] Figure 10 shows an alignment of wild-type human (SEQ ID NO: 305) and bat (SEQ ID NO: 366) STING proteins. [Figure 11] Figure 11 shows an alignment of wild-type human (SEQ ID NO: 305) and manatee (SEQ ID NO: 367) STING proteins. [Figure 12] Figure 12 shows an alignment of wild-type human (SEQ ID NO: 305) and chimaera (SEQ ID NO: 368) STING proteins. [Figure 13] Figure 13 shows an alignment of wild-type human (SEQ ID NO: 305) and mouse (SEQ ID NO: 369) STING proteins. [Figure 14] Figure 14 shows an exemplary construct containing an asd expression cassette, including a bacterial promoter and any other bacterial control sequences, in the opposite orientation to a cassette encoding a payload under the control of a eukaryotic promoter, and including bacterial terminators adjacent to the nucleic acid encoding the payload and in an orientation that terminates any read-through transcription from the prokaryotic promoter. DETAILED DESCRIPTION OF THE INVENTION
[0061] Overview A.Definition B. Overview of Immunostimulatory Bacteria for Cancer Treatment 1. Bacterial cancer immunotherapy 2. Upfront treatment targeting the tumor microenvironment a. Limitations of autologous T cell therapy b. Viral vaccine platform c. Bacterial cancer treatment i. Listeria spp. ii. Salmonella spp. iii.VNP20009 iv. Wild-type strain 3. Limitations of existing bacterial cancer immunotherapy C. Modification and Enhancement of Immunostimulatory Bacteria to Increase the Therapeutic Index and Increase Accumulation in Tumor-Resident Myeloid Cells 1. Deletion of genes in the LPS biosynthetic pathway a. msbB deletion b. pagP deletion 2. Nutritional requirements a.purI deletion / disruption B adenosine auxotrophy 3. Plasmid Maintenance and Delivery a.asd deletion b.endA deletion / disruption 4. Flagellin Knockout Strain 5. Bacterial engineering to promote adaptive immunity and enhance T cell function L-asparaginase II (ansB) deletion / disruption 6. Deletion / disruption of Salmonella genes required for curli fimbria expression 7.Improved resistance to complement Rck expression 8. Deletion of genes required for lipoprotein expression in Salmonella and other Gram-negative bacteria 9. Robust, immune-stimulating bacteria whose genomes are engineered to be optimized for antitumor therapy and encode therapeutic products, including multiple 10. Conversion of M2 phenotype macrophages to M1 and M1-like phenotype macrophages D. Immunostimulatory bacteria with enhanced therapeutic index that encode genetic payloads that stimulate immune responses in the tumor microenvironment 1. Immunostimulatory proteins a. Cytokines and chemokines b. Co-stimulatory molecules 2. Molecules that activate prodrugs 3. Constitutively active proteins that stimulate immune responses and / or type I IFN, non-human STING proteins, chimeric, and modified forms a. Constitutive STING expression and gain-of-function mutations b. Constitutive IRF3 expression and gain-of-function mutations c. Non-human STING proteins and mutants thereof with increased or constitutive activity, and STING chimeras and mutants thereof with increased or constitutive activity. d. Other gene products that act as intracellular DNA / RNA sensors and their constitutive variants i.RIG-I ii.MDA5 / IFIH1 iii.IRF7 e. Other type I IFN-regulatory proteins 4. Antibodies and antibody fragments TGF-β b. Bispecific scFv and T cell engagers c. Anti-PD-1 / anti-PD-L1 antibody d. Anti-CTLA-4 antibody e. Additional Exemplary Checkpoint Targets 5. Combinations of immunomodulatory proteins may have synergistic and / or complementary effects 6. Immunostimulatory bacteria resulting in combination therapy
[0062] E. Construction of Exemplary Plasmids Encoding Therapeutic Products for Bacterial Delivery 1. Constitutive promoters for heterologous expression of proteins 2. Multiple Therapeutic Product Expression Cassettes a. Single promoter construct b. Dual / multiple promoter constructs 3. Regulatory Elements a post-transcriptional regulatory element b. polyadenylation signal sequence and terminator C. enhancer d. secretion signal e. Improving bacterial fitness 4. Origin of Replication and Plasmid Copy Number 5. CpG motifs and CpG islands 6. Plasmid Maintenance / Selection Components 7. DNA nuclear targeting sequence F. Pharmaceutical Production, Compositions and Formulations 1.Manufacturing a. Cell bank production b. Manufacturing of active ingredients c. Manufacturing of drug products 2. Composition 3. Preparation a. Liquids, injections, emulsions b. Dry heat-stable formulation 4. Compositions for other routes of administration 5. Dosage and Administration 6. Packaging and Manufactured Goods G. Methods of Treatment and Use 1. Diagnostic methods for selecting patients for treatment and monitoring treatment a. Patient selection b. Diagnostic methods for assessing or detecting the activity of immune-stimulating bacteria indicate the effectiveness of treatment 2. Tumor 3. Administration 4. Monitoring H. Working Example
[0063] A.Definition Unless otherwise specified, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. All patents, patent applications, published applications, as well as publications, GenBank sequences, databases, websites, and other published materials referenced throughout this disclosure are incorporated by reference in their entirety unless otherwise specified. In the event of multiple definitions for terms herein, those in that section prevail. When referring to a URL or other such identifier or address, of course, such identifiers may change and specific information on the Internet may change, but equivalent information may be found by searching the Internet. Reference thereto evidences the availability and public dissemination of such information.
[0064] As used herein, a "therapeutic bacterium" is a bacterium that, when administered to a subject, e.g., a human, achieves a treatment, e.g., an anti-cancer treatment or an anti-tumor treatment.
[0065] As used herein, "immunostimulatory bacteria" are therapeutic bacteria that, when introduced into a subject, accumulate in immune-privileged tissues and cells, such as tumors, tumor microenvironments, and tumor-resident immune cells, and replicate and / or express products that are immune-stimulating or result in immune stimulation. For example, immune-stimulatory bacteria are attenuated in a host by reduced toxicity or pathogenicity and / or by encoded products that reduce toxicity or pathogenicity. This is because immune-stimulatory bacteria are unable to replicate and / or express products (or have reduced replication / product expression) except primarily in immune-privileged environments. The immune-stimulatory bacteria provided herein are modified to encode a product(s) or to exhibit traits or properties that make the product immune-stimulatory. Such products, properties, and traits include, but are not limited to, at least one of: immune stimulatory proteins, such as cytokines, chemokines, or costimulatory molecules; intracellular DNA / RNA sensors or gain-of-function or constitutively active mutants thereof (e.g., STING, IRF3, IRF7, MDA5, RIG-I); RNAi, such as siRNA (shRNA and microRNA) or CRISPR, that target, disrupt, or inhibit checkpoint genes, such as TREX1, PD-1, CTLA-4, and / or PD-L1; antibodies and fragments thereof, such as anti-immune checkpoint antibodies, anti-IL-6 antibodies, anti-VEGF antibodies, or TGF-β inhibitory antibodies; other antibody constructs, such as bispecific T cell engagers (BiTEs®); soluble TGF-β receptors that act as decoys that bind TGF-β, or TGF-β antagonizing polypeptides; and IL-6 that binds to decoy receptors. The immunostimulatory bacteria may also contain modifications that render the bacteria auxotrophic for a metabolite that is immunosuppressive or is in an immunosuppressive pathway, such as adenosine.
[0066] As used herein, the strain designations VNP20009 (see, e.g., International Application PCT Publication No. WO 99 / 13053; see also U.S. Pat. No. 6,863,894), YS1646, and 41.2.9 are used interchangeably and each refer to a strain deposited with the American Type Culture Collection (ATCC) and assigned accession number 202165. VNP20009 is an engineered, attenuated strain of Salmonella typhimurium that contains deletions in msbB and purI and was generated from the wild-type strain ATCC #14028.
[0067] As used herein, the strain designations YS1456 and 8.7 are used interchangeably and each refer to a strain deposited with the American Type Culture Collection (ATCC) and assigned accession number 202164 (see U.S. Pat. No. 6,863,894).
[0068] As used herein, the statement that a bacterium is "derived from" a particular strain means that such a strain can serve as a starting material and can be modified to produce the particular bacterium.
[0069] As used herein, "expression cassette" refers to a nucleic acid construct that includes regulatory sequences for gene expression operably linked to a nucleic acid encoding an open reading frame (ORF) that encodes a payload, e.g., a therapeutic product or other protein.
[0070] As used herein, 2A peptides are viral oligopeptides 18-22 amino acids (aa) long that mediate polypeptide cleavage during translation in eukaryotic cells. The designation "2A" refers to a specific region of the viral genome, and various viral 2A peptides have typically been named after the viruses from which they originate. Examples include F2A (foot-and-mouth disease virus 2A), E2A (equine rhinitis A virus), P2A (porcine teschovirus-1 2A), and T2A (Thosea asigna virus 2A). For coding sequences, see, e.g., Liu et al. (2017) Scientific Reports 7:2193, Figure 1. See also SEQ ID NOS: 327-330. These peptides generally share the core sequence motif of DxExNPGP and are present in multiple viral families. The peptides aid in polyprotein fragmentation by preventing peptide binding to the ribosome. 2A peptides provide multicistronic vectors in which multiple proteins are expressed from a single open reading frame (ORF). For purposes herein, 2A peptides include naturally occurring ones and any modified versions thereof, e.g., any having 97%, 98%, or 99% sequence identity to any naturally occurring 2A peptide, including those disclosed herein, which result in a single polypeptide that is transcribed and translated from a transcript containing multiple (two or more) open reading frames.
[0071] As used herein, "interferonopathy" refers to disorders associated with upregulation of interferon due to mutations in gene products involved in pathways that regulate or induce interferon expression. Product activity is usually regulated by mediators, such as intracellular DNA, RNA, or nucleotides; when the protein product is mutated, activity is constitutive. Type I interferonopathies encompass a range of conditions, including severe forms of Aicardi-Goutières syndrome (AGS) and the milder familial lupus chilliformis (FCL). Nucleic acid molecules encoding mutant products with these properties can be generated in vitro, for example, by selecting for mutations that result in a gain of function in the product compared to products of alleles that have normal activity or that have additional gain of function compared to the disease-associated gain-of-function mutants described herein.
[0072] As used herein, a "gain-of-function mutation" is one that increases the activity of a protein compared to the same protein without the mutation. For example, if the protein is a receptor, it will have increased affinity for a ligand; if the protein is an enzyme, it will have increased activity, including constitutive activity.
[0073] As used herein, an "origin of replication" is a sequence of DNA on a chromosome or plasmid, or within a virus, from which replication begins. For small DNAs, including bacterial plasmids and small viruses, a single origin is sufficient.
[0074] The origin of replication determines the vector copy number, which depends on the replication origin selected. For example, if the expression vector is derived from the low-copy-number plasmid pBR322, the copy number is approximately 15-20 copies / cell; if it is derived from the high-copy-number plasmid pUC, the copy number can be 500-700 copies / cell.
[0075] As used herein, a medium copy number of a plasmid in a cell is about 150 or less, a low copy number is 5 to 30, e.g., 20 or less, a low to medium copy number is less than 150 copies / cell, and a high copy number is greater than 150 copies / cell.
[0076] As used herein, a "CpG motif" is a pattern of bases containing an unmethylated central CpG (where p refers to a phosphodiester bond between consecutive C and G nucleotides) surrounded by at least one base flanking (3' and 5') the central CpG. A CpG oligodeoxynucleotide is an oligodeoxynucleotide that is at least about 10 nucleotides in length and contains an unmethylated CpG. At least the C of the 5'CG3' is unmethylated.
[0077] As used herein, "RIG-I binding sequence" refers to a 5' triphosphate (5' ppp) structure synthesized directly or from a poly(dA-dT) sequence by RNA pol III, which can activate type I IFN through the RIG-I pathway by interacting with RIG-I. The RNA contains at least four A ribonucleotides (AAAA); it can contain 4, 5, 6, 7, 8, 9, or 10 or more. The RIG-I binding sequence is introduced into a plasmid in bacteria for transcription into polyA.
[0078] As used herein, "cytokine" refers to a broad and vague category of small proteins (approximately 5-20 kDa) that are important in cell signaling. Cytokines include chemokines, interferons, interleukins, lymphokines, and tumor necrosis factors. Cytokines are cell signaling molecules that aid in cell-to-cell communication in the immune response and stimulate cell migration toward sites of inflammation, infection, and wounds.
[0079] As used herein, "chemokine" refers to a chemoattractant (chemotactic) cytokine that binds to a chemokine receptor, and includes proteins isolated from natural sources and proteins produced synthetically by recombinant means or by chemical synthesis. Exemplary chemokines include IL-8, IL-10, GCP-2, GRO-α, GRO-β, GRO-γ, ENA-78, PBP, CTAP, and the like. III, NAP-2, LAPF-4, MIG (CXCL9), CXCL10 (IP-10), CXCL11, PF4, SDF-1α, SDF-1β, SDF-2, MCP-1, MCP-2, MCP-3, MCP-4, MCP-5, MIP-1α (CCL3), MIP-1β (CCl4), MIP-1γ (CCL9), MIP-2, MIP-2α, MIP-3α, MIP-3β, MIP-4, MIP-5, MDC, HCC-1, ALP, Lungkin, Tim-1, Eotaxin-1, Eotaxin-2, I-309, SCYA17, TRAC, RANTES (CCL5), DC-CK-1, lymphotactin, and fractalkine, and others known to those of skill in the art. Chemokines are involved in the migration of immune cells to sites of inflammation, in the maturation of immune cells, and in the induction of adaptive immune responses.
[0080] As used herein, an "immunostimulatory protein" refers to a protein that exhibits or promotes an anti-tumor immune response in the tumor microenvironment. Examples of such proteins include cytokines, chemokines, and costimulatory molecules, such as, but not limited to, IFN-α, IFN-β, GM-CSF, IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, IL-23, IL-12p70 (IL-12p40+IL-12p35), IL-15 / IL-15R alpha chain complex, IL-36 gamma, IL-2 with reduced binding to IL-2Ra, IL-2 modified to not bind to IL-2Ra, CXCL9, CXCL10 (IP-10), C These include XCL11, CCL3, CCL4, CCL5, molecules involved in T cell recruitment and / or persistence potential, CD40, CD40 ligand (CD40L), OX40, OX40 ligand (OX40L), 4-1BB, 4-1BB ligand (4-1BBL), 4-1BBL with a deleted cytoplasmic domain (4-1BBLΔcyt) or a truncated 4-1BBL with a partially deleted cytoplasmic domain, members of the B7-CD28 family, and members of the tumor necrosis factor receptor (TNFR) superfamily.
[0081] Among immune stimulatory proteins, there are truncated costimulatory molecules, such as 4-1BBL, CD80, CD86, CD27L, B7RP1, and OX40L, each of which has a complete or partial cytoplasmic domain deletion for expression on antigen-presenting cells (APCs). These truncated gene products, e.g., those with a deleted or partial cytoplasmic domain deletion, can transmit constitutive immune stimulatory signals to T cells through costimulatory receptor binding but cannot transmit counter-regulatory signals to APCs due to the truncated or deleted cytoplasmic domain.
[0082] As used herein, a "cytoplasmic domain deletion" refers to the deletion of all or part of the amino acid residues comprising the cytoplasmic or intracellular domain of a protein, where the deletion is sufficient to cause constitutive immunostimulatory signaling in T cells via costimulatory receptor binding and sufficient to inhibit counter-regulatory signaling in APCs. For example, the cytoplasmic domain of human 4-1BBL (also known as TNFSF9) comprises amino acid residues 1-28 of SEQ ID NO: 342. The cytoplasmic domain of human CD80 comprises amino acid residues 264-288 of the protein; the cytoplasmic domain of human CD86 comprises amino acid residues 269-329 of the protein; the cytoplasmic domain of human CD27L (also known as CD70) comprises amino acid residues 1-17 of the protein; the cytoplasmic domain of human B7RP1 (also known as ICOSLG or ICOS ligand) comprises amino acid residues 278-302 of the protein; and the cytoplasmic domain of human OX40L (also known as TNFSF4 or CD252) comprises amino acid residues 1-23 of the protein.
[0083] As used herein, a "decoy receptor" is a receptor that can efficiently and specifically bind to a particular growth factor or cytokine, but is structurally incapable of signaling or activating the intended receptor complex. Decoy receptors act as inhibitors by binding to a ligand and preventing it from binding to its cognate receptor.
[0084] For example, TGF-β family receptors include cell surface serine / threonine kinase receptor type I (TβRI or TGFβR1) and type II (TβRII or TGFβR2) (which form heteromeric complexes in the absence of dimerized ligands), as well as type III receptor betaglycan (TβRIII or TGFβR3). Soluble decoy receptors for TGF-β that prevent TGF-β from binding to its receptors include the soluble extracellular domains (TGF-β binding regions) of TβRI, TβRII, or TβRIII (betaglycan), which can be fused with other molecules, such as Fc domains. In addition, BAMBI (bone morphogenetic protein (BMP) and activin membrane-bound inhibitor) is structurally related to the type I receptor and acts as a decoy that inhibits receptor activation. In addition, dominant-negative TGFβR2 (DN-TGFβR2), which contains the extracellular domain of TGFβR2 and the transmembrane region but lacks the cytoplasmic domain required for signal transduction, can be used as a TGF-β decoy receptor (see, for example, International Publication No. WO 2018 / 138003).
[0085] As used herein, a costimulatory molecule agonist is a molecule that activates or increases the activity of a costimulatory molecule upon binding to it. For example, the agonist can be an agonist antibody. Examples of CD40 agonist antibodies include CP-870,893, dacetuzumab, ADC-1013 (mitazarimab), and Chi Lob 7 / 4.
[0086] As used herein, an intracellular DNA / RNA sensor pathway is one that is initiated by the presence of DNA, RNA, nucleotides, dinucleotides, cyclic nucleotides and / or cyclic dinucleotides, or other nucleic acid molecules that are responsible for the production of type I interferons. The intracellular nucleic acid molecules arise from viral, bacterial, or radiation or other such exposure and are responsible for the activation of an immune response in the host.
[0087] As used herein, a "type I interferon pathway protein" is a protein that induces an innate immune response (such as induction of type I interferon).
[0088] As used herein, an "intracellular DNA / RNA sensor" refers to a protein that is part of an intracellular DNA / RNA sensor pathway that leads to the expression of immune response mediators, such as type I interferons. "Intracellular DNA / RNA sensors" include type I interferon pathway proteins. For example, as described herein and known to those skilled in the art, intracellular DNA is sensed by cGAS, leading to the production of cGAMP and subsequent STING / TBK1 / IRF3 signaling and type I IFN production. Additionally, bacterial cyclic dinucleotides (such as bacterial cyclic di-AMP) activate STING. Therefore, STING is an immunoregulatory protein that induces type I interferons. 5'-triphosphate RNA and double-stranded RNA are sensed by RIG-I and MDA-5 alone or MDA-5 / LGP2. This leads to the polymerization of mitochondrial MAVS (mitochondrial antiviral signaling protein) and the activation of TANK-binding kinase 1 (TBK1) and interferon regulatory factor 3 (IRF3). Proteins in such pathways are immunostimulatory and responsible for the expression of innate immune response mediators, such as type I interferon. Immunomodulatory proteins in DNA / RNA sensor pathways can be modified to have increased activity or to operate constitutively in the absence of intracellular nucleic acids, leading to an immune response, such as the expression of type I interferon.
[0089] As used herein, the "carboxy-terminal tail" or "C-terminal tail" (CTT) of the innate immune protein STING refers to the C-terminal portion of the STING protein, which, in wild-type STING, is connected to the cGAMP-binding domain by a flexible linker region. The CTT contains IRF3-, TBK1-, and TRAF6-binding sites. STING promotes the induction of interferon beta (IFN-β) production through phosphorylation of the STING protein C-terminal tail (CTT) by TANK-binding kinase 1 (TBK1). The interaction of STING with TBK1 is mediated by an evolutionarily conserved stretch of eight amino acid residues within the carboxy-terminal tail (CTT) of STING. TRAF6 catalyzes the formation of K63-linked ubiquitin chains on STING, leading to activation of the transcription factor NF-κB and induction of alternative STING-dependent gene expression programs. Deletion or disruption of the TRAF6-binding site within the CTT can reduce activation of NF-κB signaling. Substitution of the human STING CTT (or a portion thereof) with the CTT (or a corresponding portion) from STING proteins of species with low NF-κB activation can result in reduced NF-κB activation by the resulting modified human STING protein. The STING CTT is an unstructured stretch of approximately 40 amino acids that contains a sequence motif required for STING phosphorylation and IRF3 recruitment [see de Oliveira Mann et al. (2019) Cell Reports 27:1165-1175]. Human STING residue S366 has been identified as a major TBK1 phosphorylation site, part of the LxIS motif shared among innate immune adaptor proteins that activate interferon signaling [see de Oliveira Mann et al. (2019) Cell Reports 27:1165-1175].Human STING CTT contains a second PxPLR motif, involving residue L374, that is required for TBK1 binding; the LxIS and PxPLR sequences are conserved among vertebrate STING alleles [see de Oliveira Mann et al. (2019) Cell Reports 27:1165-1175]. Exemplary STING CTT sequences, as well as IRF3, TBK1, and TRAF6 binding sites, are shown in the table below:
[0090] [Table 1]
[0091] As used herein, a "STING pathway agonist" is any product that increases type I interferon (IFN) expression through activation of the STING pathway. Examples of such agonists include the gain-of-function STING polypeptide mutants provided herein, as well as gain-of-function mutants of other intracellular DNA / RNA sensors and type I IFN pathway proteins, such as mutants of IRF-3, IRF-7, MDA5, and RIG-I, which increase constitutive type I IFN expression via the STING pathway.
[0092] As used herein, a bacterium that has been modified to "induce less cell death of tumor-resident immune cells" or "induce less cell death of immune cells" is one that is less toxic than the unmodified bacterium or has reduced pathogenicity compared to the unmodified bacterium. Examples of such modifications include those that eliminate pyroptosis of phagocytes and those that alter the bacterial lipopolysaccharide (LPS) profile. These modifications include disruption or deletion of the flagellin gene, pagP, or one or more components of the SPI-1 pathway, such as hilA, rod proteins (e.g., prgJ), needle proteins (e.g., prgI), and QseC.
[0093] As used herein, bacteria that are "modified to preferentially infect tumor-resident immune cells" or "modified to preferentially infect immune cells" have a modification in their genome that reduces their ability to infect cells other than immune cells. Examples of such modifications include modifications that disrupt the type 3 or type 4 secretion system, or other genes or systems that affect the ability of bacteria to invade non-immune cells. For example, modifications include the disruption / deletion of SPI-1 components, which are required for the infection of cells, such as epithelial cells, but do not affect the infection of immune cells, such as phagocytes, by Salmonella.
[0094] As used herein, "modification" refers to a modification of the amino acid sequence of a polypeptide or the sequence of nucleotides in a nucleic acid molecule, including deletion, insertion, and substitution of amino acids or nucleotides, respectively. Methods of modifying polypeptides are common to those skilled in the art, such as by using recombinant DNA methodology.
[0095] As used herein, modifications to a bacterial genome, plasmid, or gene include nucleic acid deletions, substitutions, and insertions.
[0096] As used herein, RNA interference (RNAi) is a biological process in which RNA molecules inhibit gene expression or translation by neutralizing target mRNA molecules to inhibit translation of the target gene, thereby inhibiting expression.
[0097] As used herein, RNA molecules that act through RNAi are referred to as silencing the expression of target genes.Silencing expression means that the expression of target genes is reduced, suppressed or inhibited.
[0098] As used herein, RNAi-mediated gene silencing refers to inhibiting, suppressing, disrupting or suppressing the expression of target gene.Target gene contains the sequence of nucleotides corresponding to the sequence of inhibitory RNA, thereby the inhibitory RNA suppresses the expression of target mRNA.
[0099] As used herein, inhibiting, suppressing, disrupting, or silencing a target gene refers to a process of altering the expression, e.g., translation, of a target gene, thereby reducing the activity or expression of the product encoded by the target gene. Reduction includes complete or partial knockout, thereby achieving treatment with the immunostimulatory bacteria provided herein and the administration herein.
[0100] As used herein, small interfering RNA (siRNA) is a small piece of double-stranded (ds) RNA, usually about 21 nucleotides long, with a 3' overhang (two nucleotides) at each end that can "interfere" with protein translation by binding to messenger RNA (mRNA) at a specific sequence and promoting its degradation.By doing so, siRNA prevents the production of a specific protein based on the nucleotide sequence of its corresponding mRNA.This process is called RNA interference (RNAi), also known as siRNA silencing or siRNA knockdown.
[0101] As used herein, short hairpin RNA or small hairpin RNA (shRNA) is an artificial RNA molecule with a tight hairpin turn, which can be used to silence target gene expression through RNA interference (RNAi).The expression of shRNA in cells is typically achieved by delivering plasmids or through viral or bacterial vectors.
[0102] As used herein, the tumor microenvironment (TME) refers to the cellular environment in which a tumor resides, including surrounding blood vessels, immune cells, fibroblasts, bone marrow-derived inflammatory cells, lymphocytes, signaling molecules, and the extracellular matrix (ECM). Conditions present include, but are not limited to, increased angiogenesis, hypoxia, low pH, increased lactate concentration, increased pyruvate concentration, increased interstitial fluid pressure, and altered metabolites or metabolism, such as higher levels of adenosine, indicative of a tumor.
[0103] As used herein, "bactofection" refers to the bacteria-mediated transfer of genes or plasmid DNA into eukaryotic cells, such as mammalian cells.
[0104] As used herein, human type I interferon (IFN) is a subgroup of interferon proteins that regulate the activity of the immune system. All type I IFNs bind to specific cell surface receptor complexes, such as the IFN-α receptor. Type I interferons include, among others, IFN-α and IFN-β. Myeloid cells are the major producers of IFN-α and IFN-β, which have antiviral activity and are primarily involved in the innate immune response. Two types of IFN-β are IFN-β1 (IFNB1) and IFN-β3 (IFNB3).
[0105] As used herein, the terms M1 macrophage phenotype and M2 macrophage phenotype refer to two broad groups of macrophage phenotypes: M1 (classically activated macrophages) and M2 (alternatively activated macrophages). The role of M1 macrophages is to secrete proinflammatory cytokines and chemokines, participate in positive immune responses, and present antigens to function as immune monitors. The major proinflammatory cytokines produced are IL-6, IL-12, and TNF-alpha. M2 macrophages primarily secrete arginase-I, IL-10, TGF-β, and other anti-inflammatory cytokines, which function to reduce inflammation and contribute to tumor growth and immunosuppressive function. Macrophages with an M1-like phenotype secrete proinflammatory cytokines but lack the immunosuppressive activity of M2 macrophages. Conversion of M2 macrophages to M1 or M1-like phenotype converts M2 macrophages into macrophages that are not immunosuppressive but are involved in anti-tumor responses. M2 macrophages that are converted to macrophages with an M1 or M1-like phenotype exhibit more proinflammatory cytokines / chemokines and receptors, such as CD80 and CCR7, and chemokines, such as IFNγ and CXCL10. M1 phenotype markers include, but are not limited to, one or more of CD80, CD86, CD64, CD16, and CD32. Expression of nitric oxide synthase (iNOS) in M1 macrophages can also serve as a phenotype marker. CD163 and CD206 are key markers for identifying M2 macrophages. Other surface markers for M2-type cells include CD68. The reduction or elimination of all M2 markers and the increase in cytokines / chemokines indicative of M1 macrophages reflect the conversion from the M2 phenotype to the M1 or M1-like phenotype. The following section and examples of the conversion from M2 to M1-like or M1 phenotype describe exemplary cytokine profiles and markers that are induced.
[0106] As used herein, the statement that a nucleic acid or encoded RNA targets a gene means that it inhibits, suppresses, or silences the expression of the gene by some mechanism. Typically, such a nucleic acid contains at least a portion that is complementary to the target gene, which portion is sufficient to form a hybrid with the complementary portion.
[0107] As used herein, a "deletion" when referring to a nucleic acid or polypeptide sequence refers to the deletion of one or more nucleotides or amino acids compared to a sequence, e.g., a target polynucleotide or polypeptide, or a native or wild-type sequence.
[0108] As used herein, an "insertion," when referring to a nucleic acid or amino acid sequence, describes the inclusion of one or more additional nucleotides or amino acids within a target, native, wild-type, or other related sequence. Thus, a nucleic acid molecule containing one or more insertions compared to a wild-type sequence contains one or more additional nucleotides within the linear length of the sequence.
[0109] As used herein, "addition" to nucleic acid and amino acid sequences describes the addition of a nucleotide or amino acid onto either end compared to another sequence.
[0110] As used herein, "substitution" or "replacement" refers to the replacement of one or more nucleotides or amino acids in a native, target, wild-type, or other nucleic acid or polypeptide sequence with alternative nucleotides or amino acids without changing the length of the molecule (described in terms of the number of nucleotides or residues). Thus, one or more substitutions within a molecule do not change the number of nucleotides or amino acid residues in the molecule. Amino acid substitutions compared to a particular polypeptide can be expressed in terms of the number of amino acid residues along the length of the polypeptide sequence.
[0111] As used herein, "at a position corresponding to," or a statement that a nucleotide or amino acid position "corresponds to" a nucleotide or amino acid position in a disclosed sequence, e.g., as shown in a sequence listing, refers to a nucleotide or amino acid position identified by alignment with the disclosed sequence to maximize identity using a standard alignment algorithm, e.g., the GAP algorithm. By aligning the sequences, one skilled in the art can identify corresponding residues, e.g., using conserved and identical amino acid residues as a guide. Generally, to identify corresponding positions, amino acid sequences are aligned to obtain the highest order match (see, e.g., Computational Molecular Biology, Lesk, AM, ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, DW, ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, AM, and Griffin, HG, eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carrillo et al. (1988) SIAM J. Applied Math 48:1073).
[0112] As used herein, sequence alignment refers to the use of homology to align two or more sequences of nucleotides or amino acids. Typically, two or more sequences related by 50% or more identity are aligned. An aligned sequence set refers to two or more sequences aligned at corresponding positions and may include aligning sequences derived from RNA, such as ESTs and other cDNAs, with genomic DNA sequences. Related polypeptide or nucleic acid molecules, or variant polypeptides or nucleic acid molecules, can be aligned by any method known to those skilled in the art. Such methods typically maximize matches and include, for example, manual alignment and the use of numerous alignment programs available (e.g., BLASTP) and others known to those skilled in the art. By aligning polypeptide or nucleic acid sequences, one skilled in the art can identify similar portions or positions using conserved and identical amino acid residues as a guide. Furthermore, one skilled in the art can also find corresponding amino acid or nucleotide residues between human and non-human sequences using conserved amino acid or nucleotide residues as a guide. Corresponding positions can also be based on structural alignment, for example, using computer-simulated alignment of protein structures. In other examples, corresponding regions can be identified. One skilled in the art can also find corresponding amino acid residues between human and non-human sequences using conserved amino acid residues as a guide.
[0113] As used herein, a "property" of a polypeptide, e.g., an antibody, refers to any characteristic exhibited by the polypeptide, including, but not limited to, binding specificity, structural configuration or conformation, protein stability, resistance to proteolysis, structural stability, thermal resistance, and resistance to pH conditions. A change in a property can alter the "activity" of the polypeptide. For example, a change in the binding specificity of an antibody polypeptide can alter the ability to bind to an antigen and / or various binding activities, e.g., affinity or avidity, or the in vivo activity of the polypeptide.
[0114] As used herein, "activity" or "functional activity" of a polypeptide, e.g., an antibody, refers to any activity exhibited by the polypeptide. Such activity can be determined experimentally. Exemplary activities include, but are not limited to, the ability to interact with a biomolecule, e.g., through antigen binding, DNA binding, ligand binding, or dimerization, or enzymatic activity, e.g., kinase activity, or proteolytic activity. For antibodies (including antibody fragments), activities include, but are not limited to, the ability to specifically bind to a particular antigen, the affinity of antigen binding (e.g., high affinity or low affinity), the avidity of antigen binding (e.g., high avidity or low avidity), the on-rate, the off-rate, effector functions, e.g., the ability to promote antigen neutralization or clearance, virus neutralization, and in vivo activity, e.g., the ability to prevent infection or invasion of, or promote the clearance of, a pathogen, or to enter specific tissues, fluids, or cells in the body. Activity can be assessed in vitro or in vivo using recognized assays, such as ELISA, flow cytometry, surface plasmon resonance or equivalent assays that measure on-rate or off-rate, immunohistochemistry and immunofluorescence histology and microscopy, cell-based assays, and binding assays (e.g., panning assays).
[0115] As used herein, "binding," "bonded," or grammatical variations thereof, refers to the participation of one molecule in any attractive interaction with another molecule that results in a stable association in which the two molecules are in close proximity to one another. Binding includes, but is not limited to, non-covalent bonds, covalent bonds (e.g., reversible covalent bonds and irreversible covalent bonds), and includes interactions between molecules, such as, but not limited to, compounds, including proteins, nucleic acids, carbohydrates, lipids, and small molecules, such as drugs.
[0116] As used herein, "antibody" refers to immunoglobulins and immunoglobulin fragments, including any fragment, whether natural or partially or wholly synthetically, e.g., recombinantly produced, that contains at least a portion of the variable heavy and light chain regions of an immunoglobulin molecule sufficient to form an antigen-binding site and specifically bind to an antigen when assembled. Thus, an antibody includes any protein having a binding domain that is homologous or substantially homologous to an immunoglobulin antigen-binding domain (antibody combining site). For example, an antibody refers to an antibody containing two heavy chains (which may be designated H and H') and two light chains (which may be designated L and L'), where each heavy chain may be a full-length immunoglobulin heavy chain or a sufficient portion thereof to form an antigen-binding site (e.g., a heavy chain may be V and L'). H chain, V H -C H 1 chain, and V H -C H 1-C H 2-C H Each light chain can be a full-length light chain or a sufficient portion thereof to form an antigen-binding site (e.g., a light chain can have a V L Chain and V L -C L Each heavy chain (H and H') is paired with one light chain (L and L', respectively). Typically, antibodies are characterized by a variable heavy (V H ) chain and / or variable light (V LAt a minimum, the antibody may include all or at least a portion of the constant region.
[0117] For purposes herein, the term antibody includes full-length antibodies and portions thereof, including antibody fragments such as anti-CTLA-4 antibody fragments. Antibody fragments include Fab fragments, Fab' fragments, F(ab')2 fragments, Fv fragments, disulfide-linked Fvs (dsFvs), Fd fragments, Fd' fragments, single-chain Fvs (scFvs), scFv-Fc fragments (VFs within scFvs), and the like. H Domains include, but are not limited to, antibodies linked to Fc, such as human IgG1 Fc, single-chain Fab (scFab), diabodies, anti-idiotypic (anti-Id) antibodies, or antigen-binding fragments of any of the above. Antibodies also include synthetic antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., bispecific antibodies), human antibodies, non-human antibodies, humanized antibodies, chimeric antibodies, and intrabodies. Antibodies provided herein include members of any immunoglobulin class (e.g., IgG, IgM, IgD, IgE, IgA, and IgY), any subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2), or subsubclass (e.g., IgG2a and IgG2b). Antibodies for human therapeutic use are generally human or humanized.
[0118] As used herein, "antibody fragment" refers to (i) monovalent, monospecific antibody derivatives that contain the variable heavy and / or light chains, or functional fragments of an antibody, and lack the Fc portion; and (ii) BiTEs (tandem scFvs), DARTs, diabodies, and single-chain diabodies (scDbs). Thus, antibody fragments include Fab, Fab', scFab, scFv, scFv-Fc, Fv fragments, nanobodies (see, e.g., antibodies derived from Camelus bactriamus, Camelus dromedarius, or alpaca) [see, e.g., U.S. Pat. No. 5,759,808; and Stijlemans et al. (2004) J. Biol. Chem. 279:1256-1261], V, and VIII fragments. HH , dAb (single domain antibody), minimal recognition unit, single chain diabody (scDb), BiTE®, and DART. The antibody fragments listed have a molecular weight of less than 60 kDa.
[0119] As used herein, "nucleic acid" refers to at least two linked nucleotides or nucleotide derivatives, including deoxyribonucleic acid (DNA) and ribonucleic acid (RNA), typically linked by a phosphodiester bond. The term "nucleic acid" also includes nucleic acid analogs, such as peptide nucleic acid (PNA), phosphorothioate DNA, and other such analogs and derivatives, or combinations thereof. Nucleic acid also includes DNA and RNA derivatives containing, for example, nucleotide analogs or "backbone" bonds other than phosphodiester bonds, such as phosphotriester, phosphoramidate, phosphorothioate, thioester, or peptide bonds (peptide nucleic acids). The term also includes nucleotide analogs, as well as RNA or DNA equivalents, derivatives, variants, and analogs formed from single-stranded (sense or antisense) and double-stranded nucleic acids. Deoxyribonucleotides include deoxyadenosine, deoxycytidine, deoxyguanosine, and deoxythymidine. For RNA, the uracil base is uridine.
[0120] As used herein, an isolated nucleic acid molecule is one that is separated from other nucleic acid molecules that are present in the natural source of the nucleic acid molecule. An "isolated" nucleic acid molecule, such as a cDNA molecule, is substantially free of other cellular material or culture medium if produced by recombinant techniques, or is substantially free of chemical precursors or other chemicals if chemically synthesized. Exemplary isolated nucleic acid molecules provided herein include isolated nucleic acid molecules that encode the antibodies or antigen-binding fragments provided herein.
[0121] As used herein, "operably linked" or "operatively linked" with respect to nucleic acid sequences, regions, elements, or domains means that the nucleic acid regions are functionally related to each other. This refers to a juxtaposition whereby the components so described are in a relationship permitting them to function in their intended manner. For example, a promoter is operably linked to a coding sequence if the promoter affects transcription or expression. For example, a nucleic acid encoding a leader peptide can be operably linked to a nucleic acid encoding a polypeptide, such that the nucleic acid can be transcribed and translated to express a functional fusion protein, and the leader peptide causes secretion of the fusion polypeptide. In some instances, a nucleic acid encoding a first polypeptide (e.g., a leader peptide) is operably linked to a nucleic acid encoding a second polypeptide, such that the nucleic acids are transcribed as a single mRNA transcript, but translation of the mRNA transcript can result in one of two polypeptides being expressed. For example, an amber stop codon can be positioned such that when introduced into a partial amber suppressor cell between a nucleic acid encoding a first polypeptide and a nucleic acid encoding a second polypeptide, the resulting single mRNA transcript can be translated to produce a fusion protein containing the first and second polypeptides, or can be translated to produce only the first polypeptide. In another example, a promoter can be operably linked to a nucleic acid encoding a polypeptide, whereby the promoter controls or mediates transcription of the nucleic acid.
[0122] As used herein, "synthetic," for example with respect to a synthetic nucleic acid molecule or synthetic gene or synthetic peptide, refers to a nucleic acid molecule or gene or polypeptide molecule that is produced by recombinant and / or chemical synthesis methods.
[0123] As used herein, naturally occurring α-amino acid residues are those of the 20 α-amino acid residues found in nature that, in humans, are incorporated into proteins by specific recognition of tRNA molecules charged with the cognate mRNA codon.
[0124] As used herein, a "polypeptide" refers to two or more covalently linked amino acids. The terms "polypeptide" and "protein" are used interchangeably herein.
[0125] As used herein, "peptide" refers to a polypeptide that is from 2 to about 40 amino acids in length.
[0126] As used herein, an "amino acid" is an organic compound containing an amino group and a carboxylic acid group. Polypeptides contain two or more amino acids. For purposes herein, the amino acids contained in the provided antibodies and immunostimulatory proteins include the 20 naturally occurring amino acids (see table below), unnatural amino acids, and amino acid analogs (e.g., amino acids in which the α-carbon has a side chain). As used herein, the amino acids present in the various amino acid sequences of the polypeptides displayed herein are identified according to their well-known three-letter or one-letter abbreviations (see table below). Nucleotides present in various nucleic acid molecules and fragments are designated by standard single-letter designations routinely used in the art.
[0127] As used herein, "amino acid residue" refers to an amino acid formed by chemical digestion (hydrolysis) of a polypeptide at its peptide bonds. The amino acid residues described herein are typically in the "L" isomeric form. Residues in the "D" isomeric form can be substituted for any L-amino acid residue, as long as the desired functional property is retained by the polypeptide. NH2 refers to the free amino group present at the amino terminus of a polypeptide. COOH refers to the free carboxy group present at the carboxyl terminus of a polypeptide. In accordance with standard polypeptide nomenclature as described in J. Biol. Chem., 243:3557-59 (1968) and adopted at 37 CFR §§ 1.821-1.822, abbreviations for amino acid residues are set forth in the following table:
[0128] Correspondence table [Table 2]
[0129] All sequences of amino acid residues represented herein by formulas have a left-to-right orientation in the conventional direction from amino to carboxyl. The phrase "amino acid residue" is defined to include the amino acids listed in the table of correspondence above, as well as modified amino acids, unnatural amino acids, and unusual amino acids. A dash at the beginning or end of an amino acid residue sequence indicates a peptide bond to a further sequence of one or more amino acid residues, or to the amino-terminal group, e.g., NH2, or to the carboxyl-terminal group, e.g., COOH.
[0130] Suitable conservative substitutions of amino acids in peptides or proteins are known to those skilled in the art and can generally be made without altering the biological activity of the resulting molecule. Those skilled in the art will generally recognize that single amino acid substitutions in non-essential regions of a polypeptide will not substantially alter biological activity (see, for example, Watson et al., Molecular Biology of the Gene, 4th Edition, 1987, The Benjamin / Cummings Pub. Co., p. 224).
[0131] Such substitutions may be made according to the exemplary substitutions shown in the table below:
[0132] Exemplary Conservative Amino Acid Substitutions [Table 3]
[0133] Other substitutions are also permissible and can be determined empirically or in accordance with other known conservative or non-conservative substitutions.
[0134] As used herein, "naturally occurring amino acids" refers to the 20 L-amino acids that occur in polypeptides.
[0135] As used herein, the term "unnatural amino acid" refers to an organic compound that has a structure similar to a natural amino acid, but that has been structurally modified to mimic the structure and reactivity of the natural amino acid. Thus, examples of unnatural amino acids include amino acids or amino acid analogs other than the 20 naturally occurring amino acids, including, but not limited to, D-stereoisomers of amino acids. Exemplary unnatural amino acids are known to those of skill in the art and include 2-aminoadipic acid (Aad), 3-aminoadipic acid (bAad), β-alanine / β-aminopropionic acid (Bala), 2-aminobutyric acid (Abu), 4-aminobutyric acid / piperidine acid (4Abu), 6-aminocaproic acid (Acp), 2-aminoheptanoic acid (Ahe), 2-aminoisobutyric acid (Aib), 3-aminoisobutyric acid (Baib), 2-aminopimelic acid (Apm), 2,4-diaminobutyric acid (Dbu), desmosine (Des), 2,2′-diaminopimelic acid (Dpm), 2,3-diaminopropionic acid (Dpr). , N-ethylglycine (EtGly), N-ethylasparagine (EtAsn), hydroxylysine (Hyl), allo-hydroxylysine (Ahyl), 3-hydroxyproline (3Hyp), 4-hydroxyproline (4Hyp), isodesmosine (Ide), allo-isoleucine (Aile), N-methylglycine, sarcosine (MeGly), N-methylisoleucine (MeIle), 6-N-methyllysine (MeLys), N-methylvaline (MeVal), norvaline (Nva), norleucine (Nle), and ornithine (Orn).
[0136] As used herein, a DNA construct is a single- or double-stranded, linear or circular DNA molecule that contains segments of DNA combined and juxtaposed in a manner not found in nature. DNA constructs exist as a result of human manipulation and include clones and other copies of engineered molecules.
[0137] As used herein, a DNA segment is a portion of a larger DNA molecule having specified attributes. For example, a DNA segment encoding a specified polypeptide is a portion of a longer DNA molecule, such as a plasmid or plasmid fragment, that, when read in the 5' to 3' direction, encodes the sequence of amino acids of the specified polypeptide.
[0138] As used herein, the term "polynucleotide" refers to a single- or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5' to the 3' end. Polynucleotides include RNA and DNA, and the polynucleotides can be isolated from natural sources, synthesized in vitro, or prepared from a combination of natural and synthetic molecules. The length of a polynucleotide molecule is given herein in terms of nucleotides (abbreviated "nt") or base pairs (abbreviated "bp"). The term nucleotide is used for single- and double-stranded molecules, where the context permits. When used in reference to a double-stranded molecule, the term is used to refer to the total length and will be understood to be equivalent to the term base pair. Those skilled in the art will recognize that the two strands of a double-stranded polynucleotide may differ slightly in length and that their ends may be staggered; therefore, not all nucleotides in a double-stranded polynucleotide molecule may be paired. Such unpaired ends generally do not exceed 20 nucleotides in length.
[0139] As used herein, production by recombinant means refers to the use of well-known methods of molecular biology to express proteins encoded by cloned DNA.
[0140] As used herein, a "heterologous nucleic acid" is a nucleic acid that encodes a product (i.e., RNA and / or protein) not normally produced in vivo by the cell in which it is expressed, or a nucleic acid that resides in a locus where it is not normally present, or that mediates or encodes a mediator that alters the expression of an endogenous nucleic acid, e.g., DNA, by affecting transcription, translation, or other regulatable biochemical processes. Heterologous nucleic acids, e.g., DNA, are also referred to as foreign nucleic acids. Any nucleic acid, e.g., DNA, that one of skill in the art would recognize or consider to be heterologous to the cell in which it is expressed or foreign to that cell is included herein as heterologous nucleic acid; heterologous nucleic acids include exogenously added nucleic acids that are also expressed endogenously. Heterologous nucleic acids are typically introduced but not endogenous to the cell, obtained from another cell, or prepared synthetically, or introduced into a genomic locus that is not naturally occurring or whose expression is under the control of regulatory sequences or sequences different from the natural regulatory sequences.
[0141] Examples of heterologous nucleic acids herein include, but are not limited to, nucleic acids encoding proteins in DNA / RNA sensor pathways, or gain-of-function or constitutively active mutants thereof, or immunostimulatory proteins, e.g., cytokines, chemokines, or costimulatory molecules, that confer or contribute to anti-tumor immunity in the tumor microenvironment. Also included are other products that confer or contribute to anti-tumor immunity in the tumor microenvironment, e.g., antibodies and fragments thereof, BiTE®, decoy receptors, antagonizing polypeptides, and RNAi. In immunostimulatory bacteria, heterologous nucleic acids are generally encoded on an introduced plasmid, but can also be introduced into the bacterial genome, e.g., a promoter that alters expression of a bacterial product. Heterologous nucleic acids, e.g., DNA, can include nucleic acids that can mediate in some way the expression of DNA encoding a therapeutic product, or the heterologous nucleic acid can encode a product, e.g., a peptide or RNA, that in some way mediates, directly or indirectly, the expression of a therapeutic product.
[0142] As used herein, cell therapy includes the delivery of cells to a subject to treat a disease or condition. The cells, which may be allogeneic or autologous to the subject, are modified ex vivo, for example, by infection of the cells with immunostimulatory bacteria, as described herein, that deliver or express a product when introduced into the subject.
[0143] As used herein, genetic therapy involves the transfer of heterologous nucleic acid, e.g., DNA, into specific cells, e.g., target cells, of a mammal, particularly a human, having a disorder or condition for which such treatment is sought. The nucleic acid, e.g., DNA, is introduced into the selected target cells so that the heterologous nucleic acid, e.g., DNA, is expressed to produce the therapeutic product encoded thereby. Genetic therapy can also be used to deliver nucleic acids encoding gene products that replace defective genes or supplement gene products produced by the mammal or cell into which they are introduced. The introduced nucleic acid can encode a therapeutic compound, e.g., a growth factor or its inhibitor, or a tumor necrosis factor or its inhibitor, e.g., its receptor, that is not normally produced in the mammalian host, or not produced in therapeutically effective amounts or at a therapeutically useful time. Heterologous nucleic acid, e.g., DNA, encoding a therapeutic product can be modified before introduction into the cells of the affected host to enhance or inhibit its production or expression. Genetic therapy can also include the delivery of inhibitors or repressors of gene expression or other regulators.
[0144] As used herein, "expression" refers to the process by which a polypeptide is produced by transcription and translation of a polynucleotide. The level of polypeptide expression can be evaluated using any method known in the art, including, for example, a method for determining the amount of polypeptide produced from a host cell. Such methods can include, but are not limited to, quantification of polypeptide in cell lysates by ELISA, Coomassie blue staining after gel electrophoresis, Lowry protein assay, and Bradford protein assay.
[0145] As used herein, a "host cell" is a cell used to receive, maintain, replicate, and / or propagate a vector. A host cell can also be used to express a polypeptide encoded by a vector. The nucleic acid contained within the vector is replicated when the host cell divides, thereby amplifying the nucleic acid.
[0146] As used herein, a "vector" refers to a replicable nucleic acid capable of expressing one or more heterologous proteins when transformed into an appropriate host cell. Reference to a vector includes vectors into which a nucleic acid encoding a polypeptide or a fragment thereof can be introduced, typically by restriction digestion and ligation. Reference to a vector also includes vectors containing a nucleic acid encoding a polypeptide, such as a modified anti-CTLA-4 antibody. Vectors are used to introduce a nucleic acid encoding a polypeptide into a host cell for amplification of the nucleic acid or for expression / display of the polypeptide encoded by the nucleic acid. While vectors typically remain episomal, they can be designed to cause integration of a gene or portion thereof into a chromosome of the genome. Also contemplated are vectors that are artificial chromosomes, such as yeast artificial chromosomes and mammalian artificial chromosomes. The selection and use of such vehicles are well known to those skilled in the art. Also included in the term "viral vector" or "viral vector." A viral vector is an engineered virus operably linked to a foreign gene for the purpose of transferring the foreign gene into cells (as a vehicle or shuttle).
[0147] As used herein, "expression vector" includes a vector capable of expressing DNA operably linked to a regulatory sequence, such as a promoter region capable of inducing expression of such a DNA fragment. Such additional segments can include promoter and terminator sequences, and, optionally, one or more origins of replication, one or more selectable markers, an enhancer, and a polyadenylation signal. Expression vectors are usually derived from plasmid or viral DNA or can contain elements of both. Thus, an expression vector refers to a recombinant DNA or RNA construct, such as a plasmid, phage, recombinant virus, or other vector, that, upon introduction into an appropriate host cell, results in expression of the cloned DNA. Suitable expression vectors are well known to those skilled in the art and include those that are replicable in eukaryotic and / or prokaryotic cells, as well as those that remain episomal or integrate into the host cell genome.
[0148] As used herein, "primary sequence" refers to the sequence of amino acid residues in a polypeptide or the sequence of nucleotides in a nucleic acid molecule.
[0149] As used herein, "sequence identity" refers to the number of identical or similar amino acids or nucleotide bases in a comparison between a test polypeptide or polynucleotide and a reference polypeptide or polynucleotide. Sequence identity can be determined by sequence alignment of nucleic acid or protein sequences to identify regions of similarity or identity. For purposes herein, sequence identity is typically determined by alignment to identify identical residues. Alignment can be local or global. Matches, mismatches, and gaps can be identified between the compared sequences. A gap is a null amino acid or null nucleotide inserted between residues of aligned sequences so that identical or similar characters are aligned. Typically, internal and terminal gaps can exist. When gap penalties are used, sequence identity can be determined without penalty for terminal gaps (e.g., terminal gaps are not penalized). Alternatively, sequence identity can be determined without considering gaps by dividing the number of identical positions by the total length of the aligned sequences x 100.
[0150] As used herein, a "global alignment" is an alignment that aligns two sequences from beginning to end, aligning each character in each sequence only once. The alignment is made regardless of whether similarity or identity exists between the sequences. For example, 50% sequence identity based on a "global alignment" means that 50% of the residues are the same in the complete alignment of two sequences, each 100 nucleotides long. It is also understood that global alignment can be used to determine sequence identity even when the aligned sequences are not the same length. Differences at the ends of the sequences will be taken into account when determining sequence identity unless "no penalty for end gaps" is selected. Typically, global alignment is used for sequences that share significant similarity over most of their entire length. Exemplary algorithms for performing global alignment include the Needleman-Wunsch algorithm [Needleman et al. (1970) J. Mol. Biol. 48:443-453]. Exemplary programs for performing global alignments are publicly available and include the Global Sequence Alignment Tool available at the National Center for Biotechnology Information (NCBI) website (ncbi.nlm.nih.gov / ), and the program available at deepc2.psi.iastate.edu / aat / align / align.html.
[0151] As used herein, a "local alignment" is an alignment that aligns two sequences, but only aligns portions of the sequences that share similarity or identity. Thus, a local alignment determines whether a subsegment of one sequence is present in the other sequence. If there is no similarity, no alignment is returned. Local alignment algorithms include BLAST or the Smith-Waterman algorithm [Adv. Appl. Math. 2:482 (1981)]. For example, 50% sequence identity based on a "local alignment" means that in a complete sequence alignment of two compared sequences of any length, a 100-nucleotide-long region of similarity or identity has 50% of the residues that are the same in that region of similarity or identity.
[0152] For the purposes herein, sequence identity can be determined by standard alignment algorithm programs, using the default gap penalty established by each supplier.The default parameters for GAP program can include: (1) the unary comparison matrix (containing a value of 1 for identity and 0 for non-identity) and weighted comparison matrix of Gribskov et al. (1986) Nucl. Acids Res. 14: 6745-6763, as described by Schwartz and Dayhoff, eds., Atlas of Protein Sequence and Structure, National Biomedical Research Foundation, pp. 353-358 (1979); (2) a penalty of 3.0 for each gap, and an additional penalty of 0.10 for each symbol in each gap; and (3) no penalty for terminal gaps. Whether any two nucleic acid molecules have nucleotide sequences or any two polypeptides have amino acid sequences that are at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% (or other similar variations that list percent identity) "identical" can be determined using known computer algorithms based on local or global alignments (see, e.g., wikipedia.org / wiki / Sequence_alignment_software, which provides links to dozens of known, publicly available alignment databases and programs).Typically, for purposes herein, sequence identity is determined using a computer algorithm based on global alignments, such as the Needleman-Wunsch Global Sequence Alignment tool available from NCBI / BLAST (blast.ncbi.nlm.nih.gov / Blast.cgi?CMD=Web&Page_TYPE=BlastHome); LAlign [William Pearson implementing the Huang and Miller algorithm (Adv. Appl. Math. (1991) 12:337-357]; and the Xiaoqui Huang program available at deepc2.psi.iastate.edu / aat / align / align.html. Typically, the full-length sequences of each of the polypeptide or nucleotide sequences being compared are aligned over the entire length of each sequence in a global alignment. Local alignments can also be used when the sequences to be compared are substantially the same length.
[0153] Thus, the term "identity" as used herein refers to a comparison or alignment between a test polypeptide or polynucleotide and a reference polypeptide or polynucleotide. In one non-limiting example, "at least 90% identical to" refers to a percent identity of 90% to 100% relative to the reference polypeptide or polynucleotide. For illustrative purposes, identity at a level of 90% or greater refers to the fact that, when a test polypeptide or polynucleotide length of 100 amino acids or nucleotides is compared with a reference polypeptide or polynucleotide length, 10% or less (i.e., 10 out of 100) of the amino acids or nucleotides in the test polypeptide or polynucleotide differ from those in the reference polypeptide or polynucleotide. Similar comparisons can be made between test and reference polynucleotides. Such differences can be expressed as point mutations randomly distributed throughout the entire length of the amino acid sequence, or can be clustered at one or more positions of varying lengths, up to the maximum allowable amino acid difference (approximately 90% identity), e.g., 10 / 100. Differences can also be due to deletion or truncation of amino acid residues. Differences are defined as nucleic acid or amino acid substitutions, insertions, or deletions. At homology or identity levels greater than about 85-90%, depending on the length of the sequences being compared, results can be independent of the program and gap parameters set; such high levels of identity can often be easily assessed without relying on software.
[0154] As used herein, "disease or disorder" refers to a pathological condition in an organism resulting from a cause or condition, including but not limited to infections, acquired conditions, and genetic conditions, and those characterized by definable symptoms.
[0155] As used herein, "treating" a subject suffering from a disease or condition means that the subject's symptoms are partially or totally alleviated or remain static following treatment.
[0156] As used herein, "treatment" refers to any action that ameliorates the symptoms of a disease or disorder. Treatment includes prophylactic treatment, therapy, and / or therapy. Treatment also includes any pharmaceutical use of any of the immune stimulatory bacteria or compositions provided herein.
[0157] As used herein, "prophylactic treatment" refers to the prevention of potential disease and / or the prevention of worsening of disease symptoms or progression of disease.
[0158] As used herein, "prevention" or prophylactic treatment and its grammatical equivalents refer to a method in which the risk or likelihood of developing a disease or condition is reduced.
[0159] As used herein, a "pharmaceutically active agent" includes any therapeutic or bioactive agent, including, but not limited to, anesthetics, vasoconstrictors, dispersing agents, and conventional therapeutic agents, including small molecule drugs and therapeutic proteins.
[0160] As used herein, "therapeutic effect" means an effect resulting from treatment of a subject that alters, or typically improves or ameliorates, the symptoms of a disease or condition or cures the disease or condition.
[0161] As used herein, a "therapeutically effective amount" or "therapeutically effective dose" refers to the amount of an agent, compound, material, or composition containing at least enough of a compound to produce a therapeutic effect after administration to a subject. This is therefore the amount necessary to prevent, treat, ameliorate, suppress, or partially suppress the symptoms of a disease or disorder.
[0162] As used herein, "therapeutic efficacy" refers to the ability of an agent, compound, material, or composition containing a compound to produce a therapeutic effect in a subject to which the agent, compound, material, or composition containing the compound is administered.
[0163] As used herein, "prophylactically effective amount" or "prophylactically effective dose" refers to the amount of an agent, compound, material, or composition containing a compound that, when administered to a subject, has the intended preventive effect, such as preventing or delaying the onset or recurrence of a disease or disease symptom, reducing the likelihood of the onset or recurrence of a disease or disease symptom, or reducing the incidence of a viral infection. A complete preventive effect does not necessarily occur by administering a single dose, but may occur only after administering a series of doses. Thus, a prophylactically effective amount can be administered in one or more administrations.
[0164] As used herein, amelioration of symptoms of a particular disease or disorder by treatment, e.g., by administration of a pharmaceutical composition or other therapeutic agent, refers to any lasting or transient reduction in symptoms, whether permanent or temporary, that can result from or be associated with the administration of the composition or therapeutic agent.
[0165] As used herein, "anti-cancer agent" or "anti-cancer therapeutic agent" refers to any agent or therapeutic agent that is directly or indirectly destructive or toxic to malignant cells and tissues. For example, anti-cancer agents include agents that kill cancer cells or otherwise inhibit or impair the growth of tumors or cancer cells. Exemplary anti-cancer agents are chemotherapeutic agents and immunotherapeutic agents.
[0166] As used herein, "therapeutic activity" refers to the in vivo activity of a therapeutic product, e.g., polypeptides, nucleic acid molecules, and other therapeutic molecules. Typically, therapeutic activity is activity associated with the treatment of a disease or condition.
[0167] As used herein, the term "subject" refers to animals, including mammals, for example, humans.
[0168] As used herein, a patient refers to a human subject.
[0169] As used herein, "animal" includes any animal, such as, but not limited to, primates, including humans, gorillas, and monkeys; rodents, e.g., mice and rats; poultry, e.g., chickens; ruminants, e.g., goats, cows, deer, and sheep; and pigs and other animals. Non-human animals exclude humans as intended animals. Polypeptides provided herein are derived from any source, animal, plant, prokaryotic, and fungal. Most polypeptides are of animal origin, including mammalian origin.
[0170] As used herein, a "composition" refers to any mixture. The composition may be a solution, suspension, liquid, powder, paste, aqueous, non-aqueous, or any combination thereof.
[0171] As used herein, a "combination" refers to any association between two or more items. A combination can be two or more separate items, such as two compositions or two collections, a mixture thereof, such as a single mixture of two or more items, or any variation thereof. The elements of a combination are typically functionally associated or related.
[0172] As used herein, "combination therapy" refers to the administration of two or more different therapeutic agents. The different therapeutic agents may be provided and administered separately, sequentially, intermittently, or in a single composition.
[0173] As used herein, a "kit" is a packaged combination, which may include other elements, e.g., additional reagents, and instructions for use of the combination or elements, for purposes including, but not limited to, activation, administration, diagnosis, and evaluation of a biological activity or property.
[0174] As used herein, "unit dosage form" refers to physically discrete units suitable for human and animal subjects, individually packaged as known in the art.
[0175] As used herein, "single dosage formulation" refers to a formulation for direct administration.
[0176] As used herein, a "multi-dose formulation" refers to a formulation that contains multiple doses of a therapeutic agent and can be directly administered to provide several single doses of the therapeutic agent. The doses can be administered over minutes, hours, weeks, days, or months. Multi-dose formulations can allow for dose adjustment, dose pooling, and / or dose splitting. Because multi-dose formulations are used over time, they usually contain one or more preservatives to prevent microbial growth.
[0177] As used herein, an "article of manufacture" is a product that is manufactured and sold. As used throughout this application, the term is intended to encompass any composition provided herein contained within an article of packaging.
[0178] As used herein, "fluid" refers to any composition that can flow. Fluids therefore encompass compositions that are in the form of semi-solids, pastes, solutions, aqueous mixtures, gels, lotions, creams, and other such compositions.
[0179] As used herein, an isolated or purified polypeptide or protein (e.g., an isolated antibody or antigen-binding fragment thereof) or biologically active portion thereof (e.g., an isolated antigen-binding fragment) is substantially free of cellular material or other contaminating proteins from the cell or tissue from which the polypeptide or protein is derived, or is substantially free of chemical precursors or other chemicals when chemically synthesized. A preparation can be determined to be substantially free if it appears free of readily detectable impurities as determined by standard analytical methods used by those skilled in the art to assess purity, such as thin-layer chromatography (TLC), gel electrophoresis, and high-performance liquid chromatography (HPLC), or if it is sufficiently pure that further purification does not detectably alter the physical and chemical properties, e.g., the enzymatic and biological activity of the substance. Methods for purifying compounds to produce substantially chemically pure compounds are known to those skilled in the art. However, a substantially chemically pure compound may be a mixture of stereoisomers. In such cases, further purification may enhance the specific activity of the compound.
[0180] As used herein, "cellular extract" or "lysate" refers to a preparation or fraction comprised of lysed or disrupted cells.
[0181] As used herein, a "control" refers to a sample that is substantially identical to the test sample, except that it is not treated with the test parameters or, if a plasma sample, may be derived from a normal volunteer not affected by the condition of interest. A control may also be an internal control.
[0182] As used herein, the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a polypeptide comprising an "immunoglobulin domain" includes polypeptides having one or more of the immunoglobulin domains.
[0183] As used herein, the term "or" is used to mean "and / or" unless expressly stated to refer to alternatives only or unless the alternatives are mutually exclusive.
[0184] As used herein, ranges and amounts may be expressed as "about" a particular value or range. Also, "about" includes the exact amount. Thus, "about 5 amino acids" means "about 5 amino acids" as well as "5 amino acids."
[0185] As used herein, "may, optionally, or optionally" means that the subsequently described event or circumstance may or may not occur, and that the description includes instances in which the event or circumstance occurs and instances in which it does not occur. For example, the term "optionally" refers to a moiety that is either a variant or a non-variant.
[0186] Abbreviations for all protecting groups, amino acids, and other compounds used herein follow their common usage, recognized abbreviations, or those of the IUPAC-IUB Commission on Biochemical Nomenclature [see Biochem. (1972) 11(9): 1726-1732] unless otherwise specified.
[0187] For clarity of disclosure, and not by way of limitation, the detailed description is divided into the following subsections.
[0188] B. Overview of Immunostimulatory Bacteria for Cancer Treatment The recognition that bacteria have anti-cancer activity dates back to the 19th century, when several physicians observed tumor regression in patients infected with Streptococcus pyogenes. William Coley initiated the first research into the use of bacteria to treat advanced cancer and developed a vaccine composed of S. pyogenes and Serratia marcescens, which was used successfully to treat a variety of cancers, including sarcoma, carcinoma, lymphoma, and melanoma. Since then, several bacterial species have been investigated as sources of anti-cancer vaccines, including Clostridium, Mycobacterium, Bifidobacterium, Listeria monocytogenes, and Escherichia (see, e.g., International PCT Application Publication Nos. WO 1999 / 013053 and WO 2001 / 025399; Bermudez et al. (2002) Curr. Opin. Drug Discov. Devel. 5:194-199; Patyar et al. (2010) Journal of Biomedical Science 17:21; and Pawlek et al. (2003) Lancet Oncol. 4:548-556).
[0189] As a therapeutic platform, bacteria have several advantages over other therapies, such as oncolytic viruses. Some bacterial species can be engineered for oral and systemic (intravenous: IV) administration; they grow easily in vitro and in vivo; and they can be stored and transported in a lyophilized state. Bacterial chromosomes lack exons and can be easily manipulated, and the complete genomes of numerous strains have been fully characterized (Felgner et al. (2016) mBio 7(5):e01220-16). Many types of bacteria are cheaper and easier to produce than viruses, and because engineered bacteria do not permanently integrate into the host cell genome, their delivery can be more convenient than viral delivery. They preferentially infect myeloid cells over epithelial cells, and they can be rapidly eliminated with antibiotics if necessary, making them safe.
[0190] Provided herein are immunostimulatory bacteria engineered to take advantage of these advantageous properties. The bacteria provided herein are engineered to infect and proliferate in the tumor microenvironment, particularly tumor-resident immune cells (myeloid cells), such as tumor-associated macrophages (TAMs), dendritic cells (DCs), and myeloid-derived suppressor cells (MDSCs), and are also designed to express and deliver high levels of therapeutic proteins and combinations thereof, particularly complementary combinations. The immunostimulatory bacteria provided herein have advantageous properties that are superior to existing bacterial therapies, as well as cell therapies, oncolytic virus therapies, and previous bacterial therapies. The immunostimulatory bacteria provided herein can be administered by any suitable route, but are suitable for systemic administration, such as intravenous administration. As shown and described herein, the immunostimulatory bacteria provided herein can target major immune pathways.
[0191] The bacteria provided herein are designed and engineered to maintain the beneficial scaffolding properties of bacteria and have virus-like immune signatures.This is advantageous for use as anti-cancer therapeutic agents.Some of the immune and scaffolding properties of bacteria and viruses are summarized in the following table.The immune-stimulating bacteria provided herein retain the feasibility of bacterial scaffolding, but produce virus-like immune responses in the treated subject (discussed in more detail in Section C below).
[0192] [Table 4]
[0193] In Salmonella species and other bacterial species, flagella contribute to TRL5-mediated inflammation, LPS leads to TLR4-mediated inflammatory responses, and adhesive curli pili lead to TLR2-mediated inflammatory responses. The genomes of the immunostimulatory bacteria provided herein have been modified so that the bacteria lack flagella and adhesive curli pili and possess modified LPS, resulting in reduced or absent TLR4-mediated inflammatory responses. As a result, the immunostimulatory bacteria provided herein induce virus-like antitumor immune responses. Elimination or modification of these components confers other advantageous properties, such as those discussed in detail below. The immunostimulatory bacteria deliver therapeutic products, such as anticancer therapeutics, particularly complementary combinations of products. The immunostimulatory bacteria provided herein deliver encoded genetic payloads to tumor-resident myeloid cells in a tumor-specific manner.
[0194] Immunostimulatory bacteria are provided that deliver a genetic payload encoding one or more anti-cancer therapeutic products, including truncated costimulatory molecules (receptors or ligands, e.g., 4-1BBL, CD80, CD86, CD27L, B7RP1, OX40L) with a complete or partial cytoplasmic domain deletion for expression on antigen-presenting cells (APCs), where the truncated gene product is capable of constitutively delivering immunostimulatory signaling to T cells via costimulatory receptor engagement and, due to the truncated or deleted cytoplasmic domain, is incapable of delivering counter-regulatory signaling to APCs.
[0195] The immunostimulatory bacteria can encode and express one or more of the following: IL-2, IL-7, IL-12p70 (IL-12p40 + IL-12p35), IL-12, IL-15, IL-15 / IL-15Rα chain complex, IL-18, IL-21, IL-23, IL-36γ, interferon-α, interferon-β, IL-2 with reduced binding to IL-2Ra, IL-2 modified to not bind IL-2Ra, CXCL9, CXCL10, CXCL11, CCL3, CCL4, CCL5, a cytoplasmic DNA / RNA sensor, or a type I IFN pathway protein, e.g., a gain-of-function protein. inhibitors of TGF beta, such as TGF-beta inhibitory antibodies, TGF beta polypeptide antagonists, and TGF beta binding decoy receptors; antibodies and fragments thereof, such as those that target immune checkpoints; and other anti-cancer targets, such as VEGF and IL-6; costimulatory receptors / molecules, such as 4-1BBL, including 4-1BBL with deleted, truncated, or otherwise absent cytoplasmic domains, and others. Immunostimulatory bacteria may also encode and express truncated costimulatory molecules (e.g., 4-1BBL, CD80, CD86, CD27L, B7RP1, OX40L) with partial or complete cytoplasmic domain deletions for expression on antigen-presenting cells (APCs), such that the truncated gene products are capable of constitutively transmitting immunostimulatory signaling to T cells via costimulatory receptor engagement but are unable to transmit counter-regulatory signaling to APCs due to the deletion or truncation of the cytoplasmic domain. Combinations of such therapeutic products and drugs can be expressed in a single therapeutic composition. Thanks to modifications to the bacterial genome, immunostimulatory bacteria exhibit tumor-specific localization and enrichment, providing intravenous (IV) administration for activation of antitumor immune pathways that would otherwise be toxic if activated systemically.
[0196] The immunostimulatory bacteria provided herein are safe and genetically engineered to target tumors, tumor microenvironment, and / or tumor-resident immune cells. The immunostimulatory bacteria provided herein comprise a combination of genomic and other modifications and encoded therapeutic products that work in concert to provide immunostimulatory bacteria that multiply within tumor-resident immune cells and persist long enough to deliver therapeutic products, particularly combinations, that induce or promote anti-cancer immune stimulation in tumors and tumor microenvironments with no or limited toxic side effects. When delivered systemically, e.g., intravenously (IV), immunostimulatory bacteria become concentrated within tumors, including metastatic lesions, and they provide efficient gene transfer of their immune payload to tumor-resident myeloid cells, particularly tumor-associated macrophages (TAMs), myeloid-derived suppressor cells (MDSCs), and dendritic cells (DCs), which induce potent local immune responses to destroy tumors and vaccinate against future recurrences. When treatment ceases, they either disappear spontaneously, e.g., by phagocytosis and destruction by infected cells, or they can be rapidly destroyed by a course of antibiotics.
[0197] The immunostimulatory bacteria provided herein exhibit selective accumulation in the tumor microenvironment and / or tumor-resident immune cells due to engineered purine / adenosine auxotrophy, and are unable to replicate within phagocytes. The immunostimulatory bacteria provided herein avoid inactivation by serum complement, enabling the delivery of high concentrations of various immunotherapeutic agents and therapeutic products directly into the tumor microenvironment while minimizing toxicity to normal tissues.
[0198] For example, as described in more detail in Section C.8., the immunostimulatory bacteria provided herein contain the following genomic modifications, as discussed in detail herein: altering lipid A in LPS to result in pentaacylation (wild-type lipid A has 6-7 fatty acid chains), and reducing TLR4 affinity by msbB. - / pagP - Modification to make purI -Adenosine / adenine auxotrophic modifications such as asparaginase II improve T cell quality - (ansB - ) modification; csgD, which removes curli fimbriae, among other properties - The immunostimulatory bacteria include other optional genomic modifications, such as insertions, deletions, disruptions, and any other modifications that prevent the encoded product from being produced in an active form. The immunostimulatory bacteria contain a plasmid encoding one or more therapeutic products, particularly anti-cancer products, under the control of a eukaryotic promoter.
[0199] The immunostimulatory bacteria provided herein deliver therapeutic products (e.g., constitutively active STING mutants and other immunomodulatory proteins and products) to tumor-resident myeloid cells, promoting adaptive immunity and enhancing T cell function. The immunostimulatory bacteria result in a complete remodeling of the immunosuppressive tumor microenvironment away from a bacterial phenotype characterized by the promotion of innate immunity and the suppression of adaptive immunity toward an adaptive anti-tumor phenotype.
[0200] The immunostimulatory bacteria provided herein contain genome modifications that allow them to target or proliferate in tumor-resident immune cells, particularly tumor-resident myeloid cells, such as macrophages, MDSCs (myeloid-derived suppressor cells), and DCs (dendritic cells), where they deliver a payload of encoded therapeutic products that are expressed under the control of regulatory sequences recognized by the host cell (eukaryotic) transcription / translation machinery. The encoded products are expressed in the myeloid cells and appropriately delivered to the tumor microenvironment. The bacteria can also deliver antitumor products that generate antitumor immunity and directly treat tumors, as well as products that can activate prodrugs.
[0201] The immunostimulatory bacteria provided herein can exhibit at least about 100,000 times greater tumor infiltration and enrichment than unmodified bacteria. The immunostimulatory bacteria deliver plasmids encoding therapeutic products that are consumed by tumor-resident immune cells and expressed and produced within the immune cells and the tumor microenvironment, resulting in anti-tumor immunity.
[0202] 1. Bacterial cancer immunotherapy Many solid tumor types have evolved highly immunosuppressive microenvironments that render them highly refractory to approved checkpoint therapies, such as anti-CTLA-4, anti-PD-1, and anti-PD-L1 therapy. One mechanism by which tumors have evolved resistance to checkpoint therapy is through their lack of intratumoral T cells and tumor antigen cross-presenting dendritic cells (DCs), described as T cell-excluded, non-inflammatory, or "cold tumors" (Sharma et al. (2017) Cell 168(4):707-723). For the few patients whose tumors are T cell-driven and respond to checkpoint immunotherapy, patients often experience severe autoimmune toxicity, and many ultimately relapse and become checkpoint refractory (see, e.g., Buchbinder et al. (2015) J. Clin. Invest. 125:3377-3383; Hodi et al. (2010) N. Engl. J. Med. 363(8):711-723; and Chen et al. (2015) J. Clin. Invest. 125:3384-3391). Tumors initiate multiple mechanisms to evade immune surveillance, reprogram antitumor immune cells to suppress immunity, eliminate and inactivate antitumor T cells, and develop emerging resistance to targeted cancer therapies (see, e.g., Mahoney et al. (2015) Nat. Rev. Drug Discov. 14(8):561-584). To solve this problem, immunotherapies are needed that can appropriately inflame these tumors and generate anti-tumor immunity that can result in long-term tumor regression. In addition, intratumoral therapy is difficult and will be quite limiting in the metastatic disease setting. Systemically administered therapies are needed that appropriately inflame each individual metastatic lesion and overcome multiple pathways of immunosuppression. Thanks to their ability to specifically target tumor-resident immune cells and express multiple complementary genetic payloads / therapeutic products, the immunostimulatory bacteria provided herein are designed to address these issues.
[0203] 2. Upfront treatment targeting the tumor microenvironment Several therapies have been developed that target the tumor microenvironment (TME) and attempt to promote anti-tumor immunity, each with its own challenges and drawbacks, which are addressed by the immunostimulatory bacteria provided herein.
[0204] a. Limitations of autologous T cell therapy Several systemically administered therapeutic platforms are being clinically investigated with the goal of accessing the highly immunosuppressive tumor microenvironment and inducing an appropriate immune response that inflames the tumor and promotes antitumor immunity. These platforms include chimeric antigen receptor T cells (CAR-T cells), which are produced by harvesting T cells from the patient and reengineering them to fuse the T cell receptor to an antibody Ig variable extracellular domain specific for a particular tumor antigen. This confers the antigen recognition properties of an antibody along with the cytolytic properties of activated T cells (see, e.g., Sadelain et al. (2015) J. Clin. Invest. 125(9):3392-3400). Despite the promise and potential of this technology, including FDA approval of the CD19 CAR-T tisagenlecleucel (such as those under the trademark Kymriah®) and axicabtagene ciloleucel (such as those under the trademark Yescarta®), success has been limited to CD19 CAR-T. +CAR-T therapy has been limited to hematopoietic malignancies and has been associated with fatal immune-mediated adverse events (see, e.g., Jackson et al. (2016) Nat. Rev. Clin. Oncol. 13(6):370-383). Tumors can rapidly mutate to downregulate target tumor antigens, including CD19 antigen, in solid tumors, thereby developing immune escape mechanisms (see, e.g., Mardiana et al. (2019) Sci. Transl. Med. 11(495):eaaw2293). There is a plethora of tumor-specific target antigens. Solid tumor targets that are not expressed in healthy tissues are a major obstacle for CAR-T therapy. Additionally, CAR-T therapy is hindered from accessing the solid tumor microenvironment by another obstacle: the lack of a sufficient T cell chemokine gradient necessary for adequate T cell infiltration into the tumor. Additionally, once they infiltrate the tumor, they are rapidly inactivated (see, e.g., Brown et al. (2019) Nat. Rev. Immunol. 19(2):73-74). Even though the safety of CAR-T cells has improved significantly and efficacy has extended to solid tumors, the feasibility and expense associated with these labor-intensive therapies still limit their wider adoption.
[0205] b. Viral vaccine platform Oncolytic viruses (OVs) have natural and engineered properties that induce tumor cell lysis, recruit T cells to tumors, and deliver genetic material that tumor cells can read to produce immunomodulatory proteins. For example, an oncolytic virus called talimogene laherparepvec (T-VEC) is a modified herpes simplex virus that encodes an anti-melanoma antigen and the cytokine GM-CSF (granulocyte-macrophage colony-stimulating factor) and is administered intratumorally. T-VEC has been FDA-approved for metastatic melanoma (see, e.g., Bastin et al. (2016) Biomedicines 4(3):21). T-VEC has shown clinical benefit for some melanoma patients and is less immunotoxic than immune checkpoint antibodies or FDA-approved systemic cytokines such as IL-2 and interferon-alpha (see, e.g., Kim et al. (2006) Cytokine Growth Factor Rev. 17(5):349-366; and Paul et al. (2015) Gene 567(2):132-137).
[0206] Oncolytic viruses (OVs) have several limitations as anticancer therapies. First, they are rapidly inactivated by the human complement system in the blood. Delivering sufficient virus via systemic administration to have the desired therapeutic effect has proven challenging. Intratumoral delivery is limited in metastatic settings (where the lesion has spread throughout the body), is refractory for most solid tumor types (e.g., lung and visceral lesions), and requires injectable, interventionally guided imaging, which limits repeated administration. Viruses can be difficult to manufacture and store on a commercial scale. Most OV-based vaccines, including those based on paramyxoviruses, reoviruses, and picornaviruses, have similar limitations (see, e.g., Chiocca et al. (2014) Cancer Immunol. Res. 2(4):295-300). Oncolytic viruses are inherently immunogenic, are rapidly cleared from human blood, and T cells that enter tumors have a much higher affinity for viral antigens than for weaker tumor neoantigens (see, e.g., Aleksic et al. (2012) Eur. J. Immunol. 42(12):3174-3179). Thus, in addition to recognized technical limitations of the platform, OVs to date have limited ability to stimulate durable antitumor immunity.
[0207] c. Bacterial cancer treatment In preclinical animal studies, several bacterial species have shown preferential replication in solid tumors when injected from a distal site. These include, but are not limited to, species of Salmonella, Bifidobacterium, Clostridium, and Escherichia. The tumor-homing properties of bacteria, in conjunction with the host's innate immune response to bacterial infection, can mediate antitumor responses. This tumor tissue tropism reduces tumor size to varying degrees. One factor contributing to the tumor tropism of these bacterial species is their ability to replicate in anoxic and hypoxic environments. Some of these naturally tumor-tropic bacteria have been further engineered to enhance their antitumor potential (reviewed in Zu et al. (2014) Crit. Rev. Microbiol. 40(3):225-235; and Felgner et al. (2017) Microbial Biotechnology 10(5):1074-1078). Despite proof of concept in animal studies, complement factors in human serum that are not present in animal models can inactivate bacteria, limiting their use as a therapy to treat cancer.
[0208] For oral or systemic administration, bacterial strains are attenuated so that they do not cause systemic disease and / or septic shock, but still maintain some level of infectivity and resistance to inactivation by complement for effective tumor colonization. Examples of bacteria include Clostridium (see, e.g., Dang et al. (2001) Proc. Natl. Acad. Sci. USA 98(26):15155-15160; U.S. Patent Application Publication Nos. 2017 / 0020931 and 2015 / 0147315; and U.S. Patent Nos. 7,344,710 and 3,936,354), Mycobacterium (see, e.g., U.S. Patent Application Publication Nos. 2015 / 0224151 and 2015 / 0071873), Bifidobacterium (see, e.g., Dang et al. (2001); and Kimura et al. (1980) Cancer Res. 40:2061-2068), Lactobacillus (see, e.g., Dang et al. (2001)), Listeria monocytogenes (see, e.g., Le et al. (2012) Clin. Cancer Res. 18(3):858-868; Starks et al. (2004) J. Immunol. 173:420-427; and U.S. Patent Application Publication No. 2006 / 0051380), and Escherichia coli (see, e.g., U.S. Patent No. 9,320,787), have been investigated as potential agents for anti-cancer therapy.
[0209] The immunostimulatory bacteria provided herein contain genome modifications that address problems with previous bacteria developed to treat tumors. The modifications are designed to target or improve proliferation within the tumor microenvironment, particularly to allow the bacteria to infect tumor-resident immune cells and not healthy tissues, thereby reducing toxicity and improving delivery of the encoded product. The immunostimulatory bacteria are also designed to deliver therapeutic products, including combinations thereof, to neutralize the immunosuppressive effects of tumors, enhance the host's anti-tumor response, and provide anti-tumor products.
[0210] i. Listeria spp. Listeria monocytogenes expresses potent CD8 receptors against tumor antigens in mouse models of cancer. + It is a live, attenuated intracellular bacterium capable of inducing T cell priming and is also being explored as a bacterial cancer vector (see, e.g., Le et al. (2012) Clin. Cancer Res. 18(3):858-868). In a clinical trial of a Listeria-based vaccine incorporating the tumor antigen mesothelin in a prime-boost approach with the allogeneic pancreatic cancer-based GVAX vaccine, patients with advanced pancreatic cancer experienced a median survival of 6.1 months, compared with a median survival of 3.9 months in patients treated with the GVAX vaccine alone (see, e.g., Le et al. (2015) J. Clin. Oncol. 33(12):1325-1333). However, these results were not replicated in a larger phase 2b study, pointing to the difficulty of subverting peripheral immune surveillance to low-affinity tumor neoantigens in humans. L. monocytogenes also demonstrated a limited immune response to its encoded tumor antigens due to the requirement for bacterial lysis after phagocytosis. Post-phagocytic lysis is a prerequisite for efficient plasmid transfer, but has not been demonstrated to occur in human macrophages with L. monocytogenes.
[0211] ii. Salmonella spp. Salmonella enterica serovar Typhimurium (S. typhimurium) is an example of a bacterial species for use as an anticancer therapeutic. S. typhimurium is a Gram-negative facultative anaerobe that grows preferentially in hypoxic and necrotic areas due to tissue necrosis, the availability of nutrients from leaky tumor vasculature, and the increased likelihood of its survival within the immunosuppressive tumor microenvironment (see, e.g., Baban et al. (2010) Bioengineered Bugs 1(6):385-394). As a facultative anaerobe, S. typhimurium can grow under aerobic and anaerobic conditions and thus can colonize both small, relatively non-hypoxic tumors and large, relatively hypoxic tumors.
[0212] S. typhimurium infection via the fecal-oral route causes a localized gastrointestinal infection. The bacterium can also enter the bloodstream and lymphatic system, resulting in infection of systemic tissues such as the liver, spleen, and lungs. Systemic administration of wild-type S. typhimurium excessively stimulates TNF-α and IL-6, leading to a cytokine cascade and infectious shock, which can be fatal if left untreated. As a result, pathogenic bacterial strains such as S. typhimurium must be attenuated to prevent systemic infection without completely suppressing their ability to effectively colonize tumor tissue. Attenuation is often achieved by mutating cellular structures, such as the bacterial outer membrane, that can elicit an immune response via pathogen pattern recognition, or by limiting the bacterium's ability to replicate in the absence of nutritional supplementation.
[0213] S. typhimurium is an intracellular pathogen that is rapidly taken up by myeloid phagocytes such as macrophages or can directly invade nonphagocytic cells such as epithelial cells via its Salmonella pathogenicity island 1 (SPI-1)-encoded type III secretion system (T3SS1). Once intracellular, it can replicate within Salmonella-containing vacuoles (SCVs) via SPI-2 regulation and can also escape into the cytosol of some epithelial cells (see, e.g., Agbor et al. (2011) Cell Microbiol. 13(12):1858-1869; and Galan and Wolf-Watz (2006) Nature 444:567-573). Genetically modified bacterial strains of S. typhimurium have been described as antitumor agents that induce direct tumoricidal effects and / or deliver tumoricidal molecules (see, e.g., Clairmont et al. (2000) J. Infect. Dis. 181:1996-2002; Bermudez, D. et al. (2002) Curr. Opin. Drug Discov. Devel. 5:194-199; Zhao, M. et al. (2005) Proc. Natl. Acad. Sci. USA 102:755-760; and Zhao, M. et al. (2006) Cancer Res. 66:7647-7652).
[0214] Various methods for attenuating bacterial pathogens are known in the art. For example, auxotrophic mutations cause bacteria to be unable to synthesize essential nutrients, and deletion / mutation of genes such as aro, pur, gua, thy, nad, and asd (see, for example, U.S. Patent Application Publication No. 2012 / 0009153) is used. The nutrients produced by the biosynthetic pathways containing these genes are often unavailable within host cells, making it difficult for bacteria to survive. For example, attenuation of Salmonella species and other species can be achieved by deleting or disrupting the aroA gene, which is part of the shikimate pathway that connects glycolysis with aromatic amino acid biosynthesis (see, for example, Felgner et al. (2016) mBio 7(5):e01220-16). Deletion or disruption of aroA results in bacterial auxotrophy for aromatic amino acids and subsequent attenuation (see, e.g., U.S. Patent Application Publication Nos. 2003 / 0170276, 2003 / 0175297, 2012 / 0009153, and 2016 / 0369282; and International Application Publication Nos. WO2015 / 032165 and WO2016 / 025582). Similarly, other enzymes involved in the aromatic amino acid biosynthetic pathway, including aroC and aroD, have been deleted to achieve attenuation (see, e.g., U.S. Patent Application Publication No. 2016 / 0369282; and International Application Publication No. WO2016 / 025582). For example, the SL7207 strain of S. typhimurium is an aromatic amino acid auxotroph (aroA - mutant), and the A1 and A1-R strains are leucine-arginine auxotrophs.
[0215] Mutations that attenuate bacteria include, but are not limited to, mutations in genes that alter lipopolysaccharide (LPS) biosynthesis, such as rfaL, rfaG, rfaH, rfaD, rfaP, rFb, rfa, msbB, htrB, firA, pagL, pagP, lpxR, arnT, eptA, and lpxT; mutations that introduce suicide genes, such as sacB, nuk, hok, gef, kil, or phlA; mutations that introduce bacterial lysis genes, such as hly and cly; and mutations that alter virulence factors, such as IsyA, pag, prg, iscA, virG, plc, and act. Mutations in genes that alter stress responses, such as recA, htrA, htpR, hsp, and groEL; mutations in genes that disrupt the cell cycle, such as min; and mutations in genes that disrupt or inactivate regulatory functions, such as cya, crp, phoP / phoQ, and ompR (see, e.g., U.S. Patent Application Publication Nos. 2012 / 0009153, 2003 / 0170276, and 2007 / 0298012; U.S. Patent No. 6,190,657; International Application Publication No. WO2015 / 032165; Felgner (See, e.g., Frahm et al. (2015) mBio 6(2):e00254-15; Kong et al. (2011) Infection and Immunity 79(12):5027-5038; and Kong et al. (2012) Proc. Natl. Acad. Sci. USA 109(47):19414-19419). Generally, attenuating mutations are gene deletions that prevent spontaneous compensatory mutations that might result in reversion to the virulent phenotype.
[0216] Another method for attenuating S. typhimurium for safety is to use the PhoP / PhoQ operon system, a typical bacterial two-component regulatory system composed of a membrane-bound sensor kinase (PhoQ) and a cytoplasmic transcriptional regulator (PhoP) (see, e.g., Miller, SI et al. (1989) Proc. Natl. Acad. Sci. USA 86:5054-5058; and Groisman, EA et al. (1989) Proc. Natl. Acad. Sci. USA 86:7077-7081). PhoP / PhoQ are required for virulence, and their deletion compromises survival of the bacterium in macrophages and results in significant attenuation in mice and humans (see, e.g., Miller, SI et al. (1989) Proc. Natl. Acad. Sci. USA 86:5054-5058; Groisman, EA et al. (1989) Proc. Natl. Acad. Sci. USA 86:7077-7081; Galan, JE and Curtiss, R. III. (1989) Microb. Pathog. 6:433-443; and Fields, PI et al. (1986) Proc. Natl. Acad. Sci. USA 83:5189-5193). PhoP / PhoQ deletion strains have been used as vaccine delivery vehicles (see, e.g., Galan, JE and Curtiss, R. III. (1989) Microb. Pathog. 6:433-443; Fields, PI et al. (1986) Proc. Natl. Acad. Sci. USA 83:5189-5193; and Angelakopoulos, H. and Hohmann, EL (2000) Infect. Immun. 68:2135-2141). However, as described herein, for some strains, limited survival within macrophages is a disadvantage unless the bacterium is attempting to transfer a plasmid.
[0217] These attenuated bacterial strains have been found to be safe in mice, pigs, and monkeys when administered intravenously (IV) (see, e.g., Zhao, M. et al. (2005) Proc. Natl. Acad. Sci. USA 102:755-760; Zhao, M. et al. (2006) Cancer Res. 66:7647-7652; Tjuvajev J. et al. (2001) J. Control. Release 74:313-315; and Zheng, L. et al. (2000) Oncol. Res. 12:127-135), and several live attenuated Salmonella strains have been shown to be well tolerated following oral administration in human clinical trials (see, e.g., Chatfield, SN et al. (1992) Biotechnology 10:888-892; DiPetrillo, MD et al. (1999) Vaccine 18:449-459; Hohmann, EL et al. (1996) J. Infect. Dis. 173:1408-1414; and Sirard, JC et al. (1999) Immunol. Rev. 171:5-26).
[0218] Other strains of S. typhimurium that have been attenuated for therapeutic use include, for example, the leucine-arginine auxotroph A-1 (see, e.g., Zhao et al. (2005) Proc. Natl. Acad. Sci. USA 102(3):755-760; Yu et al. (2012) Scientific Reports 2:436; U.S. Pat. No. 8,822,194; and U.S. Patent Application Publication No. 2014 / 0178341) and its derivative AR-1 (see, e.g., Yu et al. (2012) Scientific Reports 2:436; Kawaguchi et al. (2017) Oncotarget 8(12):19065-19073; Zhao et al. (2006) Cancer Res. 66(15):7647-7652; Zhao et al. (2012) Cell Cycle 11(1):187-193; see Tomé et al. (2013) Anticancer Research 33:97-102; Murakami et al. (2017) Oncotarget 8(5):8035-8042; Liu et al. (2016) Oncotarget 7(16):22873-22882; and Binder et al. (2013) Cancer Immunol. Res. 1(2):123-133); aroA - the mutant S. typhimurium strain SL7207 (see, e.g., Guo et al. (2011) Gene Therapy 18:95-105; and U.S. Patent Application Publication Nos. 2012 / 0009153, 2016 / 0369282, and 2016 / 0184456), and its obligately anaerobic derivative strain YB1 (see, e.g., International Application Publication No. WO2015 / 032165; Yu et al. (2012) Scientific Reports 2:436; and Leschner et al. (2009) PLoS ONE 4(8):e6692); aroA - / aroD -Mutant S. typhimurium strain BRD509, a derivative of the wild-type strain SL1344 (see, for example, Yoon et al. (2017) Eur. J. Cancer 70:48-61); asd - / cya - / crp - The mutant S. typhimurium χ4550 strain (see, e.g., Sorenson et al. (2010) Biologics: Targets & Therapy 4:61-73) and phoP - / phoQ - The strain is S. typhimurium LH430 (see, for example, International Application Publication No. WO2008 / 091375).
[0219] However, attenuation affects the ability of the bacteria to grow within tumor-resident immune cells, the tumor microenvironment, and tumor cells. This problem is solved herein. Immunostimulatory bacteria, such as the Salmonella strains exemplified herein, are attenuated by modifications that can include some of the above, but can also have other modifications and properties described herein that enhance their usefulness as cancer therapeutics.
[0220] Attenuated strains of S. typhimurium have the innate ability to deliver DNA after phagocytosis and degradation (see, e.g., Weiss et al. (2003) Int. J. Med. Microbiol. 41(7):3413-3414), and they have been used as vectors for gene therapy. For example, S. typhimurium strains have been used to deliver and express a variety of genes, including those encoding cytokines, angiogenesis inhibitors, toxins, and prodrug-converting enzymes (see, e.g., U.S. Patent Application Publication No. 2007 / 0298012; Loeffler et al. (2008) Cancer Gene Ther. 15(12):787-794; Loeffler et al. (2007) Proc. Natl. Acad. Sci. USA 104(31):12879-12883; Loeffler et al. (2008) J. Natl. Cancer Inst. 100:1113-1116; Clairmont, C. et al. (2000) J. Infect. Dis. 181:1996-2002; Bermudez, D. et al. (2002) Curr. Opin. Drug Disov. Devel. 5:194-199; Zhao, M. et al. (2005) Proc. Natl. Acad. Sci. USA 102:755-760; Zhao, M. et al. (2006) Cancer Res. 66:7647-7652; and Tjuvajev J. et al. (2001) J. Control. Release 74:313-315).
[0221] S. typhimurium has been engineered to deliver the tumor-associated antigen (TAA) survivin (SVN) to antigen-presenting cells (APCs) to prime adaptive immunity (see, e.g., U.S. Patent Application Publication No. 2014 / 0186401; and Xu et al. (2014) Cancer Res. 74(21):6260-6270). SVN is an inhibitor of apoptosis protein (IAP) that prolongs cell survival and provides cell cycle control, and is overexpressed in all solid tumors and poorly expressed in normal tissues. This technique uses SPI-2 and its type III secretion apparatus to deliver the TAA into the cytosol of APCs, which are then activated to express TAA-specific CD8 + Induce T cells and antitumor immunity (see, e.g., Xu et al. (2014) Cancer Res. 74(21):6260-6270). Similar to Listeria-based TAA vaccines, this approach has shown promise in mouse models but has not demonstrated effective tumor antigen-specific T cell priming in humans.
[0222] In addition to delivering protein-encoding DNA, S. typhimurium has been used to deliver small interfering RNA (siRNA) and short hairpin RNA (shRNA) for cancer therapy. For example, S. typhimurium has been engineered to express specific shRNAs, such as those targeting the immunosuppressive gene indoleamine dioxygenase (IDO). Silencing IDO expression in a mouse melanoma model resulted in tumor cell death and significant tumor infiltration by neutrophils (see, for example, Blache et al. (2012) Cancer Res. 72(24):6447-6456; International Application Publication No. WO2008 / 091375; and U.S. Patent No. 9,453,227). Co-administration of this vector with hyaluronidase showed positive results in the treatment of murine pancreatic ductal adenocarcinoma (see, e.g., Manuel et al. (2015) Cancer Immunol. Res. 3(9):1096-1107; and U.S. Patent Application Publication No. 2016 / 0184456). In another study, an S. typhimurium strain attenuated by phoP / phoQ deletion and expressing a signal transducer and activator of transcription 3 (STAT3)-specific shRNA inhibited tumor growth, reduced the number of metastatic organs, and extended the lifespan of C57BL / 6 mice (see, e.g., Zhang et al. (2007) Cancer Res. 67(12):5859-5864). In another example, the S. typhimurium strain SL7207 has been used to deliver shRNA targeting CTNNB1, the gene encoding β-catenin (see, e.g., Guo et al. (2011) Gene Therapy 18:95-105; and U.S. Patent Application Publication Nos. 2009 / 0123426 and 2016 / 0369282).The S. typhimurium VNP20009 strain has been used to deliver shRNA targeting STAT3 (see, e.g., Manuel et al. (2011) Cancer Res. 71(12):4183-4191; U.S. Patent Application Publication Nos. 2009 / 0208534, 2014 / 0186401, and 2016 / 0184456; and International Application Publication Nos. WO2008 / 091375 and WO2012 / 149364). Using the S. typhimurium A1-R and VNP20009 strains, siRNAs targeting the autophagy genes Atg5 and Beclin1 have been delivered to tumor cells (see, e.g., Liu et al. (2016) Oncotarget 7(16):22873-22882).
[0223] However, these strains have been found to neither effectively stimulate anti-tumor immune responses nor effectively colonize tumors to deliver therapeutic doses of the encoded product. There is a need to improve such strains, such as the immunostimulatory bacteria provided herein, to more effectively stimulate anti-tumor immune responses. Further and alternative modifications of various bacteria are described in published International PCT Application No. WO2019 / 014398 and U.S. Publication No. 2019 / 0017050A1. The bacteria described in each of these publications and described herein can be modified to further improve their immunostimulatory and tumor-targeting properties, as described herein.
[0224] iii.VNP20009 An example of a therapeutic bacterium that can be used as a starting strain for the modifications described herein is a strain designated VNP20009 (ATCC#202165, YS1646). This virus was a clinical candidate. For safety reasons, VNP20009 (ATCC#202165, YS1646) was attenuated at least 50,000-fold by deletion of the msbB and purI genes (see, for example, Clairmont et al. (2000) J. Infect. Dis. 181:1996-2002; Low et al. (2003) Methods in Molecular Medicine, Vol. 90, Suicide Gene Therapy: Methods and Reviews, pp. 47-59; and Lee et al. (2000) International Journal of Toxicology 19:19-25). Deletions or disruptions that prevent expression of the msbB gene alter the composition of the lipid A domain of lipopolysaccharide, a major component of the Gram-negative bacterial outer membrane (see, e.g., Low et al. (1999) Nat. Biotechnol. 17(1):37-41). This attenuates bacterial strains and reduces systemic virulence while preventing lipopolysaccharide-induced septic shock and reducing potentially harmful production of TNFα (see, e.g., Dinarello, CA (1997) Chest 112(6 Suppl):321S-329S; and Low et al. (1999) Nat. Biotechnol. 17(1):37-41). Deletions or disruptions that prevent expression of the purI gene render the bacteria auxotrophic for purines, which further attenuates the bacteria and concentrates them within the tumor microenvironment (see, e.g., Pawelek et al. (1997) Cancer Res. 57:4537-4544; and Broadway et al. (2014) J. Biotechnology 192:177-178). As shown herein, VNP20009 is also auxotrophic for the immunosuppressive nucleoside adenosine.Adenosine accumulates at pathologically high levels within tumors and may contribute to an immunosuppressive tumor microenvironment (see, e.g., Peter Vaupel and Arnulf Mayer, Oxygen Transport to Tissue XXXVII, Advances in Experimental Medicine and Biology 876 chapter 22, pp. 177-183).
[0225] Administration of VNP20009 to mice bearing syngeneic or human xenograft tumors resulted in bacteria preferentially expanding within the extracellular components of the tumor at ratios of greater than 300-1000:1, inhibiting tumor growth and prolonging survival compared to control mice (see, e.g., Clairmont et al. (2000) J. Infect. Dis. 181:1996-2002). VNP20009 has demonstrated successful tumor targeting and tumor growth inhibition in animal models while inducing minimal toxicity (see, e.g., Broadway et al. (2014) J. Biotechnology 192:177-178; Loeffler et al. (2007) Proc. Natl. Acad. Sci. USA 104(31):12879-12883; Luo et al. (2002) Oncology Research 12:501-508; and Clairmont et al. (2000) J. Infect. Dis. 181:1996-2002).
[0226] Results from a phase 1 clinical trial in human metastatic melanoma revealed that VNP20009 was relatively safe and well tolerated, although very limited antitumor activity was observed (see, e.g., Toso et al. (2002) J. Clin. Oncol. 20(1):142-152). While VNP20009 use did not significantly alter metastatic disease burden, it did show evidence of tumor colony formation at the maximum tolerated dose (MTD). Higher doses, which would be necessary to elicit any antitumor activity, were not possible due to toxicity correlated with high levels of proinflammatory cytokines.
[0227] The immunostimulatory bacteria provided herein offer numerous improvements and advantages over the VNP20009 strain. The immunostimulatory bacteria deliver encoded genetic payloads to tumor-resident myeloid cells in a tumor-specific manner. Thanks to genome modifications, such as gene deletion or disruption and other genome modifications, for example, abolishing flagella, modifying LPS, and abolishing curli pili, the immunostimulatory bacteria exhibit reduced TLR2-, TLR4-, and TLR5-mediated inflammation and reduced biofilm formation. Thanks to, for example, abolishing L-asparaginase II expression, the immunostimulatory bacteria enhance T cell function and facilitate, provide, enable, and support plasmid maintenance. The bacteria grow exclusively or substantially exclusively in (or target) myeloid cells, particularly tumor-resident myeloid cells, and provide highly efficient plasmid delivery following phagocytosis. The immunostimulatory bacteria provided herein can colonize the tumor microenvironment and be administered systemically. The immunostimulatory bacteria provided herein have at least a 15-fold improved LD compared to VNP20009. 50 Thus, the immunostimulatory bacteria provided herein can be administered, if desired, at much higher doses without toxic effects compared to VNP20009 (see the table below in Section F.5., which describes dosage and administration).
[0228] Immunostimulatory bacteria modified as described herein, including those that lack flagella, LPS-modify, and other modifications, have been shown to preferentially grow in or target myeloid cells, particularly tumor-resident myeloid cells, and are described herein. Examples demonstrate that the immunostimulatory bacteria grow in such cells following systemic administration, such as intravenous administration. Examples also describe and demonstrate plasmid transfer and durable protein expression from the immunostimulatory bacteria into tumor-resident myeloid cells following bacterial cell death, thereby delivering therapeutic products, including products that confer anti-cancer responses and phenotypes.
[0229] iv. Wild-type strain The accumulation of VNP20009 in tumors results from a combination of factors, including the inherent invasiveness of the parent strain ATCC14028, its ability to replicate in a hypoxic environment, and its requirement for high concentrations of purines present in the interstitial fluid of tumors. As described herein, it is not necessary to use an attenuated strain, such as VNP20009, as the starting bacterial strain. Thanks to the modifications described herein, the bacteria are avirulent or attenuated. The parent strain ATCC14028 or another wild-type strain can be used as the starting strain and can be modified as described herein.
[0230] 3. Limitations of existing bacterial cancer immunotherapy Many classes of immunotherapies have significant limitations that limit their safety and efficacy, as well as complex platforms that are unlikely to be widely used. Bacteria have numerous advantageous properties for use as anticancer therapeutics, compared to, for example, oncolytic viruses. These include the ease with which they can be grown, manufactured, stored, and eliminated from the host once treatment is complete. However, viruses also have advantageous properties, including host responses. The response to bacterial infection is a natural inflammatory reaction, which is not advantageous for anticancer therapeutics. The response to viral infection is similar to the anticancer response. This is summarized in the table below (see also the summary above).
[0231] [Table 5]
[0232] Thus, the limitations of bacteria as a microbial anticancer platform stem from the specific immune program initiated by the immune system when sensing bacteria, even intracellular bacteria, compared with virus-sensing pathways that are more similar to anticancer pathways. The virus-recognition program allows for the generation of highly effective vaccines and durable adaptive immunity. However, vaccination against bacteria has had limited success. For example, the FDA-approved Salmonella typhi vaccine is only 55% effective, despite S. typhi containing the highly immunogenic Vi capsule and O:9 antigen (see, e.g., Hart et al. (2016) PLoS ONE 11(1):e0145945). There are no vaccines for less immunogenic bacterial strains, such as L. monocytogenes and S. typhimurium.
[0233] Bacteria and viruses contain conserved structures known as pathogen-associated molecular patterns (PAMPs), which are sensed by host cellular pattern recognition receptors (PRRs). Recognition of PAMPs by PRRs triggers downstream signaling cascades that result in the induction of cytokines and chemokines and the initiation of specific immune responses (see, e.g., Iwasaki and Medzhitov (2010) Science 327(5963):291-295). How the innate immune system is engaged by PAMPs and the type of infectious agent from which they originate determines whether an appropriate innate or adaptive response is generated to combat the invading pathogen.
[0234] One class of PRRs, known as Toll-like receptors (TLRs), recognizes PAMPs derived from bacterial and viral sources and are localized in various compartments within the cell. TLRs recognize a variety of ligands, including lipopolysaccharide (TLR4), lipoproteins (TLR2), flagellin (TLR5), unmethylated CpG motifs in DNA (TLR9), double-stranded RNA (TLR3), and single-stranded RNA (TLR7 and TLR8) (see, e.g., Akira et al. (2001) Nat. Immunol. 2(8):675-680; and Kawai and Akira (2005) Curr. Opin. Immunol. 17(4):338-344). DNA- and RNA-based viruses can be sensed in the host cytosolic compartment after phagocytosis or directly in the cytosol. Type I interferons (IFN-α, IFN-β) are signature cytokines induced by host recognition of single- and double-stranded DNA and RNA derived from viral sources or from the uptake of damaged host cell DNA. For example, the synthetic dsRNA analog polyinosinic polycytidylic acid (poly(I:C)) is an agonist of endosomal TLR3 and a potent inducer of type I IFN, and its more stable version, poly-ICLC (such as that sold under the trademark Hiltonol®), has been clinically developed (see, for example, Caskey et al. (2011) J. Exp. Med. 208(12):2357-2366). Similarly, single-stranded RNA (ssRNA) in endosomes is sensed by TLR7 and TLR8 (only in humans), and its known synthetic ligands, resiquimod and imiquimod, are FDA-approved local cancer immunotherapies.
[0235] In the cytosol, double-stranded RNA (dsRNA) is sensed by RNA helicases such as retinoic acid-inducible gene I (RIG-I) and melanoma differentiation-associated gene 5 (MDA-5), leading to the induction of type I IFN (see, e.g., Ireton and Gale (2011) Viruses 3(6):906-919). The cytosolic sensor of dsDNA is mediated by stimulator of interferon genes (STING). STING is an ER-resident adaptor protein that is a central mediator for sensing cytosolic dsDNA derived from infectious pathogens or aberrant host cell damage (see, e.g., Barber (2011) Immunol. Rev. 243(1):99-108). STING signaling activates the TANK-binding kinase 1 (TBK1) / interferon regulatory factor 3 (IRF3) axis and the NF-κB signaling axis, leading to the induction of IFN-β and other pro-inflammatory cytokines and chemokines that potently activate innate and adaptive immunity (see, e.g., Burdette et al. (2011) Nature 478(7370):515-518). STING-mediated sensing of cytosolic dsDNA requires cyclic GMP-AMP synthase (cGAS). cGAS is a host cell nucleotidyl transferase that directly binds to dsDNA and in response synthesizes the cyclic dinucleotide (CDN) second messenger cyclic GMP-AMP (cGAMP), which binds to and activates STING (see, e.g., Sun et al. (2013) Science 339(6121):786-791; and Wu et al. (2013) Science 339(6121):826-830).
[0236] STING can also bind to bacterially derived CDNs, such as c-di-AMP produced by intracellular L. monocytogenes or c-di-GMP from S. typhimurium. cGAS was later discovered to produce non-canonical CDNs that can activate human STING alleles that are unresponsive to canonical bacterial CDNs. Unlike bacterially produced CDNs, in which two purine nucleosides are linked by a phosphate bridge with a 3'-3' bond, the internucleotide phosphate bridge in cGAMP synthesized by cGAS is linked by a non-canonical 2'-3' bond. These 2'-3' molecules bind to STING with 300-fold higher affinity than bacterial 3'-3'c-di-GMP and are therefore more potent physiological ligands of STING (see, e.g., Civril et al. (2013) Nature 498(7454):332-337; Diner et al. (2013) Cell Rep. 3(5):1355-1361; Gao et al. (2013) Sci. Signal 6(269):pl1; and Ablasser et al. (2013) Nature 503(7477):530-534). The human cGAS / STING signaling pathway appears to have evolved to respond preferentially to viral over bacterial pathogens.
[0237] Thus, virus-sensing PRRs and TLRs, such as STING, RIG-I, TLR3, and TLR7 / 8, induce type I IFNs and cytokines and chemokines that confer effective T cell-mediated adaptive immunity. In the tumor setting, type I IFN signaling is required to induce T cell-delivered chemokines, such as CXCL10, and activate DC cross-presentation of tumor antigens to CD8 + T cells also need to be primed (see, e.g., Diamond et al. (2011) J. Exp. Med. 208(10):1989-2003; and Fuertes et al. (2011) J. Exp. Med. 208(10):2005-2016).
[0238] In contrast, host surveillance of bacteria such as S. typhimurium is primarily mediated by TLR2, TLR4, and TLR5 (see, e.g., Arpaia et al. (2011) Cell 144(5):675-688). These TLRs signal through the MyD88 (myeloid differentiation primary response protein 88) and TRIF (Toll / interleukin-1 receptor (TIR) domain-containing adaptor-inducing interferon-β) adaptor molecules to mediate the induction of the NF-κB-dependent proinflammatory cytokines TNF-α and IL-6 (see, e.g., Pandey et al. (2015) Cold Spring Harb. Perspect. Biol. 7(1):a016246). S. typhimurium has been shown to activate the NLRP3 inflammasome pathway, resulting in the cleavage of caspase-1 and the induction of the proinflammatory cytokines IL-1β and IL-18, which lead to pyroptotic cell death. Engagement of TLR2, TLR4, and TLR5, as well as inflammasome activation, induces chemokines and cytokines that lead to bacterial elimination by neutrophils and macrophages. Evidence that S. typhimurium is eliminated by T cells is limited, and antibodies raised against it are non-neutralizing (see, e.g., McSorley (2014) Immunol. Rev. 260(1):168-182). Furthermore, S. typhimurium possesses mechanisms to directly suppress T cell function, preventing any potential antitumor T cell responses from occurring (see, e.g., Kullas et al. (2012) Cell Host Microbe. 12(6)791-798). Consequently, bacterial cancer treatments, such as S. typhimurium, result in the recruitment and elimination of neutrophils and macrophages, which are not the T cells required to generate antitumor adaptive immunity. These differences are described herein as potentially explaining why prior bacterial anti-cancer vaccines, even those that carry host tumor antigens, have not been effective as T cell priming vectors in humans.
[0239] These problems are some of the problems addressed by the immunostimulatory bacteria provided herein. The immunostimulatory bacteria provided herein possess advantageous properties previously only offered by viral therapeutics, and have been engineered to retain the advantageous properties of bacterial therapeutics. The bacteria provided herein can be administered systemically and localize to tumors, tumor-resident immune cells, and / or the tumor microenvironment, overcoming immunosuppression and appropriately activating anti-tumor immunity while also limiting the autoimmune-related toxicity of existing systemic immunotherapies. The immunostimulatory bacteria provided herein effectively localize to tumor-resident immune cells and encode therapeutic anti-cancer products, and can encode multiple such products. For example, the bacteria provided herein can encode complementary therapeutic products.
[0240] Provided herein is an excellent microbial anti-cancer platform engineered to retain the beneficial properties of bacteria while eliciting a virus-like immune response that induces effective adaptive immunity. As described herein, bacteria, such as strains of Salmonella and other species, can be modified as described herein to reduce inflammatory effects and therefore toxicity. As a result, for example, they can be administered at higher dosages. Any of these strains of Salmonella and other species of bacteria known to those skilled in the art and / or listed above and herein can be modified as described herein. The immunostimulatory bacteria provided herein are modified to enhance colonization of the tumor microenvironment, tumor-resident immune cells, and tumors. They are engineered to have other properties, including adenosine auxotrophy, that reduce their toxicity and target them to the tumor microenvironment. The strains provided herein are also engineered so that they are not inactivated by complement.
[0241] Anticancer therapeutic products are provided that deliver genetic payloads encoding truncated costimulatory molecules (receptors or ligands: e.g., 4-1BBL, CD80, CD86, CD27L, B7RP1, OX40L) with complete, truncated, or partial cytoplasmic domain deletions for expression on antigen-presenting cells (APCs), where the truncated gene products are capable of constitutively transmitting immunostimulatory signaling to T cells via costimulatory receptor engagement and are incapable of counter-regulatory signaling to APCs due to the deletion or truncation of the cytoplasmic domain. Costimulatory molecules can also be modified to include residues (e.g., positive residues) in the truncated cytoplasmic domain that ensure their expression in the correct orientation in the cell membrane (the Examples below describe this in more detail; see, e.g., Example 19).
[0242] The bacterial strains provided herein are engineered to deliver therapeutic products. The bacterial strains herein deliver immunostimulatory proteins, including cytokines, chemokines, and costimulatory molecules, as well as modified gain-of-function cytoplasmic DNA / RNA sensors that can constitutively induce or induce type I IFN expression, and other therapeutic products that promote anti-tumor immune responses within the tumor microenvironment, such as, but not limited to, antibodies and fragments thereof, TGF-β and IL-6-binding decoy receptors, TGF-β polypeptide antagonists, bispecific T cell engagers (BiTEs®), RNAi, and complementary combinations thereof. The bacterial strains also contain genomic modifications that reduce or eliminate the ability of phagocytes to infect / invade epithelial cells, while retaining their ability to infect / invade, thereby providing a more robust immune response and / or allowing them to more effectively expand within tumors, tumor microenvironments, and tumor-resident immune cells. The bacterial strains may also be modified to be resistant to inactivation by complement factors in human serum. The bacterial strains may also be modified to encode therapeutic products including, for example, cytokines, chemokines, costimulatory molecules, constitutively active inducers of type I IFN, and monoclonal antibodies (and fragments thereof) against immune checkpoints and also against such other targets, alone or in combination.
[0243] C. Modification and Enhancement of Immunostimulatory Bacteria to Increase the Therapeutic Index and Increase Accumulation in Tumor-Resident Myeloid Cells Provided herein are enhancements, including modifications to the bacterial genome or immune-stimulating bacteria, that reduce toxicity and improve anti-tumor activity, for example, by increasing accumulation in tumor-resident myeloid cells, improving resistance to complement inactivation, reducing immune cell death, promoting adaptive immunity, and enhancing T cell function. The modifications are described with respect to Salmonella, particularly S. typhimurium, and one skilled in the art will understand that similar enhancements / modifications can be made in other bacterial species and other Salmonella strains. The following are examples of such enhancements / modifications:
[0244] 1. Deletion of genes in the LPS biosynthetic pathway Lipopolysaccharide (LPS) of Gram-negative bacteria is a major component of the outer leaflet of the bacterial membrane. It consists of three main moieties: lipid A, a nonrepetitive core oligosaccharide, and the O antigen (or O polysaccharide). The O antigen is the outermost part of LPS and acts as a protective layer against bacterial permeability, but the sugar composition of the O antigen varies widely between strains. Lipid A and the core oligosaccharide vary less and are more typically conserved among multiple strains of the same species. Lipid A is the portion of LPS that contains endotoxic activity. It is typically a disaccharide decorated with multiple fatty acids. These hydrophobic fatty acid chains anchor LPS in the bacterial membrane, while the remainder of the LPS protrudes from the cell surface. The lipid A domain is responsible for much of the toxicity of Gram-negative bacteria. LPS in the blood is typically recognized as a significant pathogen-associated molecular pattern (PAMP) and induces a pronounced pro-inflammatory response. LPS is a ligand for a membrane-bound receptor complex containing CD14, MD2, and TLR4. TLR4 is a transmembrane protein that can signal through the MyD88 and TRIF pathways to stimulate the NF-κB pathway, leading to the production of proinflammatory cytokines such as TNF-α and IL-6. The outcome can be endotoxic shock, which can be fatal. LPS in the cytosol of mammalian cells can directly bind to the CARD domains of caspases 4, 5, and 11, leading to autoactivation and pyroptotic cell death (see, e.g., Hagar et al. (2015) Cell Research 25:149-150). The composition of lipid A and the toxigenicity of lipid A variants are well documented. For example, monophosphorylated lipid A is less inflammatory than lipid A with multiple phosphate groups. The number and length of acyl chains on lipid A can also have a significant impact on the degree of toxicity. Standard lipid A from E. coli has six acyl chains, and this hexaacylation is highly toxic.Lipid A of S. typhimurium is similar to that of E. coli; it is a glucosamine disaccharide with four primary and two secondary hydroxyacyl chains (see, e.g., Raetz et al. (2002) Annu. Rev. Biochem. 71:635-700).
[0245] a. msbB deletion The enzyme lipid A biosynthesis myristoyltransferase, encoded by the msbB gene of S. typhimurium, catalyzes the addition of a terminal myristoyl group to the lipid A domain of lipopolysaccharide (LPS) (see, e.g., Low et al. (1999) Nat. Biotechnol. 17(1):37-41). Thus, deletion of msbB alters the acyl composition of the lipid A domain of LPS, a major component of the outer membrane of Gram-negative bacteria. For example, deletion of msbB in S. typhimurium VNP20009 results in the production of predominantly pentaacylated lipid A, which is less toxic than the native hexaacylated lipid A and allows for systemic delivery without inducing toxic shock (see, e.g., Lee et al. (2000) International Journal of Toxicology 19:19-25). This modification significantly reduces the ability of LPS to induce septic shock, attenuating the bacterial strain and therefore increasing the therapeutic index of Salmonella-based immunotherapy (see, e.g., U.S. Patent Application Publication Nos. 2003 / 0170276, 2003 / 0109026, 2004 / 0229338, 2005 / 0255088, and 2007 / 0298012). Importantly, msbB mutants that do not express the msbB product are unable to replicate intracellularly, as exemplified herein (see, e.g., Example 2), which is a requirement for Salmonella pathogenicity (see, e.g., Leung et al. (1991) Proc. Natl. Acad. Sci. USA 88:11470-11474).
[0246] Other LPS mutations that alter LPS expression, including substitutions, deletions, or insertions, can be introduced into the bacterial strains provided herein, including Salmonella strains, to dramatically reduce pathogenicity, thereby resulting in reduced toxicity and allowing for the administration of higher doses.
[0247] Corresponding genes encoding homologs or orthologs of lipid A biosynthetic myristoyltransferases in other bacterial species can also be deleted or disrupted to achieve similar results, including, but not limited to, lpxM, which encodes a myristoyl-acyl carrier protein-dependent acyltransferase in E. coli; and msbB, which encodes a lipid A acyltransferase in S. typhi.
[0248] b. pagP deletion As mentioned above, the msbB mutant of S. typhimurium is unable to undergo terminal myristoylation of LPS and produces predominantly pentaacylated lipid A, which is significantly less toxic than hexaacylated lipid A. Modification of lipid A with palmitate is catalyzed by the enzyme lipid A palmitoyltransferase (PagP). Transcription of the pagP gene is under the control of the PhoP / PhoQ system, which is activated by conditions of low magnesium, such as those present in the SCV. Therefore, the acyl content of S. typhimurium lipid A is variable; in wild-type bacteria, it can be hexaacylated or pentaacylated. The ability of S. typhimurium to palmitoylate its lipid A increases its resistance to antimicrobial peptides secreted into the phagolysosome.
[0249] In wild-type S. typhimurium, expression of pagP results in heptaacylated lipid A. In msbB mutants (mutants unable to add the terminal acyl chain of lipid A), induction of pagP results in hexaacylated lipid A (see, e.g., Kong et al. (2011) Infection and Immunity 79(12):5027-5038). Hexaacylated lipid A has been shown to be the most pro-inflammatory. Although several groups have attempted to exploit this pro-inflammatory signaling, for example by deleting or disrupting pagP to allow production of only hexaacylated lipid A (see, e.g., Felgner et al. (2016) Gut Microbes 7(2):171-177; and Felgner et al. (2018) Oncoimmunology 7(2):e1382791), this may result in poor resistance and, paradoxically, reduced adaptive immunity due to the TNF-α-mediated pro-inflammatory nature of LPS (see, e.g., Kocijancic et al. (2017) Oncotarget 8(30):49988-50001).
[0250] LPS is a potent TLR4 agonist that induces TNF-α and IL-6. 1E9 CFUs / m 2 Dose-limiting toxicity in IVVNP20009 clinical trials in mice (see, e.g., Toso et al. (2002) J. Clin. Oncol. 20(1):142-152) was cytokine-mediated (fever, hypotension), with serum TNF-α levels >100,000 pg / ml and IL-6 levels >10,000 pg / ml at 2 hours. Despite the msbB deletion in VNP20009 and its reduced pyrogenicity, LPS can still be toxic at high doses, likely due to the presence of hexaacylated lipid A. Thus, pagP, which is unable to produce hexaacylated lipid A and produces only pentaacylated lipid A, resulting in reduced induction of pro-inflammatory cytokines, is not a candidate. - / msbB -The strain was better tolerated at higher doses, reaching 1E9 CFUs / m 2 This makes it possible to administer the bacterium to humans at doses above 100mg / mL. Higher doses result in further colonization of tumors, tumor-resident immune cells, and the tumor microenvironment, enhancing the therapeutic efficacy of the immunostimulatory bacterium. The resulting changes in the bacterial membrane and structure alter host immune responses, such as complement activity, to prevent the bacterium from being eliminated upon systemic administration. For example, pagP - / msbB - The mutant strain is shown herein to have increased resistance to complement inactivation and enhanced stability in human serum (see, eg, Example 5).
[0251] Provided herein are immunostimulatory bacteria, exemplified by live attenuated Salmonella strains, such as exemplary strains of S. typhimurium, capable of producing only LPS with pentaacylated lipid A, containing a deletion of the msbB gene, and further modified by the deletion or disruption of pagP. As shown above, the deletion of msbB expression prevents terminal myristoylation of lipid A, while the deletion of pagP expression prevents palmitoylation. When further modified to express a heterologous genetic payload that stimulates an immune response within the tumor microenvironment, strains engineered to produce LPS with pentaacylated lipid A result in reduced pro-inflammatory cytokine levels, improved stability in the blood, resistance to complement fixation, increased susceptibility to antimicrobial peptides, enhanced tolerance, and increased anti-tumor immunity.
[0252] Corresponding genes encoding homologs and orthologs of lipid A palmitoyltransferase (PagP) in other bacterial species can also be deleted or disrupted to achieve similar results, including, but not limited to, pagP, which encodes lipid IVA palmitoyltransferase in E. coli; and pagP, which encodes the antimicrobial peptide resistance and lipid A acylation protein in S. typhi.
[0253] 2. Nutritional requirements The immunostimulatory bacteria provided herein can be attenuated by making them auxotrophic for one or more essential nutrients, such as purines (e.g., adenine), nucleosides (e.g., adenosine), amino acids (e.g., aromatic amino acids, arginine, and leucine), adenosine triphosphate (ATP), or other nutrients known and described in the art.
[0254] a.purI deletion / disruption Phosphoribosylaminoimidazole synthetase is an enzyme encoded by the purI gene (synonymous with the purM gene) and is involved in the purine biosynthetic pathway. Therefore, disruption, deletion, or inactivation of the purI gene renders the bacterium auxotrophic for purines. In addition to being attenuated, the purI - The mutant is enriched in the tumor environment and has significant antitumor activity (see, e.g., Pawelek et al. (1997) Cancer Research 57:4537-4544). It has previously been described that this colonization is the result of the high concentration of purines present in the interstitial fluid of tumors as a result of rapid cell turnover in tumors. -Because bacteria cannot synthesize purines, they require an external source of adenine, which was thought to result in their restricted growth in the purine-rich tumor microenvironment (see, e.g., Rosenberg et al. (2002) J. Immunotherapy 25(3):218-225). The VNP20009 strain was initially reported to contain a deletion of the purI gene (see, e.g., Low et al. (2003) Methods in Molecular Medicine Vol. 90, Suicide Gene Therapy: Methods and Reviews, pp. 47-59). However, subsequent genome analysis of VNP20009 demonstrated that the purI gene was not deleted but rather disrupted by a chromosomal inversion (see, e.g., Broadway et al. (2014) Journal of Biotechnology 192:177-178). The entire purI gene is contained in two parts of the VNP20009 chromosome, flanked by insertion sequences, one of which harbors an active transposase. Disruption of the purI gene restricts replication to tumor tissue / microenvironment, while still allowing intracellular replication and pathogenicity. As exemplified herein (see Example 2), deletion or disruption of each of the msbB and purI genes is necessary to restrict growth to the extracellular space within tumor tissue and prevent intracellular replication. To eliminate any possible reversion to wild-type by recombination, strains in which the coding portions of these genes are completely deleted are provided herein.
[0255] In addition to purI gene deletion or disruption, nutrient auxotrophy can be introduced into immunostimulatory bacteria by deletion / mutation in genes such as aro, gua, thy, nad, and asd. Nutrients produced by biosynthetic pathways involving these genes are often unavailable within host cells, making bacterial survival difficult. For example, attenuation of Salmonella and other bacterial species can be achieved by deletion of the aroA gene, which is part of the shikimate pathway that links glycolysis with aromatic amino acid biosynthesis (see, e.g., Felgner et al. (2016) mBio 7(5):e01220-16). Deletion of aroA results in bacterial auxotrophy for aromatic amino acids and subsequent attenuation (see, e.g., U.S. Patent Application Publication Nos. 2003 / 0170276, 2003 / 0175297, 2012 / 0009153, and 2016 / 0369282; and International Application Publication Nos. WO2015 / 032165 and WO2016 / 025582). Similarly, other enzymes involved in the aromatic amino acid biosynthetic pathway, including aroC and aroD, have been deleted to achieve attenuation (see, e.g., U.S. Patent Application Publication No. 2016 / 0369282; and International Application Publication No. WO2016 / 025582). For example, the SL7207 strain of S. typhimurium is an aromatic amino acid auxotroph (aroA - mutant), the A1 and A1-R strains are leucine-arginine auxotrophs, and VNP20009 / YS1646 is a purine auxotroph (purI - As shown herein, VNP20009 / YS1646 is auxotrophic for the immunosuppressive nucleoside adenosine and for ATP (see, e.g., Example 1).
[0256] Corresponding genes encoding homologs or orthologs of phosphoribosylaminoimidazole synthetase (purI) in other bacterial species and other genes required for purine synthesis can also be deleted or disrupted to achieve similar results. These genes include, but are not limited to, purM, which encodes phosphoribosylformylglycine amide cycloligase in Escherichia coli; purM, which encodes phosphoribosylformylglycine amidine cycloligase in S. typhi; purA, which encodes adenylosuccinate synthetase, purQ, which encodes phosphoribosylformylglycine amidine synthase II, and purS, which encodes the phosphoribosylformylglycine amidine synthase subunit purS in L. monocytogenes; purM (BL1122), which encodes phosphoribosylformylglycine amidine cycloligase in Bifidobacterium longum; and NT01CX_RS09765, which encodes AIR synthase, and NT01CX_RS07625 (purM), which encodes phosphoribosylformylglycine amidine cycloligase in Clostridium novyi.
[0257] B adenosine auxotrophy Metabolites derived from tryptophan and the adenosine triphosphate (ATP) / adenosine pathway are key drivers in creating an immunosuppressive environment in the tumor / tumor microenvironment (TME). Adenosine exists in free form inside and outside cells and is an effector of immune function. Adenosine reduces T cell receptor-induced activation of NF-κB and inhibits IL-2, IL-4, and IFN-γ. Adenosine reduces T cell cytotoxicity, increases T cell anergy, and upregulates Foxp3. + or Lag3 +Adenosine increases T cell differentiation into regulatory T cells (T-reg cells, T-regs, or Tregs). On natural killer (NK) cells, adenosine reduces IFN-γ production and suppresses NK cell cytotoxicity. Adenosine blocks neutrophil adhesion and extravasation, reduces phagocytosis, and attenuates superoxide and nitric oxide levels. Adenosine also reduces the expression of TNF-α, IL-12, and MIP-1α (CCL3) on macrophages, attenuates major histocompatibility complex (MHC) class II expression, and increases IL-10 and IL-6 levels. Adenosine's immunomodulatory activity occurs after its release into the extracellular space of tumors and activation of adenosine receptors (ADRs) on the surface of target immune cells, cancer cells, or endothelial cells. High adenosine levels in the tumor microenvironment result in local immunosuppression, which limits the immune system's ability to eliminate cancer cells.
[0258] Extracellular adenosine is produced by the sequential activity of the membrane-bound ectoenzymes CD39 (ectonucleoside triphosphate diphosphohydrolase 1, also known as NTPDase1) and CD73 (ecto-5'-nucleotidase), which are expressed on tumor stromal cells and cooperate to produce adenosine by phosphohydrolysis of ATP or ADP produced by dead or dying cells. CD39 converts extracellular ATP (or ADP) to 5'-AMP, which is then converted to adenosine by CD73. Under the hypoxic conditions of the tumor microenvironment, expression of CD39 and CD73 on endothelial cells increases, thereby increasing adenosine levels. Tumor hypoxia can result from insufficient blood supply and disorganized tumor vasculature, which impairs oxygen delivery (see, e.g., Carroll and Ashcroft (2005) Expert. Rev. Mol. Med. 7(6), DOI: 10.1017 / S1462399405009117). Hypoxia occurs in the tumor microenvironment and also inhibits adenylate kinase (AK), which converts adenosine to AMP, resulting in very high extracellular adenosine concentrations. The extracellular concentration of adenosine in the hypoxic tumor microenvironment has been measured at 10–100 μM, which is approximately 100–1000 times higher than typical extracellular adenosine concentrations of up to approximately 0.1 μM (see, e.g., Vaupel et al. (2016) Adv. Exp. Med. Biol. 876:177–183; and Antonioli et al. (2013) Nat. Rev. Can. 13:842–857). Because hypoxic regions of tumors are far from microvasculature, some areas of the tumor may have higher local concentrations of adenosine than others.
[0259] In addition to its immune system-inhibiting effects, adenosine can also regulate the growth and dissemination of cancer cells through its effects on cancer cell proliferation, apoptosis, and angiogenesis. For example, adenosine is primarily involved in the A 2A and A 2BAdenosine can promote angiogenesis through the stimulation of receptors on endothelial cells. Stimulation of receptors on endothelial cells regulates the expression of intercellular adhesion molecule 1 (ICAM-1) and E-selectin on endothelial cells, maintaining vascular integrity and promoting vascular growth (see, e.g., Antonioli et al. (2013) Nat. Rev. Can. 13:842-857). Adenosine stimulates A receptors on various cells. 2A , A 2B Activation of one or more of A1, A2, or A3 can stimulate the production of pro-angiogenic factors such as vascular endothelial growth factor (VEGF), interleukin 8 (IL-8), or angiopoietin 2 (see, e.g., Antonioli et al. (2013) Nat. Rev. Can. 13:842-857).
[0260] Adenosine can also directly regulate tumor cell proliferation, apoptosis, and metastasis through interactions with receptors on cancer cells. For example, studies have shown that A1 and A 2A Activation of the receptor promotes tumor cell proliferation in some breast cancer cell lines, and A 2B Activation of the receptor has been shown to have cancer growth-promoting properties in colon cancer cells (see, e.g., Antonioli et al. (2013) Nat. Rev. Can. 13:842-857). Adenosine can also induce apoptosis in cancer cells, and various studies have linked this activity to the A3-mediated extrinsic apoptotic pathway or A3-mediated apoptosis pathway. 2A and A 2B Adenosine has been correlated with activation of the intrinsic apoptotic pathway via adenosine (see, e.g., Antonioli et al. (2013)). Adenosine can promote tumor cell migration and metastasis by increasing cell motility, adhesion to the extracellular matrix, and expression of cell adhesion proteins and receptors, promoting cell movement and motility.
[0261] Adenosine triphosphate (ATP) is released extracellularly from stimulated immune cells and from damaged, dying, or stressed cells. This release of ATP stimulates the NLR family pyrin domain-containing 3 (NLRP3) inflammasome, which activates caspase-1, leading to the secretion of the cytokines IL-1β and IL-18, which then activate the innate and adaptive immune responses (see, e.g., Stagg and Smyth (2010) Oncogene 29:5346-5358). ATP can accumulate to concentrations of over 100 mM in tumor tissue, whereas the levels of ATP found in healthy tissue are very low (approximately 1-5 μM) (see, e.g., Song et al. (2016) Am. J. Physiol. Cell Physiol. 310(2):C99-C114). ATP is catabolized to adenosine by the enzymes CD39 and CD73. Activated adenosine acts as a highly immunosuppressive metabolite through a negative feedback mechanism and has pleiotropic effects on multiple immune cell types in the hypoxic tumor microenvironment (see, e.g., Stagg and Smyth (2010) Oncogene 29:5346-5358). Adenosine receptor A 2A and A 2B CD73 is expressed on various immune cells and stimulated by adenosine, promoting alterations in cAMP-mediated signaling, resulting in an immunosuppressive phenotype in T cells, B cells, NK cells, dendritic cells (DCs), mast cells, macrophages, neutrophils, and natural killer T (NKT) cells. Consequently, in pathological tissues, such as solid tumors, which have been shown to overexpress ectonucleotidases such as CD73, adenosine levels can accumulate to more than 100-fold their normal concentrations. Adenosine has also been shown to promote tumor angiogenesis and tumorigenesis. Therefore, engineered bacteria that are auxotrophic for adenosine may exhibit enhanced tumor targeting and colonization.
[0262] Immunostimulatory bacteria such as Salmonella typhi can be made auxotrophic for adenosine, for example, by deletion of the tsx genes (see, e.g., Bucarey et al. (2005) Infection and Immunity 73(10):6210-6219) or by deletion of purD (see, e.g., Husseiny (2005) Infection and Immunity 73(3):1598-1605). In the Gram-negative bacterium Xanthomonas oryzae, a purD gene knockout was shown to be auxotrophic for adenosine (see, e.g., Park et al. (2007) FEMS Microbiol. Lett. 276:55-59). As exemplified herein, the VNP20009 strain of S. typhimurium is auxotrophic for adenosine due to its purI modification, and therefore no further modification is required to make it auxotrophic for adenosine. Thus, embodiments of immune-stimulating bacterial strains provided herein are auxotrophic for adenosine. Such auxotrophic bacteria selectively replicate in the tumor microenvironment, thereby further enhancing the accumulation and replication of the administered bacteria within the tumor, reducing the levels of adenosine in and around the tumor, and thereby reducing or eliminating the immune suppression caused by adenosine accumulation. Examples of such bacteria provided herein include those that utilize purI, which results in adenosine auxotrophy. - / msbB - VNP20009 is a modified strain of S. typhimurium containing a mutation. For other strains and bacteria, the purI gene can be disrupted, as is done in VNP20009, or it can contain a deletion of all or part of the purI gene, ensuring that reversion to the wild-type gene cannot occur. As described elsewhere herein, in the VNP20009 strain, the purI -The gene was inactivated by inversion. Similarly, the msbB gene in VNP20009 was not completely deleted. As exemplified herein, strains in which the purI and msbB genes have been completely deleted to eliminate any risk of reversion exhibit superior fitness as assessed by growth of in vitro cultures.
[0263] Immunostimulatory bacteria are used that have been modified by rendering them auxotrophic for one or more essential nutrients, such as purines (e.g., adenine), nucleosides (e.g., adenosine), amino acids (e.g., aromatic amino acids, arginine, and leucine), or adenosine triphosphate (ATP). In particular, in embodiments of the immunostimulatory bacteria provided herein, such as strains of S. typhimurium, the bacteria are rendered auxotrophic for adenosine and may also be rendered auxotrophic for ATP, and preferentially grow in the tumor microenvironment (TME). Thus, the immunostimulatory bacterial strains described herein are attenuated because they require purines, adenosine, and / or ATP for growth and preferentially colonize TMEs rich in these metabolites, as discussed below. Because adenosine accumulation in the tumor microenvironment of some tumors is immunosuppressive, adenosine auxotrophy removes immunosuppression from adenosine that accumulates in the tumor microenvironment of certain cancers.
[0264] 3. Plasmid Maintenance and Delivery a.asd deletion The bacterial asd gene encodes aspartate semialdehyde dehydrogenase. -The mutant has an absolute requirement for diaminopimelic acid (DAP), which is necessary for cell wall synthesis, and lyses in a DAP-depleted environment. This DAP auxotrophy can be used for plasmid selection and maintenance of plasmid stability in vivo without antibiotics when the asd gene is complemented in trans by a plasmid within the bacterium. A non-antibiotic-based plasmid selection system is advantageous, allowing 1) the use of antibiotics administered as a rapid clearance mechanism when adverse symptoms occur and 2) antibiotic-free scale-up of production in cases where antibiotic use would normally be avoided. The asd gene complementation system provides such non-antibiotic-based plasmid selection (see, e.g., Galan et al. (1990) Gene 94(1):29-35). The use of the asd gene complementation system to maintain plasmids in the tumor microenvironment is expected to increase the efficacy of engineered S. typhimurium to deliver plasmids encoding genetic payloads / therapeutic products such as immune stimulatory proteins (e.g., cytokines, chemokines, costimulatory molecules); cytoplasmic DNA / RNA sensors that induce type I IFN, such as STING and IRF3, and gain-of-function / constitutively active mutants thereof; antibodies and fragments thereof (e.g., checkpoint inhibitors, or anti-IL-6 or anti-VEGF antibodies); bispecific T cell engagers (sold under the trademark BiTEs®); interfering RNA; and other therapeutic products discussed elsewhere herein and known in the art; and all complementary combinations of the foregoing therapeutic products.
[0265] An alternative use for S. typhimurium asd mutants is to exploit the DAP auxotrophy to produce autolytic (or suicide) strains for delivering therapeutic products / macromolecules to infected cells that lack the ability to persistently colonize host tumors. Deletion of the asd gene renders the bacterium auxotrophic for DAP when grown in vitro or in vivo. The example described herein provides an asd deletion strain that is auxotrophic for DAP and contains a plasmid suitable for delivery of an immunomodulatory protein that does not contain an asd complementing gene, resulting in a strain that lacks replication in vivo. This strain propagates and grows normally in vitro in the presence of DAP and is then administered as an immunotherapeutic agent to a mammalian host in the absence of DAP. The suicide strain is capable of invading host cells but is unable to replicate due to the absence of DAP in mammalian tissues, and automatically lyses, delivering its cytosolic contents (e.g., plasmid or protein).
[0266] Corresponding genes encoding homologs or orthologs of aspartate semialdehyde dehydrogenase (asd) in other bacterial species can also be deleted or disrupted to achieve similar results. These genes include, but are not limited to, asd encoding aspartate semialdehyde dehydrogenase in Escherichia coli, asd encoding aspartate semialdehyde dehydrogenase in S. typhi (STY4271), asd encoding aspartate semialdehyde dehydrogenase in L. monocytogenes (lmo1437), asd encoding aspartate semialdehyde dehydrogenase in Bifidobacterium longum (BL0492), and NT01CX_RS04325 (asd) encoding aspartate semialdehyde dehydrogenase in Clostridium novyi.
[0267] b.endA deletion / disruption The endA gene (see, e.g., SEQ ID NO: 250) encodes an endonuclease (DNA-specific endonuclease I; see, e.g., SEQ ID NO: 251) that mediates the degradation of double-stranded DNA (dsDNA) in the periplasm of Gram-negative bacteria. Mutations in the endA gene allow for increased yields of plasmid DNA, so most common strains of laboratory E. coli contain the endA gene. - This gene is conserved among species. To facilitate intact plasmid DNA delivery, the endA gene of engineered immunostimulatory bacteria is deleted or mutated to prevent its endonuclease activity. Examples of such mutations include the E208K amino acid substitution (see, e.g., Durfee et al. (2008) J. Bacteriol. 190(7):2597-2606) or the corresponding mutation in the species of interest. endA, including residue E208, is conserved among bacterial species, including Salmonella. Therefore, the E208K mutation can be used to eliminate endonuclease activity in other species, including Salmonella species. One skilled in the art can introduce other mutations or deletions that eliminate endA activity. Inducing this mutation or deleting or disrupting this gene to eliminate the activity of endA in the immunostimulatory bacteria herein, for example in Salmonella, increases the efficiency of intact plasmid DNA delivery, thereby increasing the expression of any one, two, or more immunomodulatory proteins / therapeutic products encoded on the plasmid and enhancing anti-tumor immune responses and anti-tumor efficacy.
[0268] 4. Flagellin Knockout Strain Flagella are bacterial surface organelles that provide a means of locomotion, consisting of long filaments attached to rotary motors via hooks that can rotate clockwise or counterclockwise. Flagella, such as those of S. typhimurium, are important for their ability to mediate motility through mucosal layers in the gastrointestinal tract, for chemotaxis, and for establishing infection via the oral route. Flagella have been demonstrated to be required for chemotaxis to and colonization of tumor cylindroids in vitro (see, e.g., Kasinskas and Forbes (2007) Cancer Res. 67(7):3201-3209). Motility has been shown to be important for tumor penetration (see, e.g., Toley and Forbes (2012) Integr. Biol. (Camb) 4(2):165-176). However, flagella are not required for tumor colonization in animals when the bacteria are administered intravenously (see, e.g., Stritzker et al. (2010) International Journal of Medical Microbiology 300:449-456). Each flagellar filament is composed of tens of thousands of flagellin subunits. The S. typhimurium chromosome contains two genes, fliC and fljB, which encode antigenically distinct flagellin monomers. Defective mutants of fliC and fljB are nonmotile and nonpathogenic when administered via the oral route of infection, but remain virulent when administered parenterally.
[0269] Flagellin is the major pro-inflammatory determinant of Salmonella (see, e.g., Zeng et al. (2003) J. Immunol. 171:3668-3674) and is directly recognized by TLR5 on the cell surface and by NLCR4 in the cytosol (see, e.g., Lightfield et al. (2008) Nat. Immunol. 9(10):1171-1178). Both pathways lead to a pro-inflammatory response, resulting in the secretion of cytokines, including IL-1β, IL-18, TNF-α, and IL-6. Attempts have been made to make Salmonella-based cancer immunotherapy more potent by increasing the pro-inflammatory response to flagellin by engineering bacteria to secrete Vibrio vulnificus flagellin B, which induces greater inflammation than flagellin encoded by fliC and fljB (see, for example, Zheng et al. (2017) Sci. Transl. Med. 9(376):eaak9537).
[0270] Herein, Salmonella bacteria, such as S. typhimurium, are engineered to lack flagellin subunits fliC and fljB, reducing TLR5-mediated pro-inflammatory signaling. Similarly, other bacteria containing flagella can be engineered to lack flagella. For example, as shown herein, Salmonella strains with deletions of msbB and / or pagP, which result in reduced TNF-alpha induction, are combined with knockouts of fliC and fljB. This results in Salmonella strains with both reduced TNF-alpha induction and reduced TLR5 recognition. These bacterial modifications, i.e., msbB, result in reduced TNF-alpha induction and reduced TLR5 recognition. - , pagP - , fliC - , and fljB -The modified genome can be combined with an immunostimulatory plasmid, which may contain CpGs, encoding therapeutic products such as immunomodulatory proteins, either alone or in combination. The resulting bacteria have reduced pro-inflammatory signaling but robust anti-tumor activity. These genome modifications can also be combined with other genome modifications described herein.
[0271] For example, as exemplified and provided herein, a fliC and fljB double mutant was constructed in VNP20009, an asd deletion strain of S. typhimurium. VNP20009 is attenuated for virulence by disruption of purI / purM and contains a modification (partial deletion) of the msbB gene that results in the production of a lipid A subunit that is less toxigenic than wild-type lipid A. This results in reduced TNF-α production in a mouse model after intravenous administration compared to strains with wild-type lipid A. The resulting strain is an example of a strain attenuated for bacterial inflammation by modification of lipid A that reduces TLR2 / 4 signaling and deletion of expression of flagellin subunits that reduces TLR5 recognition and inflammasome induction.
[0272] The pathogenesis of certain bacterial species, including Salmonella species such as S. typhimurium, involves a group of genes called the Salmonella pathogenicity island (SPI). Salmonella invades nonphagocytic intestinal epithelial cells using a type 3 secretion system (T3SS) encoded by Salmonella pathogenicity island 1 (SPI-1), which forms needle-like structures that inject effector proteins directly into the host cell cytosol. These effector proteins cause rearrangements of the eukaryotic cell cytoskeleton to facilitate invasion of the intestinal epithelium and also induce proinflammatory cytokines. The SPI, designated SPI-1, mediates invasion of epithelial cells. SPI-1 genes include, but are not limited to, avrA, hilA, hilD, invA, invB, invC, invE, invF, invG, invH, invI, invJ, iacP, iagB, spaO, spaP, spaQ, spaR, spaS, orgA, orgB, orgC, prgH, prgI, prgJ, prgK, sicA, sicP, sipA, sipB, sipC, sipD, sirC, sopB, sopD, sopE, sopE2, sprB, and sptP. Deletion of one or more of these genes reduces or eliminates the ability of bacteria to infect epithelial cells but does not affect the ability of bacteria to infect or invade phagocytic cells, including phagocytic immune cells. For example, it has been demonstrated that deletion of both the fliC and fljB genes significantly reduced the expression of SPI-1 genes such as hilA, hilD, invA, invF, and sopB, thereby reducing the ability to invade non-phagocytic cells (see, e.g., Elhadad et al. (2015) Infect. Immun. 83(9):3355-3368).
[0273] In bacteria such as Salmonella, flagellin, in addition to the SPI-1 type 3 secretion system (T3SS), is required to induce pyroptosis in macrophages and can be detected by the macrophage NLRC4 inflammasome. Ablation of flagellin subunits reduces macrophage pyroptosis. For example, S. typhimurium with deletions of fliC and fljB exhibits significantly reduced IL-1β secretion compared to wild-type strains, yet bacterial cellular uptake and intracellular replication remain unaffected. This indicates that flagellin plays a significant role in inflammasome activation. Additionally, S. typhimurium strains engineered to constitutively express fliC were found to induce macrophage pyroptosis (see, e.g., Li et al. (2016) Scientific Reports 6:37447; Fink and Cookson (2007) Cellular Microbiology 9(11):2562-2570; and Winter et al. (2015) Infect. Immun. 83(4):1546-1555).
[0274] The genome of the immunostimulatory bacteria herein may be modified by deleting or mutating the flagellin genes fliC and fljB in S. typhimurium, resulting in reduced cell death of tumor-resident immune cells such as macrophages and enhancing the anti-tumor immune response of the immunostimulatory bacteria. Combined with LPS modification, the deletion of flagellin subunits allows for increased host tolerance, restricting uptake to phagocytes only, reducing their pyroptotic cell death, and directing the immunostimulatory response toward the delivery of therapeutic products, such as immunomodulatory proteins, to the TME, particularly tumor-resident myeloid cells. The resulting immunostimulatory bacteria induce anti-tumor responses and promote adaptive immune responses against tumors.
[0275] Corresponding genes encoding flagellins in other bacterial species can also be deleted to achieve similar results, including, but not limited to, fliC, encoding the flagellar filament structural protein, and fliE, encoding the flagellar basal body protein FliE in E. coli; fliC, encoding flagellin, and flgB, encoding the flagellar basal body rod protein FlgB in S. typhi; flaA, encoding flagellin, fliE, encoding the flagellar hook basal body protein FliE, and flgB, encoding the flagellar basal body rod protein FlgB in L. monocytogenes; and These include NT01CX_RS04995, NT01CX_RS04990, NT01CX_RS05070, and NT01CX_RS05075, which encode flagellins in Clostridium norvii; NT01CX_RS05080 (flgB), which encodes the flagellar basement rod protein FlgB; NT01CX_RS05085 (flgC), which encodes the flagellar basement rod protein FlgC; and NT01CX_RS05215 (flgG), which encodes the flagellar basement rod protein FlgG.
[0276] 5. Bacterial engineering to promote adaptive immunity and enhance T cell function L-asparaginase II (ansB) deletion / disruption L-asparaginase II is an enzyme that catalyzes the conversion of L-asparagine to ammonia and aspartate. Some bacterial strains, such as Escherichia coli and S. typhimurium, utilize L-asparaginase to capture fructose-asparagine as a carbon and nitrogen source (see, e.g., Sabag-Daigle et al. (2018) Appl. Environ. Microbiol. 84(5):e01957-17). Malignant T cells, such as those in acute lymphoblastic leukemia (ALL), require asparagine because they lack the enzyme that synthesizes asparagine. Administration of L-asparaginase has been a frontline treatment for ALL since the early 1970s (see, e.g., Batool et al. (2016) Appl. Biochem. Biotechnol. 178(5):900-923). L-asparaginase II production by S. typhimurium is necessary and sufficient for T cell suppression because it directly induces T cell receptor (TcR) downregulation, reduces T cell cytokine production, and inhibits tumor cell lytic function (see, e.g., Kullas et al. (2012) Cell Host Microbe. 12(6)791-798; and van der Velden et al. (2005) Proc. Natl. Acad. Sci. USA 102(49):17769-17774). Under conditions of rapid clonal proliferation, such as those occurring during T cell activation in the tumor microenvironment, asparagine is required, and its depletion by L-asparaginase II results in T cell suppression. Therefore, L-asparaginase II has been used as an anticancer therapeutic agent for cancers in which T cell suppression is a therapeutic modality.
[0277] In contrast to the prior use of L-asparaginase as an anti-cancer therapeutic, the elimination of L-asparaginase activity in the immunostimulatory bacteria provided herein is shown to enhance T cell function in tumor microenvironments. Elimination of L-asparaginase activity can be achieved by modifying the bacterial genome to eliminate expression of the active enzyme. Modifications include nucleic acid insertions, deletions, inversions, and substitutions such that the resulting encoded enzyme is inactive, not expressed, or absent. Deletion or disruption of all or part of the ansB gene encoding L-asparaginase II in the immunostimulatory bacteria, thereby eliminating expression of the encoded enzyme, is shown herein to enhance T cell function in tumor microenvironments colonized by the bacteria. Suppression of L-asparaginase II activity is achieved by deletion or disruption / disruption of all or part of the ansB gene in the immunostimulatory bacteria, such that L-asparaginase II is not produced thereby. Thus, immunostimulatory bacteria are provided whose genomes have been modified to prevent the production of L-asparaginase II. The immunostimulatory bacteria provided herein are used to colonize tumor-resident immune cells and enhance anti-tumor immune responses, and such genomic modifications include deletions, insertions, disruptions, and / or other modifications that abolish expression of L-asparaginase II.
[0278] As shown herein, the genome of the immunostimulatory bacteria herein can be modified to delete, disrupt, or otherwise modify ansB, or to inactivate or eliminate the encoded L-asparaginase II, thereby preventing T cell suppression in vivo and enhancing anti-tumor T cell function. Strains with intact ansB are shown herein to induce significant T cell immunosuppression in T cells infected with the strain. Strains lacking ansB do not induce immunosuppression, thus solving another problem in the art when using bacteria to deliver encoded therapeutic products to tumors. Thus, immunostimulatory bacteria that combine deletion or disruption of the ansB gene, thereby preventing expression of a functional encoded enzyme, with other modifications described herein that result in increased accumulation in the tumor microenvironment and / or tumor-resident immune cells, provide superior therapeutic immunostimulatory bacteria.
[0279] Corresponding genes encoding homologs or orthologs of L-asparaginase II (ansB) in other bacterial species can also be deleted or disrupted to achieve similar results. These genes include, but are not limited to, ansB, which encodes L-asparaginase II in E. coli; ansB (STY3259), which encodes L-asparaginase in S. typhi; ansB (lmo1663), which encodes asparagine synthetase in L. monocytogenes; and BL1142, which encodes the L-asparaginase precursor in Bifidobacterium longum.
[0280] 6. Deletion / disruption of Salmonella genes required for curli fimbria expression Bacteria and fungi can form multicellular structures called biofilms. Bacterial biofilms are encapsulated in a mixture of secreted and cell wall-bound polysaccharides, glycoproteins, and glycolipids, collectively known as extracellular polymeric substances (EPS), as well as extracellular DNA. These EPS protect bacteria from multiple insults, such as cleaning agents, antibiotics, and antimicrobial peptides. Bacterial biofilms enable surface colonization and are a cause of serious infections of prosthetic devices, such as injection ports and catheters. Biofilms can also form in tissues during the course of an infection, increasing bacterial persistence and shedding duration and limiting the effectiveness of antibiotic therapy. Chronic persistence of bacteria in biofilms has been associated with increased tumor development, for example, in S. typhi infections of the gallbladder (see, e.g., Di Domenico et al. (2017) Int. J. Mol. Sci. 18:1887).
[0281] In Salmonella species, such as S. typhimurium, biofilm formation is regulated by csgD, which activates the csgBAC operon and increases the production of the curli subunits CsgA and CsgB (see, e.g., Zakikhany et al. (2010) Molecular Microbiology 77(3):771-786). CsgA is recognized as a PAMP by TLR2 and induces IL-8 production from human macrophages (see, e.g., Tukel et al. (2005) Molecular Microbiology 58(1):289-304). csgD also indirectly increases cellulose production by activating the adrA gene, which encodes diguanylate cyclase. The small molecule produced by adrA, cyclic diguanosine monophosphate (c-di-GMP), is a ubiquitous second messenger present in almost all bacterial species. Increased c-di-GMP enhances expression of the cellulose synthase gene bcsA, which in turn increases cellulose production through stimulation of the bcsABZC and bcsEFG operons, leading to cellulose biofilm formation. As a result, bacteria such as S. typhimurium can form biofilms in solid tumors as protection from phagocytosis by host immune cells. Bacterial mutants, such as Salmonella mutants, that are unable to form biofilms are more rapidly taken up by host phagocytes and more easily eliminated from infected tumors (see, e.g., Crull et al. (2011) Cellular Microbiology 13(8):1223-1233). This increased intracellular localization within phagocytes can reduce the persistence of extracellular bacteria and, as shown herein, can enhance the efficacy of plasmid delivery of therapeutic products, such as the immunomodulatory proteins and other anti-cancer therapeutics described herein.Reducing the ability of immunostimulatory bacteria, such as S. typhimurium, to form biofilms can be achieved, for example, through the deletion or disruption of genes involved in biofilm formation, such as csgD, csgA, csgB, adrA, bcsA, bcsB, bcsZ, bcsE, bcsF, bcsG, dsbA, or dsbB (see, e.g., Anwar et al. (2014) PLoS ONE 9(8):e106095).
[0282] It is shown herein that engineering immune-stimulating bacteria to reduce biofilm formation increases tumor / tissue clearance, thereby increasing therapy tolerability and preventing prosthetic colonization in patients, thereby enhancing the therapeutic efficacy of these strains. Adenosine mimetics are known to inhibit S. typhimurium biofilm formation, indicating that high adenosine concentrations in the tumor microenvironment may contribute to tumor-associated biofilm formation (see, e.g., Koopman et al. (2015) Antimicrob. Agents Chemother. 59:76-84). It is shown herein that csgD-deficient strains exhibit improved antitumor efficacy due to increased bacterial uptake into tumor-resident myeloid cells.
[0283] Corresponding genes encoding homologs and orthologs of csgD in other bacterial species, as well as other genes required for curli and biofilm formation, can also be deleted, disrupted, or otherwise modified to achieve similar results. These genes include, but are not limited to, csgD, which encodes the DNA-binding transcriptional dual regulator CsgD in E. coli; csgD (STY1179), which encodes the regulatory protein CsgD in S. typhi; and lcp, which encodes the Listeria cellulose-binding protein involved in biofilm formation in L. monocytogenes.
[0284] of the bacterial genome, e.g., the csgD -Modification by gene deletion or disruption of β-actin, which eliminates curli pili and inflammatory cyclic dinucleotides (CDNs), eliminates cellulose secretion, eliminates inflammatory and immunosuppressive elements, and prevents TLR4 recognition via altered LPS acylation, eliminating cellulose secretion and therefore potential biofilm formation, thereby increasing safety and efficacy.
[0285] As described herein, bacterial strains, such as S. typhimurium strains, that are engineered to be auxotrophic for adenosine; and that have a reduced ability to induce pro-inflammatory cytokines due to modified LPS and / or deleted flagellin; and / or do not express L-asparaginase II to improve T cell function; and / or contain deletions of genes required for biofilm formation; and / or are further modified to maintain a significant, at least low to moderate, or higher, plasmid copy number per cell without antibiotic selection, and that deliver a genetic expression cassette encoding a therapeutic product promote robust antitumor immune responses. The plasmid contains regulatory sequences that promote secretion of the encoded therapeutic product into the tumor microenvironment.
[0286] 7.Improved resistance to complement The complement system is the first line of immune defense against invading pathogens, directly activating the lectin or alternative pathway (AP) cascade in the human host. It comprises over 30 soluble and membrane-bound proteins that function in the innate immune response to recognize and kill pathogens, including bacteria, virus-infected cells, and parasites, and also play a role in antibody-mediated immune responses. Activation of the complement cascade leads to opsonization of foreign microorganisms, the release of chemotactic peptides, and ultimately the destruction of bacterial cell membranes. Three homologous glycoproteins in the complement system (C3, C4, and C5) play central roles in complement function and interact with other complement components. C3b and C4b, derived from C3 and C4, respectively, are key components of convertases that promote activation of the complement cascade. Cleavage fragments of C5 are C5a, which induces migration of phagocytes into the site of infection, and C5b, which initiates membrane attack complex formation and bacteriolysis (see, e.g., Ramu et al. (2007) FEBS Letters 581:1716-1720).
[0287] To survive, pathogens have developed strategies to prevent the harmful consequences of complement activation. For example, members of the Ail / Lom family of outer membrane proteins provide some pathogenic bacteria with protection from complement-dependent killing. Members of the Ail / Lom family, including Ail (adhesion / invasion locus) of Yersinia species, such as Y. enterocolitica and Y. pseudotuberculosis, Rck (resistance to complement killing) and PagC of Salmonella species, and OmpX of Escherichia coli, are outer membrane proteins that share significant amino acid sequence similarity and identity and have similar membrane topologies. While members of this family of proteins exhibit diverse functions, some of them, including Ail of Y. enterocolitica and Y. pseudotuberculosis and Rck of S. enterica, function, at least in part, to protect bacteria from complement-mediated lysis (see, e.g., Bartra et al. (2008) Infection and Immunity 76:612-622).
[0288] Another bacterial product that helps evade or mitigate complement is the surface protease PgtE (outer membrane serine protease) in Salmonella and other members of the omptin family. The S. enterica surface protease PgtE belongs to the omptin family of outer membrane aspartic proteases in enterobacteria. PgtE and other omptins require rough LPS for activity but are subject to steric inhibition by O antigens. pgtE expression is upregulated during growth of Salmonella inside macrophages, and bacteria released from macrophages exhibit strong PgtE-mediated proteolytic activity. PgtE proteolytically activates the mammalian plasma enzyme precursor plasminogen to plasmin, inactivates α2-antiplasmin factor, the main physiological inhibitor of plasmin, and mediates bacterial adhesion to the extracellular matrix of human cells. Thus, PgtE mediates the degradation of extracellular matrix components, generating potent localized proteolytic activity that can facilitate Salmonella migration through the extracellular matrix. PgtE also degrades alpha-helical antimicrobial peptides, which may be important during intracellular growth of Salmonella. Pla, the omputin of Yersinia pestis, is a close ortholog of PgtE and shares functions with it. Pla cleaves C3, and PgtE increases serum resistance of Salmonella by cleaving complement components C3b, C4b, and C5. The pgtE gene and its orthologs from other bacterial species can be included in the immunostimulatory bacteria herein to increase resistance to complement.
[0289] The effects of complement in human serum are shown herein to explain the failure of therapeutic immunostimulatory bacteria, such as Salmonella VNP20009, which has been shown to effectively colonize tumors in rodent models. Systemic administration of VNP20009 resulted in colonization of mouse tumors (see, e.g., Clairmont et al. (2000) J. Infect. Dis. 181:1996-2002; and Bermudez et al. (2001) Biotechnol. Genet. Eng. Rev. 18:219-33), but systemic administration of VNP20009 in human patients resulted in minimal colonization. In a phase 1 study of patients with advanced melanoma, only minimal VNP20009 was detected in human tumors after a 30-minute intravenous infusion (see Toso et al. (2002) J. Clin. Oncol. 20:142-52). Patients participating in a follow-up study evaluating a longer 4-hour infusion of VNP20009 also showed an absence of detectable VNP20009 after tumor biopsy (see Heimann et al. (2003) J. Immunother. 26:179-180). Following intratumoral administration, colonization of VNP20009 derivatives was detected (see Nemunaitis et al. (2003) Cancer Gene Ther. 10:737-744). Direct intratumoral administration of VNP20009 into human tumors resulted in much higher tumor colonization. This indicates that human tumors can be colonized at high levels and that differences in tumor colonization between mice and humans occur only after systemic administration.
[0290] Although not previously known to occur in wild-type S. typhimurium, VNP20009 is inactivated by human complement, which is described herein as explaining the low tumor colonization observed in humans upon systemic administration of VNP20009. The strains provided herein exhibit resistance to complement. They may be engineered to express Rck and other proteins involved in mediating complement resistance or evasion, such as Ail in Yersinia enterocolitica or PgtE in Salmonella typhimurium, or, if they naturally express such proteins, they may be engineered to overexpress Rck and / or other such proteins. Rck may also be introduced into bacteria lacking a homolog, such as Escherichia coli.
[0291] Rck expression Rck (resistance to complement killing) is a 17-kDa outer membrane protein encoded by the large virulence plasmid of Salmonella species, such as S. enteritidis and S. typhimurium, that induces adhesion to and invasion of epithelial cells. The Rck protein has been shown to protect S. enterica from complement by inhibiting C9 polymerization and the subsequent assembly of a functional membrane attack complex. Rck mutants exhibit a two- to three-fold reduction in epithelial cell invasion compared to wild-type strains, whereas overexpression of rck in wild-type strains results in increased invasion. The Rck protein induces cell invasion through receptor-mediated processes, promoting local actin remodeling, and weak and closely adherent membrane extensions. Thus, Salmonella can invade cells by two distinct mechanisms: the T3SS-1 complex-mediated Trigger mechanism and the rck-induced Zipper mechanism (see, e.g., Manon et al. (2012), Salmonella, Chapter 17, eds. Annous and Gurtler, Rijeka, pp. 339-364). Expression of rck on the Salmonella virulence plasmid confers high-level resistance to neutralization by human complement by preventing the formation of the membrane attack complex. When an rck-containing S. typhimurium virulence plasmid was expressed in a highly serum-susceptible strain of Escherichia coli, Rck was able to restore complement resistance.
[0292] The immunostimulatory bacteria provided herein carry or are provided with Rck to confer resistance to human complement. It is shown herein that immunostimulatory bacteria, such as E. coli, can be modified by encoding rck on a plasmid within the bacteria, thereby conferring resistance to complement. The immunostimulatory bacteria provided herein endogenously encode rck or can be modified to encode it to increase resistance to complement. Methods for conferring resistance to complement are also provided. For example, therapeutic E. coli strains described in U.S. Patent Application Publication Nos. 2018 / 0325963 and 2018 / 0273956 and U.S. Patent Nos. 9,889,164 and 9,688,967 can be improved by modifying the bacteria therein, for example, by introducing a nucleic acid encoding a Salmonella rck gene onto a plasmid therein, thereby improving or providing resistance to complement. Bacteria that are resistant to complement can be administered systemically, and enough bacteria can survive to be therapeutically effective. Nucleic acid encoding the Salmonella rck gene is introduced into bacteria, such as therapeutic E. coli, thereby conferring or increasing complement resistance.
[0293] Similarly, other orthologs and homologs of rck from other bacterial species can be expressed in immunostimulatory bacteria. For example, Ail is an Rck homolog from Yersinia enterocolitica, which enhances complement resistance upon heterologous expression. PgtE is a surface protease from S. typhimurium that has also been shown to enhance complement resistance upon heterologous expression.
[0294] 8. Deletion of genes required for lipoprotein expression in Salmonella and other Gram-negative bacteria LPS and brown (murein) lipoprotein (Lpp) are major components of the outer membrane of Gram-negative enterobacteria, functioning as potent stimulators of inflammation and immune responses. Brown (murein) lipoprotein (Lpp) is one of the most abundant components of the outer membrane of S. typhimurium, leading to TLR2 induction of pro-inflammatory cytokines, such as TNFα, IL-6, and IL-8 (human). Two functional copies of the lipoprotein gene [lppA (SEQ ID NO: 387) and lppB (SEQ ID NO: 388)] located on the bacterial chromosome of Salmonella contribute to bacterial pathogenicity. Deletion of the lppA and lppB genes, as well as elimination of lipoprotein expression, reduces virulence and reduces pro-inflammatory cytokine production (see, e.g., Sha et al. (2004) Infect. Immun. 72(7):3987-4003; Fadl et al. (2005) Infect. Immun. 73(2):1081-1096). Deletion of the Lpp genes would be predicted to reduce infection of cells and therefore reduce plasmid delivery and expression of the encoded therapeutic product or protein. However, as shown in Example 18 below, while deletion of these genes reduced tumor colonization, the amount of plasmid delivered to targeted cells, i.e., tumor-resident immune cells, particularly macrophages, was significantly increased. Thus, deletion or disruption of these genes (lppA and lppB), as shown herein, resulted in reduced virulence due to the inability to survive within infected macrophages, but increased delivery of immunostimulatory bacterial plasmids, thereby increasing expression of the encoded therapeutic genes in targeted cells, i.e., tumor-resident immune cells, particularly macrophages.
[0295] 9. Robust, immunostimulatory bacteria whose genomes have been engineered to be optimized for antitumor therapy and encode therapeutic products, including multiple As described herein, bacterial strains, such as S. typhimurium strains, that have been engineered to be adenosine auxotrophic and that have had their ability to induce pro-inflammatory cytokines reduced by modifying LPS and / or deleting flagellin, and / or that have been modified to improve T cell function by deleting or ablating L-asparaginase II expression, and / or that have been modified by deleting or disrupting genes required for biofilm formation, and / or that exhibit enhanced human serum survival by increasing rck expression, have been further modified to deliver therapeutic products, such as immunomodulatory proteins, and promote robust anti-tumor immune responses.
[0296] The table below provides an overview of the bacterial genotypes / modifications, their functional effects, and some of the effects / benefits achieved herein.
[0297] [Table 6]
[0298] The strains provided herein are ΔFLG, and / or ΔpagP, and / or ΔansB, and / or ΔcsgD. Additionally, the strains are one or more of ΔpurI (ΔpurM), ΔmsbB, and Δasd (bacterial genome). In particular, the strains are ΔpurI (ΔpurM), ΔmsbB, ΔpagP, and ΔansB, and Δasd. The strains are lppA - and / or lppB - , especially lppA - / lppB -The plasmid may be modified to encode a therapeutic product under the control of a promoter recognized by the host (e.g., a eukaryotic promoter, including those derived from eukaryotes and animal viruses, such as an RNA polymerase II promoter). The plasmid may encode an asd to enable bacterial replication in vivo, may encode a nucleic acid having other beneficial functions (e.g., CpG), or may encode a gene product, as described elsewhere herein.
[0299] The immunostimulatory bacteria provided herein can be modified to eliminate their ability to infect epithelial cells, for example, by eliminating flagella. As described elsewhere herein, eliminating the ability to infect epithelial cells can also be achieved by inactivating SPI-1-dependent invasion through the inactivation or knockout of one or more genes involved in the SPI-1 pathway. These genes include, but are not limited to, one or more of avrA, hilA, hilD, invA, invB, invC, invE, invF, invG, invH, invI, invJ, iacP, iagB, spaO, spaP, spaQ, spaR, spaS, orgA, orgB, orgC, prgH, prgI, prgJ, prgK, sicA, sicP, sipA, sipB, sipC, sipD, sirC, sopB, sopD, sopE, sopE2, sprB, and sptP. Additionally or alternatively, the immunostimulatory bacteria can contain gene knockouts or deletions that inactivate products involved in SPI-1-independent infection / invasion, such as one or more of the following genes: fljB, fliC, rck, pagN, hlyE, pefI, srgD, srgA, srgB, and srgC; and / or the immunostimulatory bacteria can contain knockouts or deletions that inactivate products of genes that induce cell death of tumor-resident immune cells, such as genes encoding proteins directly recognized by inflammasomes, including fljB, fliC, prgI (needle protein), and prgJ (rod protein). However, the rck gene is preferred because it protects against inactivation by complement. Bacteria that do not endogenously encode rck can be modified to encode a heterologous rck gene.
[0300] The immunostimulatory bacteria are derived from suitable bacterial strains. The bacterial strains may be attenuated strains, or strains attenuated by standard methods or by modifications provided herein such that their colonization ability is primarily restricted to immune-privileged tissues and organs, particularly tumor-resident immune cells, TME, and tumor cells, including solid tumors. Bacteria include, but are not limited to, strains of the genera Salmonella, Shigella, Listeria, Escherichia coli, and Bifidobacteria. For example, bacterial species include Shigella sonnei, Shigella flexneri, Shigella dysenteriae, Listeria monocytogenes, Salmonella typhi, Salmonella typhimurium, Salmonella gallinarum, and Salmonella enteritidis. Other suitable bacterial species include Rickettsia, Klebsiella, Bordetella, Neisseria, Aeromonas, Francisella, Corynebacterium, Citrobacter, Chlamydia, Haemophilus, Brucella, Mycobacterium, Mycoplasma, Legionella, Rhodococcus, Pseudomonas, Helicobacter, Vibrio, Bacillus, and Erysipelothrix.For example, Rickettsia rickettsii, Rickettsia typhi, and Rickettsia tsutsugamushi. tsutsugamuchi), Typhus Rickettsia, Rickettsia sibirica, Bordetella bronchiseptica, Neisseria meningitidis, Neisseria gonorrhoeae, Aeromonas eucleophila, Aeromonas salmonicida, Francisella tularensis, Yersinia ovis, Citrobacter freundii, Chlamydia pneumoniae, Haemophilus somnus, Brucella abortus, Mycobacterium intracellulare, Legionella pneumophila, Rhodococcus equi, Pseudomonas aeruginosa, Helicobacter mustelae, Vibrio cholerae, Bacillus subtilis, Erysipelothrix rhusiopathiae, Yersinia enterocolitica, Roshalimea quintana, and Agrobacterium tumefaciens tumerfacium).
[0301] Examples of immunostimulatory bacteria provided herein include species of the genus Salmonella. Examples of bacteria for modification as described herein include strains having all of the identifying characteristics of wild-type strains of Salmonella, such as the strain deposited with the American Type Culture Collection (ATCC) under accession number 14028. Engineered strains of Salmonella typhimurium, such as strain YS1646 (ATCC catalog number 202165, also referred to as VNP20009; see also International PCT Application Publication No. WO 99 / 13053), are engineered with a plasmid that complements the asd gene knockout and allows antibiotic-free plasmid maintenance. The strain is then modified to delete the flagellin gene and / or to delete pagP. The combination of flagellum knockout and pagP deletion renders the strain highly resistant to human serum complement. The strain is made auxotrophic for purines, particularly adenosine, and the asd gene is then deleted. - And msbB -As shown, strains with complete deletions of purI and msbB are more fit (grow faster) than strain VNP20009. In strain VNP20009, these genes are not deleted but rather modified to eliminate expression. The asd gene can be provided on a plasmid for in vivo replication in a eukaryotic host. Strains also have modifications, such as deletions, disruptions, or other modifications, in the ansB gene that prevent them from producing immunosuppressive L-asparaginase II and improve tumor T cell function. Strains have also been modified to eliminate biofilm production, for example, by deleting csgD, which prevents them from producing curli pili, cellulose, and c-di-GMP, thereby reducing undesirable inflammatory responses and preventing them from forming biofilms.
[0302] These genomic deletions and plasmids are described and exemplified elsewhere herein. Any nucleic acid encoding a therapeutic product, such as an immune stimulatory protein or other product, described elsewhere herein and / or known to those skilled in the art can be included on the plasmid. As described elsewhere herein, the plasmid is generally present at low to moderate copy number. Therapeutic products include gain-of-function mutants of cytoplasmic DNA / RNA sensors that can constitutively induce / induce type I IFN expression, as well as other immune stimulatory proteins, such as cytokines, chemokines, and costimulatory molecules, that promote anti-tumor immune responses in the tumor microenvironment, and other such products described herein. Plasmids can also encode antibodies and fragments thereof, such as single-chain antibodies, that target immune checkpoints and other cancer targets, such as VEGF, IL-6, and TGF-β, as well as other molecules, such as bispecific T cell engagers or BiTEs®. Plasmids can also encode IL-6-binding decoy receptors, TGF-beta-binding decoy receptors, and TGF-beta polypeptide antagonists. As described below, the plasmid can encode one or more (i.e., multiplex) of multiple therapeutic products / genetic payloads for delivery of anti-cancer therapeutic products to the tumor / tumor microenvironment. The products can be operably linked to a trafficking signal, such as a signal for secretion. The products can be designed for cell surface expression, for example, in tumor-resident myeloid cells.
[0303] 10. Conversion of M2 phenotype macrophages to M1 and M1-like phenotype macrophages As described herein, the immunostimulatory bacteria provided herein grow in and / or target macrophages. Macrophages are phagocytic immune cells that play a role in the elimination of senescent and apoptotic cells, the phagocytosis of immune-related complexes and pathogens, and the maintenance of homeostasis. The phenotype and function of macrophages can be polarized by the microenvironment. There are two types: M1 type (classically activated macrophages) and M2 type (alternatively activated macrophages).
[0304] The role of M1 macrophages is to secrete pro-inflammatory cytokines and chemokines, present antigens, and thus participate in positive immune responses and function as immune monitors. M1 macrophages produce pro-inflammatory cytokines, including IL-6, IL-12, and TNF-α. M2 macrophages secrete arginase 1, IL-10, TGF-β, and other anti-inflammatory cytokines, which reduce inflammation and contribute to tumor growth and immunosuppressive functions. Therefore, M1 or M1-like phenotypes are advantageous for the treatment of cancer and other such diseases and disorders.
[0305] M2 macrophages can be converted into M1 macrophages or macrophages with an M1-like phenotype. The immunostimulatory bacteria provided herein can infect macrophages and convert M2 macrophages to an M1 or M1-like phenotype. Phenotypic markers of M1 macrophages include CD80 (also known as B7, B7.1, or B1), CD86 (also known as B7.2), CD64 (also known as high-affinity immunoglobulin gamma Fc receptor I), CD16, and CD32 (also known as low-affinity immunoglobulin gamma Fc receptor IIb). Expression of nitric oxide synthase (iNOS) in M1 macrophages can also serve as a phenotypic marker. CD163 and CD206 are markers for identifying M2 macrophages. Arginase 1 (Arg1) and Dectin-1 are also ideal phenotypic indicators for identifying M2 macrophages. Therefore, conversion can be monitored or assessed by the expression of these markers.
[0306] Tumor-associated macrophages (TAMs) are associated with an immunosuppressive M2 phenotype. The immunostimulatory bacteria provided herein can convert such macrophages to an M1 or M1-like phenotype. The immunostimulatory bacteria provided herein, encoding a therapeutic product that results in the expression of type I interferon (IFN), can induce such conversion. This is a unique property of the immunostimulatory bacteria provided herein, leveraging the ability of bacteria to contain genomic modifications that result in infection of macrophages. The encoded therapeutic products include those that are part of a cytoplasmic DNA / RNA sensor pathway, such as STING mutants (described in detail herein). The encoding immunostimulatory bacteria can induce conversion of tumor-resident macrophages to an M1 phenotype (or an M1-like phenotype) upon infection and expression of the therapeutic product. This ability to convert macrophage phenotype is demonstrated and exemplified in Example 12 below. Expression of modified STING protein by the immunostimulatory bacteria provided herein that infect macrophages and express STING protein converts the phenotype of M1 macrophages to M2 macrophages.
[0307] Immunostimulatory bacteria provided herein containing genomic modifications as described herein, such as flagellum removal and LPS modification, convert infected M2 macrophages into those that induce the cytokine profile of M1 macrophages. Immunostimulatory bacteria expressing a mutant STING protein that results in constitutive type I IFN expression in human primary M2 macrophages convert these cells into type I IFN-producing cells that are M1-like (have phenotypic markers and / or expression profile typical of M1 macrophages).
[0308] The examples demonstrate this shift from M2 to an M1-like or M1 phenotype. Comparing the cytokine profile in uninfected M2 macrophages with that induced in M2 macrophages infected with a Δasd / ΔFLG / ΔpagP / ΔansB / ΔcsgD Salmonella strain, M2 induced high levels of IFNγ, CXCL10, and CXCL11 secretion. Infection with the same strains transformed with plasmids encoding the huSTING tazCTT N154S + R284G mutant, WT huIL-12, and huSTING tazCTT N154S + R284G mutant, or WT huIL-15 induced higher levels of CXCL10 and CXCL11 secretion than the non-transformed ΔFLG / ΔpagP / ΔansB / ΔcsgD strain that did not contain the plasmid. Cytokine profiles characteristic of an M1 or M1-like phenotype were induced in these strains using various payloads. Exemplary results are detailed in the Examples.
[0309] D. Immunostimulatory bacteria with enhanced therapeutic index that encode genetic payloads that stimulate immune responses in the tumor microenvironment The immunostimulatory bacteria provided herein are engineered to accumulate within the tumor microenvironment and tumor-resident myeloid cells, where a therapeutic product is expressed under the control of a eukaryotic promoter. The bacteria encode therapeutic products, particularly anti-cancer products, including products that stimulate the immune system and / or products that reverse or alleviate the immunosuppressive effects of tumors. As described herein, the bacteria may encode multiple products, with each product's expression under the control of a separate promoter or under the control of a single promoter, and may contain sequences that result in the expression of the separate products, and, where appropriate, regulatory sequences to ensure the secretion of the encoded products into the tumor microenvironment. The immunostimulatory bacteria express therapeutic products encoded on a plasmid. As previously mentioned, the plasmid may encode one or more products. Each product may be under the control of a different eukaryotic promoter, or multiple encoded products may be expressed under the control of a single promoter, such as by including a 2A self-cleaving peptide between the coding portions of T2A (SEQ ID NO: 327), P2A (SEQ ID NO: 328), E2A (SEQ ID NO: 329), and F2A (SEQ ID NO: 330). The encoded products include those described herein, and may be anti-cancer immunostimulatory products whose activities are complementary. The immunostimulatory bacteria provided herein enable the combined administration of multiple immunomodulatory products or payloads (multiple payloads) that would otherwise be excessively toxic if administered systemically. Examples of multiple payloads include one or more cytokine(s), an immunostimulatory protein for stimulating or inducing the expression of type I IFN, such as STING or a mutant thereof with increased activity or constitutively active, and a costimulatory molecule, such as an engineered 4-1BBL costimulatory molecule. Provided herein are modified 4-1BBL polypeptides, and encoding nucleic acids, that exhibit improved expression and activity when encoded on a plasmid within the immunostimulatory bacteria provided herein, which deliver the plasmid to bone marrow cells for expression under the control of the host's transcriptional and translational machinery.
[0310] The immunostimulatory bacteria provided herein have potent antitumor effects, including providing a cure, after IV administration of multiple or single-agent payloads. When administered systemically, the immunostimulatory bacteria infiltrate and concentrate within solid tumors, the TME, and tumor-resident myeloid cells, where the encoded therapeutic product is expressed and then delivered locally to the tumor microenvironment. Upon engulfment by tumor-resident myeloid cells (phagocytosis), the bacteria deliver a plasmid encoding a genetic payload, which enables ectopic, single- or multiple-payload expression in a tumor-specific manner.
[0311] 1. Immunostimulatory proteins The immunostimulatory bacteria herein can be modified to encode one or more immunostimulatory proteins that promote, induce, or enhance anti-tumor responses. As illustrated and described in the Examples, the order in which the encoding nucleic acids are arranged on the plasmid can improve overall expression, and modifications to the plasmid can improve the fitness of bacteria containing the protein-encoding plasmid.
[0312] The immunostimulatory protein can be encoded on a plasmid within the bacterium under the control of a eukaryotic promoter, such as a promoter recognized by RNA polymerase II, for expression in a eukaryotic subject, particularly a subject to which the immunostimulatory bacterium is to be administered, such as a human. In addition to the eukaryotic promoter, the nucleic acid encoding the immunostimulatory protein(s) can include other regulatory signals for expression or transport in the cell, such as for secretion or expression at the cell surface.
[0313] Immunostimulatory proteins are proteins that can promote, participate in, or enhance anti-tumor responses by subjects to which the immunostimulatory bacteria are administered in an appropriate environment, such as the tumor microenvironment (TME).Immunostimulatory proteins include, but are not limited to, cytokines, chemokines, and costimulatory molecules.These include, but are not limited to, cytokines such as IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, IL-23, IL-12p70 (IL-12p40+IL-12p35), IL-15 / IL-15R alpha chain complex, IL-36γ, GM-CSF, IFNα, IFNβ, IL-2 with reduced binding to IL-2Ra, and IL-2 modified to not bind to IL-2Ra; such as, but not limited to, CCL3, CCL4, CCL5, CXCL9, CXCL10, and CXCL11. chemokines, but are not limited to; and / or costimulatory molecules, such as, but not limited to, CD40, CD40L, OX40, OX40L, 4-1BB, 4-1BBL, 4-1BBL with a truncated or deleted cytoplasmic domain (4-1BBLΔcyt), members of the TNF / TNFR superfamily (e.g., CD27 and CD27L), and members of the B7-CD28 family [e.g., CD80, CD86, ICOS, and ICOS ligand (B7RP1)].
[0314] Other such immunostimulatory proteins known to those skilled in the art that can be used to treat tumors or that can promote, enhance, or otherwise increase or induce anti-tumor responses are contemplated for encoding within the immunostimulatory bacteria provided herein. For example, the immunostimulatory bacteria can deliver a genetic payload encoding a truncated costimulatory molecule (e.g., 4-1BBL, CD80, CD86, CD27L, B7RP1, and OX40L) with a complete or partial cytoplasmic domain deletion for expression on APCs, where the truncated gene product can constitutively transmit immunostimulatory signaling to T cells via costimulatory receptor engagement, but cannot transmit counterregulatory signaling to APCs due to the deletion or truncation of the cytoplasmic domain. As described elsewhere herein, the modified truncated cytoplasmic domain, for example, of 4-1BBL, contains specific residues to ensure proper orientation of the protein domain, which increases protein expression. As described herein, deletion (full or partial) and modification of the cytoplasmic domain of a costimulatory molecule enhances costimulatory molecule activation without immunosuppressive counter-signaling. This is exemplified for 4-1BBL in the Examples and as described below; the same modifications, including substitution of residues within the truncated cytoplasmic domain to ensure proper orientation within the membrane, can be applied to any costimulatory molecule, as well as other transmembrane polypeptides.
[0315] The full length sequence of human 4-1BBL (SEQ ID NO: 389, see also Uniprot P41273) is: [ka] where the cytoplasmic domain corresponds to amino acids 1-28 (italics), the transmembrane domain corresponds to amino acids 29-49 (bold), and the extracellular domain corresponds to amino acids 50-254 (underlined). The human 4-1BBLΔcyt sequence (see SEQ ID NO: 390) is: [ka] which is the same as the full-length protein but is missing the cytoplasmic domain, such that the transmembrane domain corresponds to amino acid residues 2-22 (bold) and the extracellular domain corresponds to amino acid residues 23-227 (underlined).
[0316] An exemplary human 4-1BBL with a truncated cytoplasmic domain is: [ka] (see SEQ ID NO: 391), in which the truncated cytoplasmic domain corresponds to residues RVLP with the first M (italicized), the transmembrane domain corresponds to residues 6-26 (bold), and the extracellular domain corresponds to residues 27-231 (underlined).
[0317] In full-length 4-1BBL, positively charged amino acids such as R and K tend to be located in the cytoplasm (internal / cytoplasmic domain), thereby orienting the transmembrane domain so that the N-terminus is internal. However, when the cytoplasmic domain is truncated, this alters the charge balance so that positive charges are only present on the exterior (extracellular domain). This favors a configuration in which the N-terminus of the protein faces outward rather than toward the cytoplasm, resulting in an "inside-out configuration." If this is observed, for example, by lower apparent activity or expression or other parameters, 4-1BBL mutants with truncated cytoplasmic domains can be modified to contain positively charged residues to ensure proper orientation of the protein within the cell membrane upon expression. Examples of possible modifications of 4-1BBL are modifications in which residues are replaced with positively charged residues or modifications that include a c-myc tag. Those skilled in the art can envision other similar substitutions / additions to achieve the same result.
[0318] Exemplary modified human 4-1BBL variants with truncated cytoplasmic domains include the following, in which extra positive residues (arginine (R), lysine (K), in italics) are included in the cytoplasmic domain region as follows, so that the resulting protein is properly oriented (has the correct configuration and not the "inside-out" configuration) when expressed in cells. See SEQ ID NOs: 391 and 392, respectively: Truncated cytoplasmic domain: [ka] This adds a positive charge back to the N-terminus (R), which favors a configuration in which the N-terminus is correctly oriented in the cytoplasm. In another example, a MYC tag is added. Truncated cytoplasmic domain with MYC tag: [ka]
[0319] See Example 19 below for the sequence of full-length mouse 4-1BBL, as well as exemplary sequences of mu4-1BBLΔcyt (murine 4-1BBL with a cytoplasmic domain deletion), mu4-1BBL with a truncated cytoplasmic domain, and mu4-1BBL with a truncated cytoplasmic domain and a MYC tag; also see SEQ ID NOs: 393-396, respectively.
[0320] Additional or alternative amino acid substitutions may be included in the costimulatory molecule to ensure proper orientation of the expressed protein within the membrane. One skilled in the art can readily prepare other similar modifications to ensure proper orientation of transmembrane proteins with truncated cytoplasmic domains.
[0321] In addition to deleting or truncating the cytoplasmic domain, costimulatory molecules (e.g., 4-1BBL, CD80, CD86, CD27L, B7RP1, and OX40L) for expression on APCs can also be modified by introducing amino acid modifications, such as insertions, deletions, and / or substitutions, into the cytoplasmic domain so that the modified gene product can constitutively transmit immunostimulatory signaling to T cells through engagement of costimulatory receptors and cannot transmit counterregulatory signals to APCs due to the modification of the cytoplasmic domain. For example, immunosuppressive reverse (intracellular) signaling can be eliminated by modifying the phosphorylation sites in the cytoplasmic domain, such as by replacing one or more Ser residues at the appropriate locus or loci with residues that reduce or eliminate reverse signaling. For example, for human 4-1BBL, immunosuppressive reverse (intracellular) signaling can be eliminated by modifying the cytoplasmic domain phosphorylation sites, including Ser5 and Ser8, with respect to the sequence of full-length human 4-1BBL (SEQ ID NO: 389). The serine residue in the cytoplasmic domain can be substituted with any other residue that reduces or eliminates reverse signaling.
[0322] Additional or alternative amino acid substitutions can be included in the costimulatory molecule to abolish immunosuppressive intracellular (reverse) signaling. One skilled in the art can readily prepare other similar modifications to abolish immunosuppressive reverse signaling while still maintaining the ability of the costimulatory molecule to activate constitutive immunostimulatory signaling to T cells via engagement of costimulatory receptors.
[0323] a. Cytokines and chemokines In some embodiments, the immunostimulatory bacteria herein are engineered to express cytokines to stimulate the immune system, including, but not limited to, IL-2, IL-7, IL-12, IL-12p70 (IL-12p40 + IL-12p35), IL-15 (and the IL-15:IL-15R alpha chain complex), IL-18, IL-21, IL-23, IL-36γ, IL-2 with reduced binding to IL-2Ra, IL-2 modified to not bind to IL-2Ra, IFN-α, and IFN-β. Cytokines stimulate immune effector cells and stromal cells at tumor sites and enhance the recognition of tumor cells by cytotoxic cells. In some embodiments, the immunostimulatory bacteria can be engineered to express chemokines such as, for example, CCL3, CCL4, CCL5, CXCL9, CXCL10, and CXCL11.
[0324] IL-2 Interleukin-2 (IL-2), the first cytokine approved for the treatment of cancer, has been implicated in activating the immune system through several mechanisms, including activating and promoting the growth of cytotoxic T lymphocytes (CTLs), generating lymphokine-activated killer (LAK) cells, promoting the growth and proliferation of Treg cells, stimulating tumor-infiltrating lymphocytes (TILs), and promoting the proliferation and differentiation of T cells, B cells, and NK cells. Recombinant IL-2 (rIL-2) has been approved by the FDA for the treatment of metastatic renal cell carcinoma (RCC) and metastatic melanoma (see, e.g., Sheikhi et al. (2016) Iran J. Immunol. 13(3):148-166).
[0325] IL-7 IL-7, a member of the IL-2 superfamily, has been implicated in T cell survival, proliferation, and homeostasis. Mutations in the IL-7 receptor have been shown to result in T cell loss and the development of severe combined immunodeficiency (SCID), highlighting the critical role IL-7 plays in T cell development. IL-7 is a homeostatic cytokine that provides continuous signals to resting naive and memory T cells and accumulates during lymphopenic states, resulting in an increase in both T cell proliferation and the diversity of the T cell repertoire. Compared to IL-2, IL-7 inhibits CD4 + FOXP3 + CD8 compared with regulatory T cells + It is selective for expanding T cells. Recombinant IL-7 has been shown to enhance antigen-specific T cell responses after vaccination and adoptive cell therapy in mice. IL-7 may also play a role in promoting T cell recovery after chemotherapy for hematopoietic stem cell transplantation. Early phase clinical trials in patients with advanced malignancies have demonstrated that recombinant IL-7 is administered at biologically active doses (i.e., circulating CD4 + T cell count and CD8 + IL-7 has been shown to be well tolerated at doses (at which T cell numbers increase three- to four-fold) and to have limited toxicity (see, e.g., Lee, S. and Margolin, K. (2011) Cancers 3:3856-3893). IL-7 has been shown to have antitumor effects in tumors such as glioma, melanoma, lymphoma, leukemia, prostate cancer, and glioblastoma, and in vivo administration of IL-7 in murine models resulted in reduced cancer cell growth. IL-7 has also been shown to enhance the antitumor effects of IFN-γ in rat gliomas and induce the production of IL-1α, IL-1β, and TNF-α by monocytes, which results in melanoma growth inhibition. Furthermore, administration of recombinant IL-7 after treatment of pediatric sarcoma resulted in enhanced immune recovery (see, e.g., Lin et al. (2017) Anticancer Research 37:963-968).
[0326] IL-12[IL-12p70(IL-12p40+IL-12p35)] Bioactive IL-12 (IL-12p70), which promotes cell-mediated immunity, is a heterodimer composed of p35 and p40 subunits, while IL-12p40 monomers and homodimers act as IL-12 antagonists. IL-12 secreted by antigen-presenting cells promotes IFN-γ secretion from NK cells and T cells, inhibits tumor angiogenesis, and stimulates the growth of NK cells, CD8 + T cells and CD4 + Activation and proliferation of T cells, naive CD4 + IL-12 enhances the differentiation of T cells into Th1 cells and promotes antibody-dependent cell-mediated cytotoxicity (ADCC) against tumor cells. IL-12 has been shown to exhibit antitumor effects in murine models of melanoma, colon cancer, breast cancer, and sarcoma (see, e.g., Kalinski et al. (2001) Blood 97:3466-3469; Sheikhi et al. (2016) Iran J. Immunol. 13(3):148-166; and Lee, S. and Margolin, K. (2011) Cancers 3:3856-3893).
[0327] IL-15 and IL-15:IL-15Rα IL-15 is structurally similar to IL-2, and while both IL-2 and IL-15 provide the initial stimulus for T cell proliferation and activation, IL-15 blocks IL-2-induced apoptosis, a process that leads to the elimination of stimulated T cells and the induction of T cell tolerance, limiting memory T cell responses and potentially limiting the therapeutic effectiveness of IL-2 alone. IL-15 also mediates the proliferation of memory CD8 T cells to maintain long-term antitumor immunity. + Supports T cell persistence and CD8 + It has demonstrated significant antitumor activity in a preclinical murine model in an antigen-independent manner through direct activation of effector T cells. +In addition to T cells, IL-15 is responsible for the development, proliferation, and activation of effector natural killer (NK) cells (see, e.g., Lee, S. and Margolin, K. (2011) Cancers 3:3856-3893; and Han et al. (2011) Cytokine 56(3):804-810).
[0328] IL-15 and IL-15 receptor alpha (IL-15Rα) are coordinately expressed by antigen-presenting cells such as monocytes and dendritic cells, and IL-15 mediates the expression of CD8 + IL-15Rβγ expressed on the surface of T cells and NK cells C The soluble IL-15:IL-15-Rα complex is trans-presented by the IL-15Rβγ receptor complex. C It has been shown that IL-15 modulates immune responses via complexes, and the biological activity of IL-15 has been shown to be increased 50-fold by administering it as a preformed complex of IL-15 with soluble IL-15Rα, which has an increased half-life compared to IL-15 alone. This significant increase in the therapeutic efficacy of IL-15 by pre-association with IL-15Rα has been demonstrated in murine tumor models (see, e.g., Han et al. (2011) Cytokine 56(3):804-810).
[0329] IL-18 IL-18 stimulates NK cells and CD8 + IL-18 induces the secretion of IFN-γ by T cells, enhancing their cytotoxicity. IL-18 also activates macrophages and promotes the production of Th1 helper CD4 + IL-18 has shown promising antitumor activity in several preclinical mouse models. For example, administration of recombinant IL-18 (rIL-18) inhibits CD4 +IL-18 resulted in the regression of melanoma or sarcoma in syngeneic mice via T cell activation and / or NK cell-mediated responses. Other studies have shown that the antitumor effects of IL-18 were mediated by IFN-γ and involved antiangiogenic mechanisms. Combining IL-18 with other cytokines, such as IL-12, or with costimulatory molecules, such as CD80, enhanced the IL-18-mediated antitumor effects. Phase I clinical trials in patients with advanced solid tumors and lymphomas demonstrated that administration of IL-18 was safe, resulted in immunomodulatory activity, increased serum IFN-γ and GM-CSF levels, and moderate clinical responses. Clinical trials have shown that IL-18 can be combined with other anti-cancer therapeutic agents, such as monoclonal antibodies, cytotoxic drugs, or vaccines (see, e.g., Fabbi et al. (2015) J. Leukoc. Biol. 97:665-675; and Lee, S. and Margolin, K. (2011) Cancers 3:3856-3893).
[0330] We found that an attenuated strain of Salmonella typhimurium engineered to express IL-18 inhibited subcutaneous (SC) tumor growth or lung metastasis in syngeneic mice without any toxic effects after systemic administration. Treatment with this engineered bacterium induced the accumulation of T cells, NK cells, and granulocytes in tumors, resulting in intratumoral production of cytokines (see, e.g., Fabbi et al. (2015) J. Leukoc. Biol. 97:665-675).
[0331] chemokines Chemokines are a family of small cytokines that mediate the migration of leukocytes to areas of injury or inflammation and are involved in mediating immune and inflammatory responses. Chemokines are classified into four subfamilies based on the position of cysteine residues within their sequences: XC-, CC-, CXC-, and CX3C-chemokine ligands, or XCLs, CCLs, CXCLs, and CX3CLs. Chemokine ligands bind to their cognate receptors and regulate the circulation, homing, and retention of immune cells, with each chemokine ligand-receptor pair selectively regulating a specific type of immune cell. Different chemokines attract different leukocyte populations, forming concentration gradients in vivo, and the attracted immune cells migrate down the gradient toward higher concentrations of chemokines (see, e.g., Argyle D. and Kitamura, T. (2018) Front. Immunol. 9:2629; and Dubinett et al. (2010) Cancer J. 16(4):325-335). Chemokines can improve antitumor immune responses by increasing immune cell infiltration into tumors and facilitating the migration of antigen-presenting cells (APCs) to tumor-draining lymph nodes, which prime naive T and B cells (see, e.g., Lechner et al. (2011) Immunotherapy 3(11):1317-1340). The immunostimulatory bacteria herein can be engineered to encode chemokines including, but not limited to, CCL3, CCL4, CCL5, CXCL9, CXCL10, and CXCL11.
[0332] CCL3, CCL4, CCL5 CCL3, CCL4, and CCL5 share a high degree of homology and bind to CCR5 (CCL3, CCL4, and CCL5) and CCR1 (CCL3 and CCL5) on several cell types, including immature DCs and T cells, in both humans and mice. Therapeutic T cells have been shown to induce chemotaxis of innate immune cells to tumor sites through tumor-specific secretion of CCL3, CCL4, and CCL5 (see, e.g., Dubinett et al. (2010) Cancer J. 16(4):325-335).
[0333] Induction of T helper cell type 1 (Th1) responses leads to the release of CCL3. In vivo and in vitro studies in mice indicate that CCL3 is chemotactic for both neutrophils and monocytes. Specifically, CCL3 can mediate the mobilization of myeloid progenitor cells (MPCs) from the bone marrow and has MPC regulatory and stimulatory effects. CCL3-transfected human ovarian cancer cells showed enhanced intratumoral T cell infiltration and macrophage infiltration, leading to improved antitumor responses, indicating that CCL3-mediated chemotaxis of neutrophils suppressed tumor growth. DCs transfected with the tumor antigen human melanoma-associated gene (MAGE)-1, recruited by CCL3, exhibited superior antitumor effects in a mouse melanoma model, including increased lymphocyte proliferation, cytolytic activity, and survival, as well as reduced tumor growth. The combined use of CCL3 and an antigen-specific platform against MAGE-1 has also been used to treat gastric cancer. Production of CCL3 by the highly immunogenic murine colon tumor, CT26, slowed tumor growth in vivo; this process was driven by the CCL3-dependent accumulation of natural killer (NK) cells and, therefore, IFNγ, resulting in the production of CXCL9 and CXLC10 (see, e.g., Allen et al. (2017) Oncoimmunology 7(3):e1393598; and Schaller et al. (2017) Expert Rev. Clin. Immunol. 13(11):1049-1060).
[0334] CCL3 has been used as an adjuvant for cancer treatment. Administration of the CCL3 active mutant, ECI301, after radiofrequency ablation in mouse hepatocellular carcinoma increased tumor-specific responses, and this mechanism was further shown to be dependent on CCR1 expression. CCL3 has also shown success as an adjuvant in systemic cancer, as mice vaccinated with CCL3 and IL-2 or granulocyte-macrophage colony-stimulating factor (GM-CSF) in leukemia / lymphoma models showed increased survival (see, e.g., Schaller et al. (2017) Expert Rev. Clin. Immunol. 13(11):1049-1060).
[0335] CCL3 and CCL4 upregulate CD8 in melanoma and colon cancer + It plays a role in directing T cell infiltration to the primary tumor site. Tumor production of CCL4 is associated with CD103 + Suppression of CCL4 by a WNT / β-catenin-dependent pathway leads to the accumulation of DCs; CD103 in melanoma tumors + CCL3 also prevented DC infiltration (see, e.g., Spranger et al. (2015) Nature 523(7559):231-235). CCL3 also inhibited CD4+ / CD5+ / CD6+ / CD8+ / CD9+ / CD10+ / CD11+ / CD12+ / CD13+ / CD14+ / CD15+ / CD16+ / CD17+ / CD18+ / CD19+ / CD20+ + T cells and CD8 + It has been shown to enhance T cell infiltration (see, for example, Allen et al. (2017) Oncoimmunology 7(3):e1393598).
[0336] Binding of CCL3 or CCL5 to their receptors (CCR1 and CCR5) induces the migration of immature DCs, monocytes, and memory and T effector cells from the circulation to sites of inflammation or infection. For example, CCL5 expression in colorectal tumors contributes to the chemoattraction and survival of T lymphocytes. CCL3 and CCL5 have been used alone or in combination therapy to induce tumor regression and immunity in several preclinical models. For example, studies have shown that subcutaneous injection of Chinese hamster ovary cells genetically modified to express CCL3 resulted in tumor inhibition and neutrophil infiltration. In another study, a recombinant oncolytic adenovirus expressing CCL5 (Ad-RANTES-E1A) resulted in primary tumor regression and blocked metastasis in a murine model of breast cancer (see, e.g., Lechner et al. (2011) Immunotherapy 3(11):1317-1340).
[0337] In translational studies of colorectal cancer, CCL5 induced an "antiviral response pattern" in macrophages. CCL5 is produced as a result of CXCR3-mediated migration of lymphocytes at the invasive margin of liver metastases in colorectal cancer. Blockade of the CCL5 receptor, CCR5, results in tumor death driven by macrophages producing IFN and reactive oxygen species. While macrophages reside within the tumor microenvironment, CCR5 inhibition induces a phenotypic shift from an M2 to an M1 phenotype. Blockade of CCR5 also results in clinical responses in colorectal cancer patients (see, e.g., Halama et al. (2016) Cancer Cell 29(4):587-601).
[0338] CCL3, CCL4, and CCL5 can be used to treat conditions including lymphoid tumors, bladder cancer, colorectal cancer, lung cancer, melanoma, pancreatic cancer, ovarian cancer, cervical cancer, or liver cancer (see, e.g., U.S. Patent Publication No. US2015 / 0232880; and International Application Publication Nos. WO2015 / 059303, WO2017 / 043815, WO2017 / 156349, and WO2018 / 191654).
[0339] CXCL9, CXCL10, CXCL11 CXCL9 (MIG), CXCL10 (IP10), and CXCL11 (ITAC) are induced by the production of IFN-γ. These chemokines bind to CXCR3, which is predominantly expressed on activated T cells, and function both in angiogenesis suppression and in leukocyte recruitment and activation. The prognosis in colorectal cancer is related to the level of tumor-infiltrating T cells, particularly Th1 and CD8. + High intratumoral expression of CXCL9, CXCL10, and CXCL11 strongly correlates with effector T cells; high expression of CXCL9, CXCL10, and CXCL11 indicates a favorable prognosis. For example, in a sample of 163 patients with colon cancer, patients with high levels of CXCL9 or CXCL11 showed increased postoperative survival, and patients with high CXC expression had significantly higher numbers of CD3 + T cells, CD4 + Helper T cells, and CD8 + In liver metastases from colorectal cancer patients, CXCL9 and CXCL10 levels were increased at the invasive margin and correlated with the density of effector T cells. Stimulation of lymphocyte migration through the action of CXCL9 and CXCL10 on CXCR3 leads to the production of CCL5 at the invasive margin (see, e.g., Halama et al. (2016) Cancer Cell 29(4):587-601; and Kistner et al. (2017) Oncotarget 8(52):89998-90012).
[0340] CXCL9 functions as a chemoattractant for tumor-infiltrating lymphocytes (TILs) in vivo and activates peripheral blood lymphocytes, natural killer (NK) cells, and Th1 lymphocytes. CXCL9 is also crucial for T cell-mediated suppression of skin tumors. For example, when combined with systemic IL-2, CXCL9 binds CXCR3 + It has been shown to inhibit tumor growth through increased intratumoral infiltration of mononuclear cells. In a murine model of colon cancer, the combination of huKS1 / 4-IL-2 fusion protein with CXCL9 gene therapy achieved a significant antitumor effect, inhibiting chemoattraction and CD8+ and CD4 + and extended lifespan via activation of T lymphocytes (see, e.g., Dubinett et al. (2010) Cancer J. 16(4):325-335; and Ruehlmann et al. (2001) Cancer Res. 61(23):8498-8503).
[0341] CXCL10, produced by activated monocytes, fibroblasts, endothelial cells, and keratinocytes, is chemotactic for activated T cells and can act as an inhibitor of angiogenesis in vivo. Expression of CXCL10 in colorectal tumors has been shown to contribute to the chemoattraction of cytotoxic T lymphocytes and longer survival. Administration of immunostimulatory cytokines, such as IL-12, has been shown to enhance the antitumor effects produced by CXCL10. Dendritic cell (DC) vaccines primed with tumor cell lysates and transfected with CXCL10 have enhanced immune protection and efficacy in mice; animals exhibited resistance to tumor challenge, slowed tumor growth, and longer survival. In vivo and in vitro studies in mice using a CXCL10-mucin-GPI fusion protein resulted in tumors with higher levels of recruited NK cells compared to tumors not treated with the fusion protein. Interferon (which can be produced by plasmacytoid dendritic cells; these cells are associated with primary melanoma lesions and can be recruited to the...
Claims
1. A nucleic acid construct comprising nucleic acids encoding multiple anti-cancer products as a polycistronic sequence under the control of a single promoter.
2. 2. The construct of claim 1, wherein the polycistronic sequence comprises a 2A peptide between each open reading frame (ORF) encoding each product.
3. 3. The construct of claim 1 or claim 2, wherein the anti-cancer product is a protein.
4. 4. The construct of claim 2 or claim 3, wherein the 2A peptide is one or more of T2A, P2A, E2A, or F2A.
5. The construct of any one of claims 1 to 4, wherein the encoded product is one or more immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment.
6. Immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment include IL-2, IL-7, IL-12p70 (IL-12p40 + IL-12p35), IL-15, IL-2 with reduced binding to IL-2Ra, IL-15 / IL-15R alpha chain complex, IL-18, IL-21, IL-23, IL-36γ, IL-2 modified to not bind to IL-2Ra, CXCL9, CXCL10, CXCL11, interferon α, interferon β, interferon γ, CCL3, CCL4, CCL5, and proteins involved in or related to the recruitment and / or persistence of T cells.
6. The construct of claim 5, wherein the target polypeptide is selected from one or more of: a protein that causes or enhances immunosuppression, CD40, CD40 ligand (CD40L), CD28, OX40, OX40 ligand (OX40L), 4-1BB, 4-1BB ligand (4-1BBL), 4-1BBL with a cytoplasmic domain deletion or truncation that abolishes immunosuppressive counter-signaling, a member of the B7-CD28 family, a CD47 antagonist, an anti-IL6 antibody or an IL-6-binding decoy receptor, a TGF beta polypeptide antagonist, and a member of the tumor necrosis factor receptor (TNFR) superfamily.
7. Immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment include IFN-α, IFN-β, GM-CSF, IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, IL-23, IL-12p70 (IL-12p40 + IL-12p35), IL-15 / IL-15R alpha chain complex, IL-36 gamma, IL-2 with reduced binding to IL-2Ra, IL-2 modified to not bind to IL-2Ra, CXCL9, CXCL10 (IP-10), CXCL11, CCL3, CCL4, CCL5, and other proteins that potentially recruit and / or inhibit T cells.
6. The construct of claim 5, wherein the construct is selected from one or more of: molecules involved in the progression and / or persistence of immunosuppression, CD40, CD40 ligand (CD40L), OX40, OX40 ligand (OX40L), 4-1BB, 4-1BB ligand (4-1BBL), 4-1BBL with a cytoplasmic domain deletion or truncation that abolishes immunosuppressive counter-signaling, a cytoplasmic domain deletion (4-1BBLΔcyt) or a partial cytoplasmic domain deletion, a member of the B7-CD28 family, and a member of the tumor necrosis factor receptor (TNFR) superfamily.
8. The construct of any one of claims 1 to 7, comprising a nucleic acid encoding 4-1BBL having a deletion or partial deletion of the cytoplasmic domain, or a partial deletion of the cytoplasmic domain, and optionally containing amino acid modifications, whereby the resulting 4-1BBL exhibits the appropriate orientation when expressed in a cell.
9. 9. The construct according to any one of claims 1 to 8, comprising a nucleic acid encoding a 4-1BBL variant having a deleted or partial deletion of the cytoplasmic domain or a modified 4-1BBL having a truncated and modified cytoplasmic domain, wherein the sequence of 4-1BBL is set forth in SEQ ID NO: 390, SEQ ID NO: 391, and SEQ ID NO:
392.
10. The following products and product combinations: one or more of IL-12, or IL-15, or IL12p70, or IL-15 / IL-15R alpha chain complex; Cytokine and stimulator of interferon genes (STING) pathway agonists; cytokines, STING pathway agonists, and costimulatory receptor ligands or immune checkpoint inhibitors; cytokines, STING pathway agonists, and TGF beta polypeptide antagonists; and cytokines, STING pathway agonists, TGF beta polypeptide antagonists, and costimulatory receptor ligands or immune checkpoint inhibitors; and a nucleic acid encoding any one of The construct of any one of claims 1 to 9, wherein the STING pathway agonist is any product that increases type I interferon expression through activation of the STING pathway.
11. 11. The construct of any of claims 1 to 10, comprising a nucleic acid encoding a stimulator of interferon genes (STING) polypeptide.
12. A combination of: anti-CTLA-4 antibody and STING polypeptide; IL-15 and STING polypeptides, 4-1BBL and STING polypeptides, TGF beta receptor decoy or antagonist polypeptide and STING polypeptide, IL-12 and STING polypeptides, anti-CTLA-4 antibody, IL-15, and STING polypeptide; 4-1BBL, IL-15, and STING polypeptides; TGF beta receptor decoy or antagonist polypeptides, IL-15, and STING polypeptides, anti-CTLA-4 antibody, IL-12, and STING polypeptide; 4-1BBL, IL-12, and STING polypeptides; TGF beta receptor decoy or polypeptide antagonist, IL-12, and STING polypeptide, anti-CTLA-4 antibodies, IL-15, TGFbeta receptor decoy or polypeptide antagonists, and STING polypeptides; 4-1BBL, IL-15, TGF beta receptor decoy or polypeptide antagonist, and STING polypeptide, anti-CTLA-4 antibodies, IL-12, TGFbeta receptor decoy or polypeptide antagonists, and STING polypeptides; 4-1BBL, IL-12, TGF beta receptor decoy or polypeptide antagonist, and STING polypeptide, anti-CTLA-4 antibodies, IL-12, IL-15, and STING polypeptides; 4-1BBL, IL-12, IL-15, and STING polypeptides; TGF beta receptor decoy or polypeptide antagonists, IL-12, IL-15, and STING polypeptides; TGF beta receptor decoy or polypeptide antagonists, IL-12, IL-15, and STING polypeptides; anti-CTLA-4 antibodies, IL-12, IL-15, TGFbeta receptor decoy or polypeptide antagonists, and STING polypeptides; 4-1BBL, IL-12, IL-21, TGF beta receptor decoy or polypeptide antagonist, and STING polypeptide, anti-CTLA-4 antibodies, IL-12, IL-15, and TGFbeta receptor decoys or polypeptide antagonists; 4-1BBL, IL-12, IL-21, and TGF beta receptor decoy or polypeptide antagonists; IL-12, IL-15, and STING polypeptides; IL-15, IL-21, and STING polypeptides; IL-12, IL-21, and STING polypeptides; anti-CTLA-4 antibodies, IL-15, IL-21, and STING polypeptides; anti-CTLA-4 antibodies, IL-12, IL-21, and STING polypeptides; 4-1BBL, IL-15, IL-21, and STING polypeptides; 4-1BBL, IL-12, IL-21, and STING polypeptides; anti-CTLA-4 antibody and IL-15, anti-CTLA-4 antibodies, IL-15, and TGFbeta receptor decoys or polypeptide antagonists; 4-1BBL and IL-15, 4-1BBL, IL-15, and TGF beta receptor decoy or polypeptide antagonists, anti-CTLA-4 antibody and IL-12, anti-CTLA-4 antibodies, IL-12, and TGFbeta receptor decoys or polypeptide antagonists; 4-1BBL and IL-12, 4-1BBL, IL-12, and TGF beta receptor decoy or polypeptide antagonists, anti-CTLA-4 antibodies and TGF-beta receptor decoy or polypeptide antagonists; 4-1BBL and TGF beta receptor decoy or polypeptide antagonists, IL-15 and TGFbeta receptor decoy or polypeptide antagonists, IL-12 and TGF beta receptor decoys or polypeptide antagonists, IL-12, IL-15 and TGF beta receptor decoy or polypeptide antagonists, and IL-15, IL-21, and TGFbeta receptor decoy or polypeptide antagonists; and a nucleic acid encoding a combination of therapeutic products selected from the group consisting of: 4-1BBL is 4-1BBL having a deleted cytoplasmic domain, 4-1BBL having a modified cytoplasmic domain, 4-1BBL having a truncated cytoplasmic domain, or 4-1BBL having a truncated and modified cytoplasmic domain; the anti-CTLA-4 antibody is an scFv or scFv-Fc; The STING polypeptide is a wild-type STING, or a variant STING polypeptide, or a chimeric STING polypeptide, or a chimeric STING polypeptide having an amino acid substitution; A construct according to any one of claims 1 to 11.
13. IL-2 and IL-12p70; IL-2 and IL-21; IL-2, IL-12p70, and STING gain-of-function (GOF) variants; IL-2, IL-21, and STING GOF variants; IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt), where Δcyt is a deletion of the cytoplasmic domain; IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα and STING GOF variants; IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα and IL-12p70; IL-15 / IL-15Rα and IL-21; IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; IL-15 / IL-15Rα, IL-21, and STING GOF variants; IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and IL-21; IL-12p70, IL-21, and STING GOF variants; IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and STING GOF variants; IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and IL-18; IL-12p70, IL-18, and STING GOF variants; IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-2, and IL-12p70; TGF-β decoy receptor or TGF-β polypeptide antagonists, IL-2 and IL-21; TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-2, IL-12p70, and STING GOF variants; TGF-β decoy receptor or TGF-β polypeptide antagonists, IL-2, IL-21, and STING GOF variants; TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-15 / IL-15Rα, and STING GOF variants; TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or TGF-β polypeptide antagonists, IL-15 / IL-15Rα, and IL-12p70; TGF-β decoy receptor or TGF-β polypeptide antagonists, IL-15 / IL-15Rα, and IL-21; TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; TGF-β decoy receptor or TGF-β polypeptide antagonists, IL-15 / IL-15Rα, IL-21, and STING GOF variants; TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-12p70, and IL-21; TGF-β decoy receptor or TGF-β polypeptide antagonists, IL-12p70, IL-21, and STING GOF variants; TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or TGF-β polypeptide antagonist and IL-12p70; TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-12p70, and STING GOF variant; TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-12p70, and IL-18; TGF-β decoy receptor or TGF-β polypeptide antagonists, IL-12p70, IL-18, and STING GOF variants; TGF-β decoy receptor or TGF-β polypeptide antagonist, IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or TGF-β polypeptide antagonist and STING GOF variant; anti-CTLA-4 antibody, IL-2, and IL-12p70; anti-CTLA-4 antibodies, IL-2, and IL-21; anti-CTLA-4 antibodies, IL-2, IL-12p70, and STING GOF variants; anti-CTLA-4 antibodies, IL-2, IL-21, and STING GOF variants; anti-CTLA-4 antibodies, IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and STING GOF variants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-15 / IL-15Rα, and IL-12p70; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and IL-21; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-21, and STING GOF variants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-12p70, and IL-21; anti-CTLA-4 antibodies, IL-12p70, IL-21, and STING GOF variants; anti-CTLA-4 antibodies, IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody and IL-12p70; anti-CTLA-4 antibodies, IL-12p70, and STING GOF variants; anti-CTLA-4 antibodies, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-12p70, and IL-18; anti-CTLA-4 antibodies, IL-12p70, IL-18, and STING GOF variants; anti-CTLA-4 antibodies, IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies and STING GOF variants; CD40 agonist, IL-2, and IL-12p70; CD40 agonist, IL-2, and IL-21; CD40 agonist, IL-2, IL-12p70, and STING GOF variants; CD40 agonist, IL-2, IL-21, and STING GOF variants; CD40 agonist, IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, and STING GOF variants; CD40 agonist, IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, and IL-12p70; CD40 agonists, IL-15 / IL-15Rα and IL-21; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; CD40 agonist, IL-15 / IL-15Rα, IL-21, and STING GOF variants; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-12p70, and IL-21; CD40 agonist, IL-12p70, IL-21, and STING GOF variants; CD40 agonist, IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist and IL-12p70; CD40 agonist, IL-12p70, and STING GOF variants; CD40 agonist, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-12p70, and IL-18; CD40 agonist, IL-12p70, IL-18, and STING GOF variants; CD40 agonists, IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); and CD40 agonists and STING GOF variants and encoding a therapeutic product combination selected from among 4-1BBL is 4-1BBL having a deleted cytoplasmic domain (4-1BBLΔcyt), 4-1BBL having a modified cytoplasmic domain, 4-1BBL having a truncated cytoplasmic domain, or 4-1BBL having a truncated and modified cytoplasmic domain; the anti-CTLA-4 antibody is an scFv or scFv-Fc; A construct according to any one of claims 1 to 11.
14. a chimeric polypeptide comprising a human STING polypeptide with a C-terminal tail (CTT) from various species, wherein the STING polypeptide has been modified to result in increased or constitutive expression of type I interferon (IFN), or has NF-κB signaling activity that is lower than the NF-κB signaling activity of human STING; The TRAF6 binding site of CTT may be deleted; The human STING protein has a sequence set forth in any one of SEQ ID NOs: 305 to 309; A construct according to any one of claims 1 to 13.
15. The construct of any one of claims 1 to 14, wherein the encoded therapeutic protein comprises IL-12p70, and Tasmanian devil-derived CTT and a chimeric human STING polypeptide having amino acid substitutions that result in increased or constitutive expression of type I interferon, or is a STING polypeptide having amino acid substitutions that result in increased or constitutive expression of type I interferon, and the mutations that result in increased or constitutive expression of type I interferon are gain-of-function (GOF) mutations.
16. The construct of claim 15, wherein the amino acid replacement in the STING polypeptide corresponds to R284G, with reference to any of SEQ ID NOs: 305 to 309 for alignment.
17. A construct described in any one of claims 11 to 16, wherein the STING polypeptide further comprises an N154S substitution.
18. The construct of any one of claims 1 to 17, comprising a nucleic acid encoding IL-36γ.
19. 19. The construct of any of claims 1 to 18, encoding an immune checkpoint inhibitor antibody or an antigen-binding portion thereof.
20. The construct of claim 19, wherein the immune checkpoint is CTLA-4, PD-1, or PD-L1.
21. The construct of any one of claims 1 to 20, wherein the encoded product is an antibody that is an scFv or an scFv-Fc two-chain polypeptide.
22. A plasmid comprising the construct of any one of claims 1 to 21.
23. 23. The plasmid of claim 22, which is a bacterial plasmid and wherein the construct is operably linked to a eukaryotic transcriptional regulatory sequence.
24. 24. The plasmid of claim 23, wherein the transcriptional regulatory sequence comprises a eukaryotic promoter.
25. A composition comprising a mixture of anti-cancer protein products encoded by the construct or plasmid of any one of claims 1 to 24.
26. An immunostimulatory bacterium comprising a construct or a plasmid according to any one of claims 1 to 24.
27. The resulting bacteria is msbB - / purI - 27. The immunostimulatory bacterium of claim 26, wherein the bacterial genome has been modified so that:
28. The bacteria is msbB - KatsupurI - and thereby msbB - and purI - 28. The immunostimulatory bacterium of claim 26 or claim 27, wherein at least the entire coding portion of the gene has been deleted.
29. The immunostimulatory bacterium of any one of claims 26 to 28, wherein the genome of the bacterium has been modified so that the bacterium has lost its flagella.
30. genomic modifications, whereby the bacterium - / pagap - The immunostimulatory bacterium according to any one of claims 26 to 29,
31. The bacterium contains a genome modification such that it does not express L-asparaginase II, thereby preventing the bacterium from expressing ansB. - The immunostimulatory bacterium according to any one of claims 26 to 30,
32. The bacterium contains a plasmid encoding multiple therapeutic products, and the bacterium is - KatsupurI - The bacterial genome has been modified so that msbB - and purI - An immunostimulatory bacterium in which at least the entire coding portion of a gene has been deleted.
33. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of the gene, whereby the bacterium does not activate the synthesis of secreted asparaginase.
34. The immunostimulatory bacterium of claim 33, wherein the asparaginase is L-asparaginase II encoded by the ansB gene.
35. have a genome modification whereby the bacterium has lost its flagellum and - , ansB - , and csgD - 35. The immunostimulatory bacterium of claim 34,
36. The immunostimulatory bacterium of claim 35, which is Δasd / ΔFLG / ΔpagP / ΔansB / ΔcsgD.
37. genomic modification, whereby the bacterium - The immunostimulatory bacterium according to any one of claims 33 to 36,
38. 38. The immunostimulatory bacterium of any of claims 33 to 37, which has a genomic modification whereby the bacterium is an adenosine auxotroph or an adenosine and adenine auxotroph.
39. genomic modification, whereby the bacterium - The immunostimulatory bacterium according to any one of claims 33 to 38,
40. The immunostimulatory bacterium of any one of claims 33 to 39, wherein the plasmid encodes aspartate semialdehyde dehydrogenase (asd).
41. purI - The immunostimulatory bacterium according to any one of claims 33 to 40,
42. 1. An immunostimulatory bacterium comprising a plasmid encoding multiple therapeutic products under the control of a eukaryotic promoter, the genome of an immunostimulatory bacterium has been modified by deletion or disruption of all or a sufficient portion of a gene, thereby modifying the bacterium to produce pentaacylated lipopolysaccharide (LPS); hexaacylated lipopolysaccharides are substantially reduced by at least 10-fold compared to wild-type bacteria or are absent; An immunostimulatory bacterium in which the plasmid encodes multiple complementary anti-cancer therapeutic products under the control of a single promoter, each of the complementary therapeutic products treating a different aspect of cancer or acting via a different mechanism, such that the combined effect is at least additive of the effect of each product individually.
43. 1. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, the genome of the immunostimulatory bacterium has been modified by deletion or disruption of all or a sufficient portion of a gene, thereby attenuating recognition of the bacterium by TLR2, TLR4, and TLR5; Immunostimulatory bacteria in which the plasmid encodes multiple complementary therapeutic products under the control of a single promoter.
44. 1. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, the genome of the immunostimulatory bacterium has been modified by deletion or disruption of all or a sufficient portion of a gene, such that the bacterium does not activate the synthesis of curli and / or cellulose; Immunostimulatory bacteria in which the plasmid encodes multiple complementary therapeutic products under the control of a single promoter.
45. 1. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of a gene, whereby the bacterium is auxotrophic for purines, adenosine, or ATP; the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of a gene, whereby the bacterium lacks flagella; An immunostimulatory bacterium in which the plasmid encodes multiple therapeutic products under the control of a single eukaryotic promoter.
46. an immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of a gene, thereby causing the bacterium to lose its flagellum; Immunostimulatory bacteria in which the plasmid encodes multiple therapeutic products under the control of a single promoter.
47. an immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of a gene, thereby modifying the bacterium to specifically infect tumor-resident myeloid cells; Immunostimulatory bacteria in which the plasmid encodes multiple therapeutic products under the control of a single promoter.
48. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of a gene, thereby modifying the bacterium to specifically infect tumor-resident myeloid cells and to be unable to replicate within the tumor-resident myeloid cells.
49. 1. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium comprises: a) deletion or disruption of all or a sufficient portion of the gene, whereby the bacterium is modified to produce pentaacylated lipopolysaccharide; the genome of an immunostimulatory bacterium is modified by deletion or disruption of all or a sufficient portion of a gene, thereby modifying the bacterium to produce pentaacylated lipopolysaccharide; deletion or disruption of hexaacylated lipopolysaccharide, such that it is substantially reduced to 10-fold or more or absent compared to wild-type bacteria; b) deletion or disruption of all or a sufficient portion of the gene, thereby attenuating recognition of the bacterium by one or more of TLR2, TLR4, and TLR5; c) deletion or disruption of all or a sufficient portion of the gene such that the bacterium does not activate the synthesis of curli and / or cellulose; d) deletion or disruption of all or a sufficient portion of the gene such that the bacterium does not activate the synthesis of secreted asparaginase; e) deletion or disruption of all or a sufficient portion of a gene, thereby rendering the bacterium auxotrophic for purines, adenosine, or ATP; f) deletion or disruption of all or a sufficient portion of the gene, thereby causing the bacterium to lose its flagellum; g) deletion or disruption of all or a sufficient portion of the gene, thereby modifying the bacterium to specifically infect tumor-resident myeloid cells; h) deletion or disruption of all or a sufficient portion of the gene, whereby the bacterium is modified to specifically infect tumor-resident myeloid cells and is unable to replicate within the tumor-resident myeloid cells; and i) Deletion or disruption of either or both lppA and lppB, which reduces or eliminates lipoprotein expression at the membrane, thereby increasing expression of the encoded therapeutic protein within the tumor microenvironment and / or in tumor-resident immune cells. An immunostimulatory bacterium comprising two or more modifications selected from the following:
50. 50. The immunostimulatory bacterium of claim 49, comprising modifications a), d), and f), or comprising modifications c) and d).
51. 50. The immunostimulatory bacterium of claim 49, comprising modifications a), c), d), e), and f).
52. 50. The immunostimulatory bacterium of claim 49, comprising modifications a), c), d), e), f), and i), or comprising modifications a), d), f), and i), or comprising modifications c), d), and i), or comprising modifications f) and i), or comprising modifications a) to i).
53. 50. The immunostimulatory bacterium of claim 49, comprising modifications a), b), d), and f), or comprising modifications a), b), c), and d).
54. The immunostimulatory bacterium of any one of claims 26 to 53, wherein lppA and lppB are deleted.
55. It has lost its flagellum and msbB - / pagap - 55. The immunostimulatory bacterium of any of claims 26 to 54, wherein the plasmid encodes a combination of two or more therapeutic proteins selected from among a costimulatory molecule, a cytokine, a STING pathway agonist, and an immune checkpoint inhibitor antibody.
56. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product, wherein infection of macrophages with the bacterium converts human M2 macrophages to M1 phenotype macrophages.
57. 1. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product, the immunostimulatory bacterium contains a modification in its genome that allows the bacterium to infect tumor-resident macrophages and not epithelial cells; Immunostimulatory bacteria, the expression of which in macrophages converts human M2 macrophages to an M1 or M1-like phenotype.
58. 58. The immunostimulatory bacterium of any of claims 26 to 57, comprising a plasmid encoding a therapeutic product, wherein expression of the therapeutic product in macrophages converts human M2 macrophages to an M1 or M1-like phenotype.
59. 59. The immunostimulatory bacterium of any one of claims 26 to 58, wherein the therapeutic product is part of a cytoplasmic DNA / RNA sensor pathway that leads to the expression of type I interferon (IFN).
60. 60. The immunostimulatory bacterium of claim 59, wherein expression of type I IFN is constitutive.
61. 61. The immunostimulatory bacterium of claim 59 or claim 60, wherein the therapeutic product is a gain-of-function (GOF) variant of a therapeutic product that is part of a cytoplasmic DNA / RNA sensor pathway, and wherein the GOF variant product does not require a cytoplasmic nucleic acid, nucleotide, dinucleotide, or cyclic dinucleotide to result in expression of type I IFN.
62. The immunostimulatory bacterium of any one of claims 26 to 61, wherein the therapeutic product is a variant STING protein.
63. The immunostimulatory bacterium of any one of claims 26 to 62, wherein infection with the bacterium converts human M2 macrophages into M1-like type I IFN-producing cells.
64. The wild-type bacteria have flagella, and the immunostimulatory bacteria have pagP. - / msbB - The immunostimulatory bacterium according to any one of claims 26 to 63,
65. 65. The immunostimulatory bacterium of any one of claims 26 to 64, wherein the immunostimulatory bacterium contains a genome modification whereby the bacterium has lost flagella and does not produce L-asparaginase II (ansB).
66. The immunostimulatory bacteria also have a genomic modification that causes the bacteria to express msbB. - And pagP - 66. The immunostimulatory bacterium of claim 65,
67. 67. The immunostimulatory bacterium of any one of claims 26 to 66, wherein the immunostimulatory bacterium has a genome modification whereby the bacterial phenotype conferred by the genome is Δasd / ΔFLG / ΔpagP / ΔansB / ΔcsgD or Δasd / ΔFLG / ΔpagP / ΔansB / ΔcsgD / ΔmsbB / ΔpurI, and the plasmid optionally encodes aspartate semialdehyde dehydrogenase (asd).
68. An immunostimulatory bacterium according to any one of claims 26 to 67, comprising a plasmid encoding a STING polypeptide.
69. The immunostimulatory bacterium of claim 68, wherein the STING polypeptide is a variant STING polypeptide that results in increased or constitutive expression of type I interferon.
70. The immunostimulatory bacterium of claim 69, wherein the STING polypeptide is a human chimeric STING polypeptide comprising a C-terminal tail (CTT) derived from Tasmanian devil STING.
71. The immunostimulatory bacterium of claim 69 or claim 70, wherein the STING polypeptide comprises a substitution corresponding to R284G, with reference to any of SEQ ID NOs: 305 to 309 for alignment.
72. 72. The immunostimulatory bacterium of claim 71, further comprising a substitution corresponding to N154S with reference to any of SEQ ID NOs: 305-309.
73. 73. The immunostimulatory bacterium of any of claims 26 to 72, comprising a plasmid encoding one or more of IL-12, IL-15, and IL-21.
74. The immunostimulatory bacterium of any one of claims 26 to 73, which is a Salmonella strain.
75. The immunostimulatory bacterium of any one of claims 26 to 74, wherein the therapeutic product is an anti-cancer therapeutic.
76. The immunostimulatory bacterium of any one of claims 26 to 75, wherein the bacterium encodes a therapeutic product that is an immunostimulatory protein.
77. 77. The immunostimulatory bacterium of claim 76, wherein the immunostimulatory protein is a stimulator of interferon genes (STING) protein, a modified STING protein, a cytokine, a chemokine, or a costimulatory receptor or ligand.
78. 78. The immunostimulatory bacterium of any one of claims 26 to 77, wherein the bacterium comprises a genome modification whereby the bacterium loses flagella.
79. The bacterium comprises a genomic modification whereby the bacterium contains pagP - or msbB - / pagap - The immunostimulatory bacterium according to any one of claims 26 to 78,
80. the bacterium comprises a genome modification whereby the bacterium does not express asparaginase or does not activate the synthesis of secreted asparaginase, and / or The genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of the ansB gene encoding L-asparaginase II, thereby rendering the bacterium - and does not express active L-asparaginase II; The immunostimulatory bacterium according to any one of claims 26 to 79.
81. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of csgD, thereby rendering the bacterium csgD-dependent. - and does not activate the synthesis of curli, an immunostimulatory bacterium.
82. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of the ansB gene encoding L-asparaginase II, thereby rendering the bacterium an ansB gene. - and does not express active L-asparaginase II.
83. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of the ansB gene encoding L-asparaginase II, and the deletion or disruption of all or a sufficient portion of the csgD gene, whereby the bacterium is - and does not express active L-asparaginase II, and csgD - and does not activate the synthesis of curli, an immunostimulatory bacterium.
84. Further included are deletions or disruptions of all or a sufficient portion of the gene encoding the flagellum, whereby the bacterium is capable of expressing flagellin. - (fliC - / fljB - 84. The immunostimulatory bacterium of any one of claims 26 to 83, which does not produce flagella, whereas wild-type bacteria have flagella.
85. 1. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by the deletion or disruption of all or a sufficient portion of the lppA and lppB genes which encode bacterial lipoproteins, whereby no lipoproteins are produced, and wherein the therapeutic product encoded on the plasmid is an anti-cancer therapeutic.
86. The genome of the immunostimulatory bacterium has been further modified by the deletion or disruption of all or a sufficient portion of the csgD gene, thereby rendering the bacterium csgD - or has another or additional modification in its genome that renders it impaired in biofilm formation.
87. The genome of the bacterium is further modified by the deletion or disruption of all or a sufficient portion of the gene, thereby rendering the bacterium csgD - / msbB - / pagap - The immunostimulatory bacterium according to any one of claims 82 to 86,
88. 88. The immunostimulatory bacterium of any of claims 82, 83, and 85-87, wherein the bacterium comprises a genome modification whereby the bacterium loses flagella.
89. It contains a genome modification that causes the bacterium to lose its flagellum, and lppA - / lppB - and csgD - or have lost their flagella, and ansB - and csgD - May also be immune stimulating bacteria.
90. The immunostimulatory bacterium of any one of claims 26 to 89, wherein the bacterium is auxotrophic for purines.
91. The immunostimulatory bacterium of any one of claims 26 to 89, wherein the bacterium is auxotrophic for adenosine.
92. 90. The immunostimulatory bacterium of any one of claims 26 to 89, which is auxotrophic for adenosine, adenine, and ATP.
93. The bacteria is purI - The immunostimulatory bacterium according to any one of claims 26 to 92,
94. Bacteria are pagP - The immunostimulatory bacterium according to any one of claims 26 to 93,
95. Bacteria are ASD - The immunostimulatory bacterium according to any one of claims 26 to 94,
96. Aspartate semialdehyde dehydrogenase - (asd - ), and the bacterium is aspartate semialdehyde dehydrogenase (asd) by disruption or deletion of all or part of the endogenous gene encoding aspartate semialdehyde dehydrogenase (asd). - 96. The immunostimulatory bacterium of any one of claims 26 to 95, wherein the endogenous asd is not expressed.
97. 97. The immunostimulatory bacterium of any one of claims 26 to 96, encoding aspartate semialdehyde dehydrogenase (asd) on a plasmid under the control of a bacterial promoter.
98. The bacteria is msbB - The immunostimulatory bacterium according to any one of claims 26 to 97,
99. genome modifications, whereby the bacterium is - , purI - , msbB - , flagellin - , and pagP - and the wild-type bacterium has flagella.
100. ASD - , csgD - , purI - , msbB - , flagellin - , and pagP - and the wild-type bacterium has flagella.
101. ansB - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), and pagP - and the wild-type bacterium has flagella.
102. Bacteria produce flagellin - (fliC - / fljB - 101. The immunostimulatory bacterium of any one of claims 96 to 100, wherein the wild-type bacterium has flagella.
103. The genome of the bacterium has been modified by the deletion or disruption of all or a sufficient portion of the lppA and / or lppB genes, thereby rendering the bacterium - and / or lppB - 103. The immunostimulatory bacterium of any of claims 26 to 102, wherein said plasmid-encoded therapeutic protein has increased expression in the tumor microenvironment and / or tumor-resident macrophages compared to the same immunostimulatory bacterium but with intact lppA and / or lppB.
104. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by deletion or disruption of all or a sufficient portion of the gene, thereby rendering the bacterium ansB. - , asd - , csgD - , purI - , msbB - , flagellin - , and pagP - and the wild-type bacterium has flagella.
105. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product under the control of a eukaryotic promoter, wherein the genome of the immunostimulatory bacterium has been modified by deletion or disruption of all or a sufficient portion of the ansB gene, thereby rendering the bacterium - , asd - , csgD - , purI - , msbB - , flagellin - and the wild-type bacterium has flagella and pagP - , an immune-stimulating bacterium.
106. Bacteria produce flagellin - (fliC - / fljB - 106. The immunostimulatory bacterium of claim 104 or claim 105, wherein said bacterium is
107. The genome of the bacterium contains further modifications, such that the bacterium contains ansB - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), pagP - , lppA - , and lppB - 107. The immunostimulatory bacterium of claim 105 or 106,
108. The immunostimulatory bacterium of any one of claims 26 to 107, wherein the therapeutic product is an anti-cancer therapeutic agent.
109. 109. The immunostimulatory bacterium of any one of claims 26 to 108, wherein the nucleic acid encoding the therapeutic product is operably linked to a nucleic acid encoding a secretion signal, whereby the therapeutic product is secreted when expressed.
110. The immunostimulatory bacterium of any one of claims 26 to 109, wherein one or more genes or operons involved in SPI-1 entry have been deleted or inactivated, such that the immunostimulatory bacterium does not invade or infect epithelial cells.
111. 111. The immunostimulatory bacterium of claim 110, wherein one or more of avrA, hilA, hilD, invA, invB, invC, invE, invF, invG, invH, invI, invJ, iacP, iagB, spaO, spaQ, spaR, spaS, orgA, orgB, orgC, prgH, prgI, prgJ, prgK, sicA, sicP, sipA, sipB, sipC, sipD, sirC, sopB, sopD, sopE, sopE2, sprB, and sptP are deleted or inactivated.
112. The immunostimulatory bacterium of any one of claims 26 to 111, wherein the plasmid is present at low or medium copy number.
113. The immunostimulatory bacterium of any one of claims 26 to 111, wherein the plasmid comprises a medium to low copy number origin of replication.
114. The immunostimulatory bacterium of any one of claims 26 to 111, wherein the plasmid comprises a low copy number origin of replication.
115. The immunostimulatory bacterium of any one of claims 26 to 111 and 114, wherein the plasmid is present in low copy number.
116. The immunostimulatory bacterium of any one of claims 26 to 111, wherein the plasmid is present at a copy number of 150 or less.
117. The immunostimulatory bacterium of any one of claims 26 to 111, wherein the plasmid is present in a copy number of more than 150.
118. The immunostimulatory bacterium of any one of claims 26 to 111, wherein the plasmid is present in high copy number.
119. 112. The immunostimulatory bacterium of any one of claims 26 to 111, wherein the plasmid is present at a moderate copy number, between 20 and 150 inclusive, or less than or about 150 and more than 20 or about 20, or between 20 and 150 copies.
120. The immunostimulatory bacterium of any one of claims 26 to 111, wherein the copy number of the plasmid is greater than 150.
121. 117. The immunostimulatory bacterium of claim 116, wherein the copy number of the plasmid is 150 copies or less, or 150 or less.
122. 116. The immunostimulatory bacterium of any of claims 26 to 115, wherein the plasmid is present in low copy number, said low copy number being less than 25 or less than 20, or less than about 25 or less than about 20 copies.
123. The immunostimulatory bacterium of any of claims 26 to 122, wherein the therapeutic product is a nucleic acid or a protein.
124. The immunostimulatory bacterium of claim 123, wherein the therapeutic product is a protein.
125. The immunostimulatory bacterium of any one of claims 26 to 124, wherein the plasmid encodes two or more therapeutic products.
126. The immunostimulatory bacterium of any one of claims 26 to 125, wherein the therapeutic product encoded on the plasmid is an anti-cancer treatment.
127. The immunostimulatory bacterium of any one of claims 26 to 126, wherein the bacterium encodes two or more products selected from a cytokine, a protein that constitutively induces type I IFN, and a costimulatory receptor or molecule.
128. The immunostimulatory bacterium of claim 127, wherein the costimulatory molecule is missing a cytoplasmic domain or has a modified and truncated cytoplasmic domain to ensure that the encoded costimulatory molecule is expressed in the correct orientation within the cell, or has a truncated cytoplasmic domain, thereby eliminating or reducing immunosuppressive counter-signaling.
129. 129. The immunostimulatory bacterium of any one of claims 26 to 128, wherein the nucleic acid encoding one or more of the therapeutic products comprises a nucleic acid encoding a signal for secretion of the therapeutic product from the bacterium or a cell containing the plasmid.
130. 130. The immunostimulatory bacterium of any one of claims 26 to 129, wherein the nucleic acid encoding the product on a plasmid is operably linked to a regulatory sequence recognized by the eukaryotic host.
131. 131. The immunostimulatory bacterium of any one of claims 26 to 130, wherein the immunostimulatory bacterium encodes two or more products, the expression of each product being under the control of a separate promoter, or all under the control of a single promoter, each product separated by a nucleic acid encoding a 2A peptide, such that separate translation of each encoded therapeutic product occurs.
132. 132. The immunostimulatory bacterium of claim 131, wherein the nucleic acid encodes a T2A, F2A, E2A, or P2A peptide to cause individual expression of therapeutic products expressed under the control of a single promoter.
133. The immunostimulatory bacterium of any one of claims 26 to 132, wherein the eukaryotic promoter is an RNA polymerase II promoter or an RNA polymerase III promoter.
134. 134. The immunostimulatory bacterium of claim 133, wherein the promoter is an RNA polymerase II promoter that is a viral promoter or a mammalian RNA polymerase II promoter.
135. 135. The immunostimulatory bacterium of claim 134, wherein the promoter is a viral promoter selected from among a cytomegalovirus (CMV) promoter, an SV40 promoter, an Epstein-Barr virus (EBV) promoter, a herpesvirus promoter, and an adenovirus promoter.
136. 135. The immunostimulatory bacterium of any of claims 26 to 134, wherein the promoter controlling the expression of one or more therapeutic products or heterologous proteins encoded on the plasmid is the elongation factor 1 (EF-1) alpha promoter, or the MND promoter, or the UBC promoter, or the PGK promoter, or the CAG promoter.
137. 135. The immunostimulatory bacterium of any of claims 26 to 134, wherein the promoter controlling expression of one or more of the therapeutic products or heterologous proteins encoded on the plasmid is an EF-1 alpha, adenovirus 2 or 5 late, CMV, SV40, MND, PGK, EIF4A1, CAG, or CD68 promoter.
138. An immunostimulatory bacterium according to any one of claims 26 to 134, wherein the promoter controlling expression of one or more therapeutic products or heterologous proteins encoded on the plasmid is a viral promoter that is a late promoter.
139. 139. The immunostimulatory bacterium of any of claims 26 to 138, wherein the plasmid comprises regulatory sequences, including terminators and / or promoters, controlling expression of the therapeutic product selected from among SV40, hGH, BGH, MND, chicken β-globin, and rbGlob (rabbit globin) genes.
140. 140. The immunostimulatory bacterium of any one of claims 26 to 139, wherein the encoded therapeutic product is operably linked to a signal sequence for secretion from cells containing the plasmid.
141. The immunostimulatory bacterium of any of claims 26 to 140, wherein the plasmid encoding the therapeutic product comprises a construct comprising an enhancer, a promoter, an open reading frame encoding the therapeutic product or a heterologous protein, and a polyA tail.
142. The immunostimulatory bacterium of any of claims 26 to 141, wherein the plasmid comprises a construct comprising an enhancer, a promoter, an IRES, an open reading frame encoding a therapeutic product or a heterologous protein, and a polyA tail.
143. The immunostimulatory bacterium of any of claims 26 to 142, wherein the plasmid comprises a construct comprising an enhancer, a promoter, an IRES, a localization sequence, an open reading frame encoding a therapeutic product, and a polyA tail.
144. The immunostimulatory bacterium of any of claims 26 to 143, wherein the plasmid comprises a construct comprising a bacterial terminator positioned to reduce read-through from a bacterial promoter on the plasmid.
145. The immunostimulatory bacterium of any one of claims 26 to 144, wherein the eukaryotic promoter on the plasmid is oriented in the opposite direction to the bacterial promoter on the plasmid.
146. The immunostimulatory bacterium of claim 145, wherein a bacterial promoter controls expression of the asd gene.
147. 147. The immunostimulatory bacterium of any of claims 26 to 146, wherein the construct on the plasmid encoding the therapeutic product or heterologous protein comprises the woodchuck hepatitis virus (WHP) post-transcriptional regulatory element (WPRE) or the hepatitis B virus post-transcriptional regulatory element (HPRE).
148. 148. The immunostimulatory bacterium of any of claims 26 to 147, wherein the plasmid contains a nucleic acid encoding a therapeutic product that is part of, or a variant of, a cytoplasmic DNA / RNA sensor pathway that leads to expression of type I interferon (IFN).
149. 149. The immunostimulatory bacterium of claim 148, wherein the unmodified therapeutic product directly or indirectly senses or interacts with intracytoplasmic nucleic acids, nucleotides, dinucleotides, or cyclic dinucleotides to induce expression of type I IFN, and the variant protein induces expression of type I IFN without sensing or interacting with intracytoplasmic nucleic acids, nucleotides, dinucleotides, or cyclic dinucleotides.
150. The immunostimulatory bacterium of claim 148, wherein the therapeutic product is a variant that, when expressed in a subject, results in constitutive expression of type I IFN.
151. 149. The immunostimulatory bacterium of claim 148, wherein the therapeutic product is a gain-of-function (GOF) variant that does not require an intracytoplasmic nucleic acid, nucleotide, dinucleotide, or cyclic dinucleotide to result in expression of type I IFN.
152. 152. The immunostimulatory bacterium of any of claims 26-151, wherein the therapeutic product is selected from among STING, RIG-I, MDA-5, IRF-3, IRF-7, TRIM56, RIP1, Sec5, TRAF3, TRAF2, TRAF6, STAT1, LGP2, DDX3, DHX9, DDX1, DDX9, DDX21, DHX15, DHX33, DHX36, DDX60, and SNRNP200, and variants thereof that have increased activity or that increase activity such that type I interferon activity is increased or constitutive.
153. 153. The immunostimulatory bacterium of any of claims 26 to 152, wherein the therapeutic product is selected from among TRIM56, RIP1, Sec5, TRAF3, TRAF2, TRAF6, STAT1, LGP2, DDX3, DHX9, DDX1, DDX9, DDX21, DHX15, DHX33, DHX36, DDX60, and SNRNP200, and variants thereof that have increased activity or that increase activity such that type I interferon activity is increased or constitutive.
154. 154. The immunostimulatory bacterium of any of claims 26 to 153, wherein the therapeutic product is a variant protein with increased activity that results in increased expression of type I interferon (IFN) or results in constitutive expression of type I IFN.
155. The immunostimulatory bacterium of any of claims 26 to 154, wherein the plasmid encodes a gain-of-function, constitutively active variant of a protein that promotes or causes interferonosis in humans.
156. The immunostimulatory bacterium of any of claims 62-80 and 148-155, wherein the therapeutic product is a variant comprising a mutation that eliminates phosphorylation sites in the STING protein, thereby reducing nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling.
157. 157. The immunostimulatory bacterium of any of claims 148-156, wherein the type I IFN-inducing therapeutic product is STING, RIG-I, IRF-3, or MDA5, or a variant thereof.
158. The therapeutic product that induces the expression of type I IFN is a variant thereof with increased activity or constitutive activity, the therapeutic product is STING, RIG-I, IRF-3, or MDA5, or a variant thereof; 158. The immunostimulatory bacterium of any one of claims 148 to 157.
159. 159. The immunostimulatory bacterium of any of claims 148-158, wherein the therapeutic product is a variant of STING, RIG-I, IRF-3, or MDA5 that comprises a gain-of-function mutation that results in increased expression of type I IFN.
160. 160. The immunostimulatory bacterium of any of claims 148-159, wherein the therapeutic product is a variant of STING, RIG-I, IRF-3, or MDA5 in which one or more serine (S) or threonine (T) residues that become phosphorylated as a result of viral infection have been replaced with aspartic acid (D), thereby making the resulting variant a phosphomimetic that constitutively induces type I IFN.
161. the therapeutic product is IRF-3 with one or more substitutions at residues at positions 396, 398, 402, 404, and 405, with reference to SEQ ID NO: 312 for alignment; the residue is replaced with an aspartic acid residue, 161. The immunostimulatory bacterium of any one of claims 148 to 160.
162. 162. The immunostimulatory bacterium of claim 161, wherein IRF-3 comprises a S396D substitution, see SEQ ID NO: 312 for alignment.
163. 162. The immunostimulatory bacterium of claim 161, wherein the IRF-3 comprises S396D / S398D / S402D / T404D / S405D substitutions, with reference to SEQ ID NO: 312 for alignment.
164. 164. The immunostimulatory bacterium of any of claims 148-163, wherein the therapeutic product is selected from among STING, RIG-I, MDA-5, IRF-3, IRF-7, TRIM56, RIP1, Sec5, TRAF3, TRAF2, TRAF6, STAT1, LGP2, DDX3, DHX9, DDX1, DDX9, DDX21, DHX15, DHX33, DHX36, DDX60, and SNRNP200, and variants thereof that have increased activity or that increase activity such that type I interferon activity is increased or constitutive.
165. the therapeutic product that senses cytoplasmic DNA / RNA is a variant STING, MDA5, RIG-I, or IRF-3; Unmodified STING has the sequence set forth in any one of SEQ ID NOs: 305 to 309, unmodified MDA5 has the sequence set forth in SEQ ID NO: 310, unmodified RIG-I has the sequence set forth in SEQ ID NO: 311, and unmodified IRF-3 has the sequence set forth in SEQ ID NO:
312. The immunostimulatory bacterium of any one of claims 148 to 164.
166. 166. The immunostimulatory bacterium of any of claims 148-165, wherein the therapeutic product is selected from among STING, MDA5, IRF-3, and RIG-I, and comprises a gain-of-function mutation that renders STING, MDA5, IRF-3, or RIG-I constitutively active, whereby expression of type I IFN is constitutive.
167. The mutation is: a) In STING, with reference to SEQ ID NOS: 305-309 for alignment, S102P, V147L, V147M, N154S, V155M, G166E, C206Y, G207E, S102P / F279L, F279L, R281Q, R284G, R284S, R284M, R284K, R284T, R197A, D205A, R310A, R293A, T294A, E296A, R197A / D205A, S272A / Q27 one or more selected from: 3A, R310A / E316A, E316A, E316N, E316Q, S272A, R293A / T294A / E296A, D231A, R232A, K236A, Q273A, S358A / E360A / S366A, D231A / R232A / K236A / R238A, S358A, E360A, S366A, R238A, R375A, N154S / R284G, and S324A / S326A; b) in MDA5, with reference to SEQ ID NO: 310 for alignment, one or more of T331I, T331R, A489T, R822Q, G821S, A946T, R337G, D393V, G495R, R720Q, R779H, R779C, L372F, and A452T; c) in RIG-I, one or both of E373A and C268F, with reference to SEQ ID NO: 311 for alignment; and d) In IRF-3, see SEQ ID NO: 312 for alignment, S396D 167. The immunostimulatory bacterium of claim 165 or claim 166, selected as follows:
168. The therapeutic product may comprise any of the following sequences: S102P, V147L, V147M, N154S, V155M, G166E, C206Y, G207E, S102P / F279L, F279L, R281Q, R284G, R284S, R284M, R284K, R284T, R197A, D205A, R310A, R293A, T294A, E296A, R197A / D205A, S272A / Q273A, R310A / E316A, E316A, E316N, E316 168. The immunostimulatory bacterium of any of claims 148 to 167, which is a variant STING containing one or more amino acid substitutions selected from among Q, S272A, R293A / T294A / E296A, D231A, R232A, K236A, Q273A, S358A / E360A / S366A, D231A / R232A / K236A / R238A, S358A, E360A, S366A, R238A, R375A, S324A / S326A, and N154S / R284G, and conservative substitutions thereof.
169. the therapeutic protein increases or induces the expression of type I IFN; The type I IFN is interferon α or interferon β; The immunostimulatory bacterium of any one of claims 26 to 168.
170. The immunostimulatory bacterium of any one of claims 26 to 169, wherein one or more genes or operons involved in SPI-1 entry or SPI-1-independent entry have been deleted, disrupted or inactivated, such that the immunostimulatory bacterium does not invade or infect epithelial cells or has a reduced ability to invade or infect epithelial cells.
171. 171. The immunostimulatory bacterium of claim 170, wherein one or more of avrA, hilA, hilD, invA, invB, invC, invE, invF, invG, invH, invI, invJ, iacP, iagB, spaO, spaP, spaQ, spaR, spaS, orgA, orgB, orgC, prgH, prgI, prgJ, prgK, sicA, sicP, sipA, sipB, sipC, sipD, sirC, sopB, sopD, sopE, sopE2, sprB, and sptP are deleted, disrupted, or inactivated.
172. 172. The immunostimulatory bacterium of claim 171, wherein the one or more genes are selected from among pagN, hlyE, pefI, srgD, srgA, srgB, and srgC.
173. 173. The immunostimulatory bacterium of any of claims 26 to 172, which has a deletion or disruption of a gene encoding a protein in the SPI-2 complex.
174. The immunostimulatory bacterium of any of claims 26 to 173, wherein the plasmid encodes an immunostimulatory protein that confers or contributes to an anti-tumor immune response in the tumor microenvironment.
175. Immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment include IL-2, IL-7, IL-12p70 (IL-12p40 + IL-12p35), IL-15, IL-2 with reduced binding to IL-2Ra, IL-15 / IL-15R alpha chain complex, IL-18, IL-21, IL-23, IL-36γ, IL-2 modified to not bind to IL-2Ra, CXCL9, CXCL10, CXCL11, interferon α, interferon β, interferon γ, CCL3, CCL4, CCL5, and are involved in, cause, or enhance the recruitment and / or persistence of T cells.
175. The immunostimulatory bacterium of claim 174, selected from one or more of the following proteins: CD40, CD40 ligand (CD40L), CD28, OX40, OX40 ligand (OX40L), 4-1BB, 4-1BB ligand (4-1BBL), 4-1BB1 with a cytoplasmic domain that is deleted, truncated, or otherwise modified to abolish immunosuppressive counter-signaling; a member of the B7-CD28 family; a CD47 antagonist; an anti-IL6 antibody or IL-6 binding decoy receptor; a TGF beta polypeptide antagonist; and a member of the tumor necrosis factor receptor (TNFR) superfamily.
176. 176. The immunostimulatory bacterium of claim 174 or claim 175, wherein the plasmid encodes the modified 4-1BBL whose sequence is set forth in SEQ ID NO:390, SEQ ID NO:391, or SEQ ID NO:
392.
177. 177. The immunostimulatory bacterium of claim 175 or claim 176, further comprising a tag linked to the costimulatory protein to facilitate purification or expression of the costimulatory protein.
178. 178. The immunostimulatory bacterium of claim 177, wherein the tag is a c-myc tag comprising the sequence EQKLISEEDL, set forth as residues 2-11 of SEQ ID NO:
392.
179. 179. The immunostimulatory bacterium of any of claims 174-178, wherein the plasmid encodes a 4-1BBL polypeptide and at least one additional therapeutic protein.
180. 180. The immunostimulatory bacterium of claim 179, wherein the additional therapeutic protein is IL-15Rα-IL-15sc or IL-12, or IL-15Rα-IL-15sc and IL-12.
181. 181. The immunostimulatory bacterium of any of claims 174 to 180, comprising a 1-4BBL polypeptide and one or more additional therapeutic polypeptides encoded in a polycistronic nucleic acid under the control of a single promoter, wherein the 1-4BBL polypeptide is the first polypeptide of the polycistrone.
182. the immunostimulatory protein is a costimulatory molecule selected from among CD40, CD40 ligand (CD40L), CD28, OX40, OX40 ligand (OX40L), 4-1BB, and 4-1BB ligand (4-1BBL), which may be truncated in the cytoplasmic domain or lack the cytoplasmic domain for expression on antigen-presenting cells (APCs), thereby abolishing immunosuppressive counter-signaling; The truncated gene product is capable of constitutively delivering immunostimulatory signaling to T cells via costimulatory receptor engagement and, due to the truncation or deletion of the cytoplasmic domain, is incapable of delivering counter-regulatory signaling to antigen-presenting cells (APCs).
182. The immunostimulatory bacterium of any one of claims 174 to 181.
183. the encoded product is a STING protein, a modified STING protein, a chimeric STING protein, an anti-CTLA-4 antibody, IL-15, 4-1BBL and modified or truncated forms thereof, a TGF-beta receptor decoy or polypeptide antagonist, IL-12, and IL-21, and / or one or more of IL-12, or IL-15, or IL12p70, or IL-15 / IL-15R alpha chain complex; cytokines and STING pathway agonists; cytokines, STING pathway agonists, and either costimulatory molecules or immune checkpoint inhibitors; cytokines, STING pathway agonists, and TGF beta receptor decoy or polypeptide antagonists; and / or Cytokines, STING pathway agonists, TGF beta receptor decoys or polypeptide antagonists, and costimulatory molecules or immune checkpoint inhibitors 183. The immunostimulatory bacterium of any of claims 26 to 182, comprising one or more of any of:
184. The immunostimulatory bacterium of any of claims 26 to 183, wherein the plasmid comprises a nucleic acid encoding a product that induces tumor cell apoptosis or is cytotoxic to tumor cells.
185. the product is a nucleic acid, the nucleic acid encoding the product includes nucleic acid encoding a secretion signal, thereby causing the product to be secreted; The immunostimulatory bacterium of claim 184.
186. 185. The immunostimulatory bacterium of claim 183 or claim 184, wherein the product induces apoptosis.
187. The immunostimulatory bacterium of claim 186, wherein the apoptosis-inducing product is azurin.
188. 188. The immunostimulatory bacterium of any of claims 174-187, wherein the plasmid encodes an immunostimulatory protein that confers or contributes to an anti-tumor immune response in the tumor microenvironment, and the immunostimulatory protein is a cytokine or chemokine.
189. 189. The immunostimulatory bacterium of any of claims 174-188, wherein the plasmid encodes an immunostimulatory protein that confers or contributes to an anti-tumor immune response in the tumor microenvironment, wherein the immunostimulatory protein is a costimulatory molecule or a cytoplasmic domain deleted or truncated or otherwise modified version thereof.
190. 190. The immunostimulatory bacterium of claim 189, wherein the immunostimulatory protein that confers or contributes to an anti-tumor immune response in the tumor microenvironment is selected from among 4-1BBL, CD80, CD86, CD27L, B7RP1, and OX40L, and cytoplasmic domain deleted or truncated or truncated and modified forms thereof, wherein the modifications promote correct orientation when the proteins are expressed in a cell, and the cytoplasmic deletion, truncation, and / or modification eliminates or reduces immunosuppressive counter-signaling.
191. The immunostimulatory bacterium of any of claims 26 to 190, wherein the plasmid encodes a therapeutic product that is a TGF beta polypeptide antagonist.
192. 192. The immunostimulatory bacterium of claim 191, wherein the TGF beta polypeptide antagonist is selected from among an anti-TGF beta antibody or a fragment thereof, an anti-TGF beta receptor antibody or a fragment thereof, a soluble TGF beta antagonist polypeptide, and a TGF beta binding decoy receptor.
193. 193. The immunostimulatory bacterium of claim 191 or claim 192, wherein the nucleic acid encoding the TGF beta polypeptide antagonist comprises nucleic acid encoding a signal sequence for secretion of the encoded polypeptide.
194. The immunostimulatory bacterium of any of claims 26 to 193, wherein the therapeutic product is an antibody or an antigen-binding fragment thereof.
195. The antibody or antigen-binding fragment thereof may be Fab, Fab', F(ab') 2 195. The immunostimulatory bacterium of claim 194, wherein the antigen-binding fragment is selected from the group consisting of a single-chain Fv (scFv), an Fv, a dsFv, a nanobody, a diabody fragment, a single-chain antibody, and an scFv-Fc two-chain antibody.
196. The immunostimulatory bacterium of claim 195, wherein the antibody is an scFV.
197. 197. The immunostimulatory bacterium of claim 195 or claim 196, wherein the antibody comprises an Fc, whereby the resulting antibody comprises two chains.
198. 198. The immunostimulatory bacterium of any of claims 195 to 197, wherein the antibody is encoded by nucleic acid comprising a variable light chain, a linker, a variable heavy chain, and nucleic acid encoding an IgG Fc, whereby the encoded antibody is an scFv-Fc.
199. 199. The immunostimulatory bacterium of any one of claims 195 to 198, wherein the antibody is an anti-CTLA-4 antibody.
200. 200. The immunostimulatory bacterium of any of claims 194-199, wherein the antibody or antigen-binding fragment thereof is humanized or human.
201. The immunostimulatory bacterium of any of claims 194-200, wherein the antibody or antigen-binding fragment thereof is an antagonist of PD-1, PD-L1, CTLA-4, VEGF, VEGFR2, or IL-6.
202. The plasmid is a) immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment; b) one or more proteins that are part of a cytoplasmic DNA / RNA sensor pathway that leads to the expression of type I interferon (IFN), or variants thereof that have increased activity that increase the expression of type I IFN, or variants thereof that lead to the constitutive expression of type I IFN; and c) an anti-cancer antibody or an antigen-binding portion thereof 202. The immunostimulatory bacterium of any one of claims 26 to 201, encoding two or more therapeutic products selected from:
203. The immunostimulatory bacterium of claim 202, wherein the immunostimulatory protein is a costimulatory molecule that is missing a cytoplasmic domain or a portion thereof sufficient for expression on an antigen-presenting cell (APC), such that the truncated costimulatory molecule can constitutively transmit immunostimulatory signaling to T cells via costimulatory receptor engagement and is incapable of transmitting counter-regulatory signaling to antigen-presenting cells (APCs).
204. 1. An immunostimulatory bacterium comprising a plasmid encoding two or more therapeutic products under the control of a single promoter, The therapeutic product is a) immunostimulatory proteins that confer or contribute to an anti-tumor immune response in the tumor microenvironment; b) one or more proteins that are part of a cytoplasmic DNA / RNA sensor pathway that leads to the expression of type I interferon (IFN), or variants thereof that have increased activity that increase the expression of type I IFN, or variants thereof that lead to the constitutive expression of type I IFN; and c) an anti-cancer antibody or an antigen-binding portion thereof is selected from Immunostimulatory bacteria in which the encoding nucleic acids are separated by an IRES sequence or a 2A peptide, and each nucleic acid encoding each product may be operably linked to a nucleic acid encoding a signal sequence, whereby, upon translation of the encoded mRNA, each product is individually expressed and secreted from the bacterium and / or the cell containing the plasmid.
205. The immunostimulatory bacterium of claim 204, wherein the immunostimulatory protein is a costimulatory molecule that is missing a cytoplasmic domain or a portion thereof sufficient for expression on an antigen-presenting cell (APC), such that the truncated costimulatory molecule can constitutively transmit immunostimulatory signaling to T cells via costimulatory receptor engagement and is incapable of transmitting counter-regulatory signaling to antigen-presenting cells (APCs).
206. The immunostimulatory bacterium of any of claims 26 to 205, wherein the plasmid encodes at least two therapeutic products selected from a cytokine, a protein that constitutively induces type I IFN, a costimulatory molecule, and an anti-cancer antibody or antigen-binding portion thereof.
207. the plasmid encodes two or more therapeutic products under the control of a single promoter; expression of nucleic acids encoding at least two or all of the products is under the control of a single promoter, and the nucleic acid encoding each product is separated by a nucleic acid encoding a 2A peptide, thereby resulting in individual expression of each product upon translation; The immunostimulatory bacterium according to any one of claims 26 to 206.
208. 208. The immunostimulatory bacterium of any of claims 202-207, wherein nucleic acid encoding one or more therapeutic products is operably linked to nucleic acid encoding a sequence that directs secretion of the expressed product.
209. the therapeutic product is a costimulatory molecule having a cytoplasmic domain deletion or truncation or other modification for expression on antigen-presenting cells (APCs); The truncated gene product is capable of constitutively transmitting immunostimulatory signaling to T cells via costimulatory receptor engagement and is incapable of counter-regulatory signaling to APCs due to cytoplasmic domain deletion, truncation, or other modifications. The immunostimulatory bacterium according to any one of claims 26 to 208.
210. 210. The immunostimulatory bacterium of claim 209, wherein the costimulatory molecule having a deleted or truncated cytoplasmic domain or being otherwise modified is 4-1BBL, CD80, CD86, CD27L, B7RP1, or OX40L, and variants that increase correct orientation of the protein when expressed in a cell.
211. encoding two or more therapeutic products, at least one product selected from a) and at least one product selected from b); a) is IL-2, IL-7, IL-12p70 (IL-12p40+IL-12p35), IL-15, IL-23, IL-36 gamma, IL-2 with reduced binding to IL-2Ra, IL-15 / IL-15R alpha chain complex, IL-18, IL-2 modified so as not to bind to IL-2Ra, CXCL9, CXCL10, CXCL11, interferon α, interferon β, CCL3, CCl4, CCL5, a protein involved in or causing or enhancing T-cell recruitment / persistence, CD40, CD40 ligand (CD40L), OX40, OX40 ligand (OX40L), 4-1BB, 4-1BB ligand (4-1BBL), a member of the B7-CD28 family, a TGF beta polypeptide antagonist, or a member of the tumor necrosis factor receptor (TNFR) superfamily; b) is STING, RIG-I, MDA-5, IRF-3, IRF-5, IRF-7, TRIM56, RIP1, Sec5, TRAF3, TRAF2, TRAF6, STAT1, LGP2, DDX3, DHX9, DDX1, DDX9, DDX21, DHX15, DHX33, DHX36, DDX60, or SNRNP200; The immunostimulatory bacterium according to any one of claims 26 to 210.
212. 212. The immunostimulatory bacterium of any one of claims 26 to 211, which encodes or further encodes one or more of a TGFbeta inhibitory antibody or antigen-binding fragment thereof, a TGFbeta-binding decoy receptor, an anti-IL6 antibody or antigen-binding fragment thereof, and an IL-6-binding decoy receptor.
213. The following combinations of therapeutic products: IL-2 and IL-12p70; IL-2 and IL-21; IL-2, IL-12p70, and STING gain-of-function (GOF) variants; IL-2, IL-21, and STING GOF variants; IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt), in which Δcyt is a deletion of the cytoplasmic domain; IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα and STING GOF variants; IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα and IL-12p70; IL-15 / IL-15Rα and IL-21; IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; IL-15 / IL-15Rα, IL-21, and STING GOF variants; IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and IL-21; IL-12p70, IL-21, and STING GOF variants; IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and STING GOF variants; IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and IL-18; IL-12p70, IL-18, and STING GOF variants; IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or polypeptide antagonists, IL-2, and IL-12p70; TGF-β decoy receptor or polypeptide antagonists, IL-2, and IL-21; TGF-β decoy receptor or polypeptide antagonists, IL-2, IL-12p70, and STING GOF variants; TGF-β decoy receptor or polypeptide antagonists, IL-2, IL-21, and STING GOF variants; TGF-β decoy receptor or polypeptide antagonists, IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or polypeptide antagonists, IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or polypeptide antagonists, IL-15 / IL-15Rα, and STING GOF variants; TGF-β decoy receptor or polypeptide antagonists, IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or polypeptide antagonists, IL-15 / IL-15Rα, and IL-12p70; TGF-β decoy receptor or polypeptide antagonists, IL-15 / IL-15Rα, and IL-21; TGF-β decoy receptor or polypeptide antagonists, IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; TGF-β decoy receptor or polypeptide antagonists, IL-15 / IL-15Rα, IL-21, and STING GOF variants; TGF-β decoy receptor or polypeptide antagonists, IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or polypeptide antagonists, IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or polypeptide antagonists, IL-12p70 and IL-21; TGF-β decoy receptor or polypeptide antagonists, IL-12p70, IL-21, and STING GOF variants; TGF-β decoy receptor or polypeptide antagonists, IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or polypeptide antagonist and IL-12p70; TGF-β decoy receptor or polypeptide antagonists, IL-12p70, and STING GOF variants; TGF-β decoy receptor or polypeptide antagonists, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or polypeptide antagonists, IL-12p70, and IL-18; TGF-β decoy receptor or polypeptide antagonists, IL-12p70, IL-18, and STING GOF variants; TGF-β decoy receptor or polypeptide antagonists, IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor or polypeptide antagonists and STING GOF variants; anti-CTLA-4 antibody, IL-2, and IL-12p70; anti-CTLA-4 antibodies, IL-2, and IL-21; anti-CTLA-4 antibodies, IL-2, IL-12p70, and STING GOF variants; anti-CTLA-4 antibodies, IL-2, IL-21, and STING GOF variants; anti-CTLA-4 antibodies, IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and STING GOF variants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-15 / IL-15Rα, and IL-12p70; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and IL-21; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-21, and STING GOF variants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-12p70, and IL-21; anti-CTLA-4 antibodies, IL-12p70, IL-21, and STING GOF variants; anti-CTLA-4 antibodies, IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody and IL-12p70; anti-CTLA-4 antibodies, IL-12p70, and STING GOF variants; anti-CTLA-4 antibodies, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-12p70, and IL-18; anti-CTLA-4 antibodies, IL-12p70, IL-18, and STING GOF variants; anti-CTLA-4 antibodies, IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies and STING GOF variants; CD40 agonist, IL-2, and IL-12p70; CD40 agonist, IL-2, and IL-21; CD40 agonist, IL-2, IL-12p70, and STING GOF variants; CD40 agonist, IL-2, IL-21, and STING GOF variants; CD40 agonist, IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, and STING GOF variants; CD40 agonist, IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, and IL-12p70; CD40 agonist, IL-15 / IL-15Rα, and IL-21; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; CD40 agonist, IL-15 / IL-15Rα, IL-21, and STING GOF variants; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-12p70, and IL-21; CD40 agonist, IL-12p70, IL-21, and STING GOF variants; CD40 agonist, IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist and IL-12p70; CD40 agonist, IL-12p70, and STING GOF variant; CD40 agonist, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-12p70, and IL-18; CD40 agonist, IL-12p70, IL-18, and STING GOF variants; CD40 agonists, IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); and CD40 agonists and STING GOF variants and encoding one or more of: 4-1BBL is 4-1BBL having a deleted cytoplasmic domain, 4-1BBL having a modified cytoplasmic domain, 4-1BBL having a truncated cytoplasmic domain, or 4-1BBL having a truncated and modified cytoplasmic domain; the anti-CTLA-4 antibody is an scFv or scFv-Fc; The immunostimulatory bacterium of any one of claims 26 to 212.
214. A combination of: anti-CTLA-4 antibody and STING, IL-15 and STING, 4-1BBL and STING, TGF beta decoy receptor or polypeptide antagonists, and STING, IL-12 and STING, anti-CTLA-4 antibody, IL-15, and STING; 4-1BBL, IL-15, and STING, TGF beta decoy receptor or polypeptide antagonists, IL-15, and STING, anti-CTLA-4 antibody, IL-12, and STING; 4-1BBL, IL-12, and STING, TGF beta decoy receptor or antagonist polypeptide, IL-12, and STING, anti-CTLA-4 antibodies, IL-15, TGF beta decoy receptor or polypeptide antagonists, and STING; 4-1BBL, and IL-15, TGF beta decoy receptor or polypeptide antagonist, and STING, anti-CTLA-4 antibodies, and IL-12, and TGF beta decoy receptor or polypeptide antagonists, and STING; 4-1BBL, and IL-12, TGF beta decoy receptor or polypeptide antagonist, and STING, anti-CTLA-4 antibody, IL-12, IL-15, and STING; 4-1BBL, IL-12, IL-15, and STING, TGF beta decoy receptor or polypeptide antagonists, IL-12, IL-15, and STING; TGF beta decoy receptor or polypeptide antagonists, IL-12, IL-15, and STING; anti-CTLA-4 antibodies, IL-12, IL-15, TGF beta decoy receptor or polypeptide antagonists, and STING; 4-1BBL, IL-12, IL-21, TGF beta decoy receptor or polypeptide antagonist, and STING, anti-CTLA-4 antibodies, IL-12, IL-15, and TGF beta decoy receptor or polypeptide antagonists; 4-1BBL, IL-12, IL-21, and TGF beta decoy receptor or polypeptide antagonists; IL-12, IL-15, and STING, IL-15, IL-21, and STING, IL-12, IL-21, and STING, anti-CTLA-4 antibody, IL-15, IL-21, and STING; anti-CTLA-4 antibodies, IL-12, IL-21, and STING; 4-1BBL, IL-15, IL-21, and STING, 4-1BBL, IL-12, IL-21, and STING, anti-CTLA-4 antibody and IL-15, anti-CTLA-4 antibodies, IL-15, and TGF beta decoy receptor or polypeptide antagonists; 4-1BBL and IL-15, 4-1BBL, IL-15, and TGF beta decoy receptor or polypeptide antagonists, anti-CTLA-4 antibody and IL-12, anti-CTLA-4 antibodies, and IL-12, and TGF beta decoy receptor or polypeptide antagonists; 4-1BBL and IL-12, 4-1BBL, IL-12, and TGF beta decoy receptor or polypeptide antagonists; anti-CTLA-4 antibodies, and TGF beta decoy receptor or polypeptide antagonists; 4-1BBL and TGF beta decoy receptor or polypeptide antagonists, IL-15 and TGF beta decoy receptor or polypeptide antagonists, IL-12 and TGF beta decoy receptor or polypeptide antagonists, IL-12, IL-15, and TGF beta decoy receptor or polypeptide antagonists, and IL-15, IL-21, and TGF beta decoy receptor or polypeptide antagonists and a nucleic acid encoding a combination of therapeutic products selected from the group consisting of: IL-15 is IL-15 or the IL-15 / IL-15R alpha chain complex; STING is a STING polypeptide, or a variant STING polypeptide, or a chimeric STING polypeptide, or a chimeric STING having an amino acid substitution; the TGF beta is a soluble TGF beta decoy or a TGF beta antagonist; 4-1BBL is 4-1BBL having a deleted cytoplasmic domain, 4-1BBL having a modified cytoplasmic domain, 4-1BBL having a truncated cytoplasmic domain, or 4-1BBL having a truncated and modified cytoplasmic domain; the anti-CTLA-4 antibody is an scFv or scFv-Fc; The immunostimulatory bacterium according to any one of claims 26 to 213.
215. 215. The immunostimulatory bacterium of claim 214, wherein the TGF beta decoy comprises an Fc fusion or is an anti-TGF antibody or antigen-binding fragment thereof.
216. The immunostimulatory bacterium of claim 214 or claim 215, wherein 4-1BBL is full-length, or full-length with an amino acid substitution at Ser5 and / or Ser8, thereby reducing or eliminating immunosuppressive reverse signaling, or 1-4BBL with a cytoplasmic domain deletion or a cytoplasmic domain truncation that eliminates or reduces immunosuppressive reverse signaling, or 1-4BBL with an amino acid substitution in the truncated cytoplasmic domain, thereby 4-1BBL is in the correct orientation when expressed in a cell.
217. The immunostimulatory bacterium of any of claims 214 to 216, wherein the STING polypeptide comprises an R284G substitution, or an N154S / R284G substitution, or is a chimeric human STING polypeptide having CTT derived from Tasmanian devil, or is a chimeric human STING polypeptide having CTT derived from Tasmanian devil and a substitution corresponding to R284G or a substitution corresponding to N154S / R284G, all with reference to SEQ ID NOs: 305 to 309 for alignment.
218. The immunostimulatory bacterium of any of claims 213 to 215, wherein the STING gain-of-function (GOF) variant is selected from any of claims 167 or 168.
219. The following combinations of therapeutic products: IL-2 and IL-12p70; IL-2 and IL-21; IL-2, IL-12p70, and STING GOF variants; IL-2, IL-21, and STING GOF variants; IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt), where Δcyt is a deletion of the cytoplasmic domain; IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα and STING GOF variants; IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα and IL-12p70; IL-15 / IL-15Rα and IL-21; IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; IL-15 / IL-15Rα, IL-21, and STING GOF variants; IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and IL-21; IL-12p70, IL-21, and STING GOF variants; IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and STING GOF variants; IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); IL-12p70 and IL-18; IL-12p70, IL-18, and STING GOF variants; IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor, IL-2, and IL-12p70; TGF-β decoy receptor, IL-2, and IL-21; TGF-β decoy receptor, IL-2, IL-12p70, and STING GOF variants; TGF-β decoy receptor, IL-2, IL-21, and STING GOF variants; TGF-β decoy receptor, IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor, IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor, IL-15 / IL-15Rα, and STING GOF variants; TGF-β decoy receptor, IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor, IL-15 / IL-15Rα, and IL-12p70; TGF-β decoy receptor, IL-15 / IL-15Rα, and IL-21; TGF-β decoy receptor, IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; TGF-β decoy receptor, IL-15 / IL-15Rα, IL-21, and STING GOF variants; TGF-β decoy receptor, IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor, IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor, IL-12p70, and IL-21; TGF-β decoy receptor, IL-12p70, IL-21, and STING GOF variants; TGF-β decoy receptor, IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor and IL-12p70; TGF-β decoy receptor, IL-12p70, and STING GOF variants; TGF-β decoy receptor, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor, IL-12p70, and IL-18; TGF-β decoy receptor, IL-12p70, IL-18, and STING GOF variants; TGF-β decoy receptor, IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); TGF-β decoy receptor and STING GOF variants; anti-CTLA-4 antibody, IL-2, and IL-12p70; anti-CTLA-4 antibodies, IL-2, and IL-21; anti-CTLA-4 antibodies, IL-2, IL-12p70, and STING GOF variants; anti-CTLA-4 antibodies, IL-2, IL-21, and STING GOF variants; anti-CTLA-4 antibodies, IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and STING GOF variants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-15 / IL-15Rα, and IL-12p70; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, and IL-21; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-21, and STING GOF variants; anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies, IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-12p70, and IL-21; anti-CTLA-4 antibodies, IL-12p70, IL-21, and STING GOF variants; anti-CTLA-4 antibodies, IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody and IL-12p70; anti-CTLA-4 antibodies, IL-12p70, and STING GOF variants; anti-CTLA-4 antibodies, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibody, IL-12p70, and IL-18; anti-CTLA-4 antibodies, IL-12p70, IL-18, and STING GOF variants; anti-CTLA-4 antibodies, IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); anti-CTLA-4 antibodies and STING GOF variants; CD40 agonist, IL-2, and IL-12p70; CD40 agonist, IL-2, and IL-21; CD40 agonist, IL-2, IL-12p70, and STING GOF variants; CD40 agonist, IL-2, IL-21, and STING GOF variants; CD40 agonist, IL-2, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-2, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, and STING GOF variants; CD40 agonist, IL-15 / IL-15Rα, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, and IL-12p70; CD40 agonist, IL-15 / IL-15Rα, and IL-21; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, and STING GOF variants; CD40 agonist, IL-15 / IL-15Rα, IL-21, and STING GOF variants; CD40 agonist, IL-15 / IL-15Rα, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-15 / IL-15Rα, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-12p70, and IL-21; CD40 agonist, IL-12p70, IL-21, and STING GOF variants; CD40 agonist, IL-12p70, IL-21, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist and IL-12p70; CD40 agonist, IL-12p70, and STING GOF variants; CD40 agonist, IL-12p70, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); CD40 agonist, IL-12p70, and IL-18; CD40 agonist, IL-12p70, IL-18, and STING GOF variants; CD40 agonists, IL-12p70, IL-18, STING GOF variants, and 4-1BBL (including 4-1BBLΔcyt); and CD40 agonists and STING GOF variants Immunostimulatory bacteria or cells encoding one or more of:
220. 220. The immunostimulatory bacterium or cell of claim 219, wherein the STING GOF variant is selected from among those described in claim 167 or claim 168.
221. The immunostimulatory bacterium of any of claims 26-220, wherein the encoded therapeutic product comprises an Fc domain.
222. The immunostimulatory bacterium of any of claims 26-221, wherein the encoded therapeutic product comprises a B7 protein transmembrane domain.
223. The immunostimulatory bacterium of any of claims 26 to 222, wherein the encoded therapeutic product is GPI anchored.
224. 224. The immunostimulatory bacterium of any of claims 26-223, wherein the encoded therapeutic product comprises human serum albumin or a derivative thereof that increases the serum half-life of the encoded product.
225. The immunostimulatory bacterium of any of claims 26 to 224, wherein the encoded therapeutic product comprises a fusion with collagen.
226. The immunostimulatory bacterium of any one of claims 26 to 225, wherein the bacterium is a gram-negative bacterium.
227. the bacterium is a strain of the genus Salmonella, Shigella, Escherichia coli, Bifidobacteriae, Rickettsia, Vibrio, Listeria, Klebsiella, Bordetella, Neisseria, Aeromonas, Francisella, Cholera, Corynebacterium, Citrobacter, Chlamydia, Haemophilus, Brucella, Mycobacterium, Mycoplasma, Legionella, Rhodococcus, Pseudomonas, Helicobacter, Bacillus, or Erysipelothrix, or an attenuated or modified strain thereof of any of the bacterial strains from the preceding list; The immunostimulatory bacterium of any one of claims 26 to 226.
228. Bacteria include Rickettsia rickettsiae, Rickettsia typhi, Rickettsia tsutsugamushi, Rickettsia typhi, Rickettsia sibirica, Bordetella bronchiseptica, Neisseria meningitidis, Neisseria gonorrhoeae, Aeromonas eucleophila, Aeromonas salmonicida, Francisella tularensis, Mycobacterium pseudotuberculosis, Citrobacter freundii, Chlamydia pneumoniae, Haemophilus somnus, Brucella The immunostimulatory bacterium of any one of claims 26 to 226, which is selected from the group consisting of Bacillus abortus, Mycobacterium intracellulare, Legionella pneumophila, Rhodococcus equi, Pseudomonas aeruginosa, Helicobacter mustelae, Vibrio cholerae, Bacillus subtilis, Erysipelothrix rhusiopathiae, Yersinia enterocolitica, Roshalimea quintana, and Agrobacterium tumefaciens.
229. 229. The immunostimulatory bacterium of any one of claims 26 to 228, which is an attenuated bacterium or is a gram-negative bacterium.
230. 230. The immunostimulatory bacterium of any one of claims 26 to 229, which is a strain of the genus Salmonella.
231. 231. The immunostimulatory bacterium of claim 230, which is a Salmonella typhimurium strain.
232. 232. The immunostimulatory bacterium of claim 230 or claim 231, wherein the unmodified Salmonella is a wild-type strain.
233. The immunostimulatory bacterium of claim 230 or claim 231, wherein the unmodified Salmonella strain is attenuated.
234. The immunostimulatory bacterium of any one of claims 26 to 233, wherein the immunostimulatory bacterium is derived from strain AST-100 (VNP20009 or YS1646) or strain ATCC14028 or a strain having all of the identifying characteristics of strain ATCC14028.
235. ansB - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), and pagP - The immunostimulatory bacterium of any one of claims 227 to 233,
236. 236. The immunostimulatory bacterium of any one of claims 26 to 235, wherein the bacterium encodes and expresses a resistance to complement killing (rck) gene.
237. 237. The immunostimulatory bacterium of claim 236, wherein the rck gene is a Salmonella rck gene.
238. The immunostimulatory bacteria of any of claims 26 to 237, which, when administered intravenously at a therapeutic dose, induces serum IL-6, serum TNF alpha, and serum IL-10 of less than 150 pg / ml each when measured 7 days after treatment.
239. An immunostimulatory bacterium that, when administered intravenously at therapeutic doses, induces serum IL-6, serum TNF alpha, and serum IL-10 at less than 150 pg / ml each when measured 7 days after treatment.
240. The dose is 1 x 10 8 The immunostimulatory bacterium of claim 238 or claim 239, which is a CFU (colony forming unit).
241. The dose is 1 x 10 8 CFU ~ 1 x 10 9 The immunostimulatory bacterium of claim 238 or claim 239, which is a CFU.
242. An immunostimulatory bacterium comprising a plasmid encoding a therapeutic product and modified to encode and express a resistance to complement killing (rck) gene, wherein the wild-type bacterium does not encode rck.
243. The immunostimulatory bacterium of claim 242, which is an Escherichia coli strain.
244. A delivery vehicle encoding a truncated costimulatory molecule having a complete or partial cytoplasmic domain deletion for expression on antigen-presenting cells (APCs), wherein the truncated gene product is capable of constitutively transmitting immunostimulatory signaling to T cells via costimulatory receptor engagement and, due to the deletion of the cytoplasmic domain, is incapable of transmitting counter-regulatory signaling to APCs.
245. The delivery vehicle of claim 244, wherein the costimulatory molecule is 4-1BBL, CD80, CD86, CD27L, B7RP1, or OX40L, or a variant thereof having a deletion or truncation of the cytoplasmic domain and / or a mutation that confers proper orientation of the protein when expressed in a cell.
246. The delivery vehicle of claim 244 or claim 245, which is an immunostimulatory bacterium, an exosome, a nanoparticle, an oncolytic virus, or a cell.
247. 247. The delivery vehicle of any one of claims 244 to 246, which is a cell.
248. The delivery vehicle of claim 247, wherein the cell is a stem cell.
249. The delivery vehicle of claim 248, wherein the stem cells are mesenchymal stem cells (MSCs).
250. The delivery vehicle of claim 249, wherein the MSCs are genetically modified to express a combination of immunomodulatory cytokines.
251. The delivery vehicle of claim 250, wherein the cytokines are interleukin 12 (IL-12) and interleukin 21 (IL-21).
252. 252. An isolated cell comprising the delivery vehicle of any of claims 244-251.
253. 244. An isolated cell comprising the immunostimulatory bacterium of any of claims 26-243.
254. 254. The cell of claim 252 or claim 253, which is an immune cell, a stem cell, a tumor cell, or a primary cell line.
255. The cell of claim 254, which is a hematopoietic cell.
256. The cell of claim 255, which is a T cell.
257. 257. The cell of any of claims 252-256, produced ex vivo by infecting the cell with a delivery vehicle or immunostimulatory bacteria.
258. 255. The cell of any one of claims 252 to 254, which is a stem cell of non-embryonic origin.
259. The cell of any one of claims 252 to 254, wherein the cell is a stem cell.
260. The cell of claim 259, wherein the stem cell is a mesenchymal stem cell (MSC).
261. The cell of claim 260, wherein the MSC is genetically modified to express a combination of immunomodulatory cytokines.
262. The cell of claim 261, wherein the cytokines are interleukin 12 (IL-12) and interleukin 21 (IL-21).
263. 262. A pharmaceutical composition comprising the immunostimulatory bacterium of any of claims 26-243, or the delivery vehicle of any of claims 244-251, or the cell of any of claims 252-262 in a pharmaceutically acceptable vehicle.
264. 85. A pharmaceutical composition comprising the immunostimulatory bacteria of claim 84 in a pharmaceutically acceptable vehicle.
265. 265. The pharmaceutical composition of claim 263 or claim 264, which is formulated for administration undiluted.
266. 266. The pharmaceutical composition of any of claims 263 to 265, formulated for systemic administration.
267. 267. The pharmaceutical composition of any one of claims 263 to 266, formulated for parenteral administration.
268. 268. The pharmaceutical composition of claim 267, formulated for intravenous administration.
269. The pharmaceutical composition of claim 267, formulated for intratumoral administration.
270. 268. The pharmaceutical composition of claim 267, formulated for intraperitoneal administration.
271. 267. The pharmaceutical composition of claim 266, formulated for oral administration.
272. 271. A method of treating cancer, including solid tumors or hematological tumors, in a subject, comprising administering an immunostimulatory bacterium according to any one of claims 26 to 243, or a delivery vehicle according to any one of claims 244 to 251, or a cell according to any one of claims 252 to 262, or a pharmaceutical composition according to any one of claims 263 to 271.
273. 27. Use of an immunostimulatory bacterium according to any one of claims 26 to 244, or a delivery vehicle according to any one of claims 244 to 251, or a cell according to any one of claims 252 to 262, or a pharmaceutical composition according to any one of claims 263 to 271 for the treatment of cancer, including solid tumors or hematological tumors, in a subject.
274. 271. An immunostimulatory bacterium according to any one of claims 26 to 244, or a delivery vehicle according to any one of claims 244 to 251, or a cell according to any one of claims 252 to 262, or a pharmaceutical composition according to any one of claims 263 to 271 for use in treating cancer, including solid tumors or hematological tumors, in a subject.
275. 275. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any one of claims 272 to 274, wherein the subject is a human.
276. 276. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272-275, wherein the cancer comprises a solid tumor.
277. 276. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272-275, wherein the cancer comprises a hematological tumor.
278. 278. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272-277, wherein the treatment comprises a combination therapy in which a second anti-cancer agent or treatment is administered.
279. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of claim 278, wherein a second anti-cancer agent or treatment is administered before, simultaneously with, after, or intermittently with the immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition.
280. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of claim 278 or claim 279, wherein the second anti-cancer agent or treatment is immunotherapy.
281. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition according to any one of claims 272 to 280, wherein administration of the immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition is parenteral administration.
282. 281. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272 to 280, wherein administration of the immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition is oral or rectal, or by aerosol to the lung, or intratumoral administration.
283. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition according to any one of claims 272 to 280, wherein the administration of the immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition is intravenous, intramuscular, or subcutaneous.
284. 284. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272 to 283, wherein the cancer is selected from leukemia; lymphoma; gastric cancer; and cancer of the breast, heart, lung, small intestine, colon, spleen, kidney, bladder, head and neck, colorectal, ovary, prostate, brain, pancreas, skin, bone, bone marrow, blood, thymus, uterus, testicle, cervix, and liver.
285. 281. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of claim 280, wherein the immunotherapy comprises administration of an anti-PD-1 or anti-PD-L1 or anti-CTLA-4 antibody, or an antigen-binding portion or antigen-binding form thereof.
286. 286. The method, use, immunostimulatory bacterium, delivery vehicle, cell or pharmaceutical composition of any of claims 272 to 285, wherein the immunostimulatory bacterium is a Salmonella, Shigella, Listeria, or Escherichia species.
287. 287. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272 to 286, wherein the immunostimulatory bacterium is a Salmonella species.
288. 288. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272 to 287, wherein the immunostimulatory bacterium is a Salmonella typhimurium strain.
289. 289. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition according to any one of claims 272 to 288, wherein administration of the immunostimulatory bacterium is by intraperitoneal administration or intratumoral administration.
290. 290. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272-289, wherein the subject has metastatic cancer.
291. 291. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272-290, comprising administering a second anti-cancer treatment, wherein the second treatment is selected from among anti-PD-1, anti-CTLA-4, anti-PD-L1, anti-IL-6, anti-Siglec 15, anti-VEGF, anti-CD73, and anti-CD38 antibodies, or antigen-binding portions or antigen-binding forms thereof.
292. 292. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272-291, comprising administering a second or further anti-cancer treatment, wherein the second or further treatment is selected from among a poly(ADP-ribose) polymerase (PARP) inhibitor, a histone deacetylase (HDAC) inhibitor, a chemotherapeutic agent, an anti-EGFR antibody, a CAR-T cell, an anti-Her2 antibody, an anti-mesothelin antibody, and an anti-B cell maturation antigen (BCMA) antibody.
293. Immunostimulatory bacteria are ansB - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), and pagP - 293. The method, use, immunostimulatory bacterium, delivery vehicle, cell, or pharmaceutical composition of any of claims 272 to 292, wherein
294. 1. A method of selecting a subject for treatment with an immunostimulatory bacterium according to any one of claims 26 to 243, or a delivery vehicle according to any one of claims 244 to 251, or a cell according to any one of claims 252 to 262, or a pharmaceutical composition according to any one of claims 263 to 271, comprising: Obtaining a biological sample from a subject; and Detecting one or more biomarkers indicative of an immune exclusion or immune desert tumor phenotype A method comprising:
295. The biomarkers Tests showing T cell or tumor infiltrating lymphocyte (TIL) infiltration into the tumor microenvironment; Biomarkers that measure the restriction of T cells or TILs to the infiltrative margin of the tumor and tumor core; level of TILs; an adenosine signature (Nanostring) indicative of CXCL1, CXCL2, CXCL3, CXCL5, CXCL8, THBS1, IL-6, CSF-3, IL-1beta, CCL2, CCL3, or CCL7; Myeloid signature (Nanostring) indicative of CXCL1, CXCL2, CXCL3, CXCL8, IL-6, or PTGS2; and levels of one or more of CD3, CD8, CD73, CD39, TNAP (tissue-nonspecific alkaline phosphatase), CD38, CD45, CD68, PD-L1, and FoxP3 The method of claim 294, wherein the
296. 1. A method for monitoring therapy with an immunostimulatory bacterium according to any one of claims 26 to 243, or a delivery vehicle according to any one of claims 244 to 251, or a cell according to any one of claims 252 to 262, or a pharmaceutical composition according to any one of claims 263 to 271, comprising: obtaining a biological sample from a subject and detecting changes in the level of a biomarker; an increase in biomarkers indicative of an anti-cancer phenotype indicates that the treatment is effective; The method, wherein the biomarker is any indicative of a cytokine response, type I interferon activation, or type II interferon activation.
297. the biomarkers are selected from levels of one or more of CXCL10 / IP-10, CXCL9, interferon alpha, interferon beta, the pro-inflammatory serum cytokines IL-6, TNF-α, MCP-1, or CCL2, and IL-18 binding protein; an increase in the level of one or more of the biomarkers indicates that the treatment is effective; The method of claim 296.
298. 300. The method of any of claims 294 to 297, wherein the biological sample is a tumor biopsy or a sample of body fluid.
299. 299. The method of any one of claims 294 to 298, further comprising administering an immunostimulatory bacterium of any one of claims 26 to 243, or a delivery vehicle of any one of claims 244 to 251, or a cell of any one of claims 252 to 262, or a pharmaceutical composition of any one of claims 263 to 271.
300. an engineered stimulator of interferon genes (STING) protein from a non-human species, wherein the non-human STING optionally has reduced NF-κB signaling activity compared to human STING and increased type I interferon (IFN) pathway signaling activity compared to human STING; the non-human STING protein is modified to contain a mutation such that its activity is increased or that it acts constitutively in the absence of cytoplasmic nucleic acid; the mutations are amino acid insertions, deletions, and / or substitutions; The STING protein may have a deletion or disruption of the TRAF6 binding site; Modified STING protein.
301. A modified stimulator of interferon genes (STING) protein from a non-human species, or a chimeric human STING protein and variants thereof, comprising one or more mutations with gain of function (GOF) that result in enhanced constitutive activation and / or sensitivity of the encoded STING protein, or increased affinity or binding to an endogenous ligand, whereby the STING protein is modified by one or more of amino acid insertion, deletion, and substitution; the STING protein has IFN-beta signaling activity and attenuated nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling activity compared to human STING; The mutation results in increased STING activity or constitutive activity in inducing IFN-beta production, Modified STING protein.
302. A modified STING protein according to claim 300 or claim 301, wherein the human STING protein has a sequence set forth in any of SEQ ID NOs: 305-309 or is a human allelic variant thereof having at least 98% sequence identity to the sequence of amino acids set forth in any of SEQ ID NOs: 305-309.
303. the STING protein is a chimera comprising a replacement of the C-terminal tail (CTT) region in a STING protein from a first species with CTT from a STING protein from a second species; the STING protein of the second species has NF-κB signaling activity that is lower than the NF-κB signaling activity of human STING; The TRAF6 binding site of CTT may be deleted; A modified STING protein according to any one of claims 300 to 302.
304. A modified STING protein according to any of claims 300 to 303, wherein the mutation is any of those associated with STING-associated vasculitis (SAVI), an autoinflammatory disease.
305. a chimeric modified stimulator of interferon genes (STING) protein comprising a replacement of a CTT (C-terminal tail) region in a STING protein from a first species with a CTT from a STING protein from a second species; the STING protein of the second species has NF-κB signaling activity that is lower than the NF-κB signaling activity of human STING; The TRAF6 binding site of CTT may be deleted; Modified STING protein.
306. A modified STING protein described in any of claims 303 to 305, wherein the human STING protein has a sequence set forth in any of SEQ ID NOs: 305 to 309 or is a human allelic variant thereof having at least 98% sequence identity to the amino acid sequence set forth in any of SEQ ID NOs: 305 to 309.
307. A modified STING protein described in any of claims 303 to 306, wherein the first species is human and the second species is selected from Tasmanian devil, marmoset, cow, cat, ostrich, wild boar, bat, manatee, ibis, coelacanth, mouse, and chimaera shark.
308. A modified STING protein according to any one of claims 300 to 307, having type I IFN signaling activity that is at least or at least about 30% of the activity of wild-type human STING protein.
309. A modified STING protein according to any of claims 300 to 308, having NF-κB signaling activity that is less than 30%, less than 20%, less than 15%, less than 10%, or less than 5% of wild-type human STING NF-κB signaling activity.
310. A modified STING protein described in any of claims 300 to 309, wherein the non-human species or second species is selected from among Tasmanian devil, marmoset, cow, cat, ostrich, wild boar, bat, manatee, ibis, coelacanth, mouse, and chimaera shark.
311. A modified STING protein described in any of claims 300 to 310, wherein the STING modification is a mutation that corresponds to a mutation that occurs in interferonosis by reference to and alignment with human STING, and the aligned human STING sequence is set forth in SEQ ID NOs: 305 to 309.
312. A modified STING protein described in any of claims 300 to 311, comprising a replacement of the C-terminal tail (CTT) with CTT from a STING protein having reduced NF-κB signaling activity compared to the NF-κB signaling activity of human STING.
313. The modified STING protein of claim 312, wherein the replacing CTT is derived from Tasmanian devil, marmoset, cow, cat, ostrich, wild boar, bat, manatee, ibis, coelacanth, mouse, and chimaera STING protein.
314. The modified STING protein of claim 312, wherein the replacing CTT is derived from Tasmanian devil, marmoset, cow, cat, ostrich, wild boar, bat, manatee, ibis, coelacanth, mouse, and chimaera STING protein, and replaces human STING CTT.
315. The replacing CTT is selected from the following species and has the following sequence: Tasmanian devil RQEEFAIGPKRAMTVTTSSTLSQEPQLLISGMEQPLSLRTDGF SEQ ID NO: 371, Marmoset EEEEVTVGSLKTSEVPSTSTMSQEPELLISGMEKPLPLRSDLF SEQ ID NO: 372, Bovine EREVTMGSTETSVMPGSSVLSQEPELLISGLEKPLPLRSDVF SEQ ID NO: 373, Cat EREVTVGSVGTSMVRNPSVLSQEPNLLISGMEQPLPLRTDVF SEQ ID NO: 374, Ostrich RQEEYTVCDGTLCSTDLSLQISESDLPQPLRSDCL SEQ ID NO: 375, Wild boar EREVTMGSAETSVVPTSSTLSQEPELLISGMEQPLPLRSDIF SEQ ID NO: 376, Bat EKEEVTVGTVGTYEAPGSSTLHQEPELLISGMDQPLPLRTDIF SEQ ID NO: 377, Manatee EREEVTVGSVGTSVVPSPSSPSTSSLSQEPKLLISGMEQPLPLRTDVF SEQ ID NO: 378, Toki CHEEYTVYEGNQPHNPSTTLHSTELNLQISESDLPQPLRSDCF SEQ ID NO: 379, coelacanth (Variant 1) QKEEYFMSEQTQPNSSSTSCLSTEPQLMISDTDAPHTLKRQVC SEQ ID NO: 380, coelacanth (Variant 2) QKEEYFMSEQTQPNSSSTSCLSTEPQLMISDTDAPHTLKSGF SEQ ID NO: 381, Chimaera LTEYPVAEPSNANETDCMSSEPHLMISDDPKPLRSYCP SEQ ID NO: 383, and Mouse EKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI SEQ ID NO: 384, or allelic variants thereof having at least 98% sequence identity with each of these sequences. A modified STING protein as described in claim 313 or claim 314, having the following structure:
316. A modified STING protein as described in claim 314 or claim 315, wherein the human CTT comprises the sequence EKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS (sequence number 370) or is an allelic variant having at least 98% sequence identity thereto.
317. A modified STING protein according to any one of claims 305 to 316, wherein the modified STING protein is a chimera in which the human STING CTT is replaced with a CTT derived from Tasmanian devil STING.
318. A modified STING protein as described in claim 317, wherein the C-terminal tail (CTT) derived from Tasmanian devil STING comprises the sequence RQEEFAIGPKRAMTVTTSSTLSQEPQLLISGMEQPLSLRTDGF (sequence number 371) or is an allelic variant having at least 98% sequence identity thereto.
319. A modified STING protein according to any one of claims 300 to 318, comprising a deletion or disruption of the TRAF6 binding site.
320. The modified STING protein of claim 319, wherein the STING protein is a human STING protein and the TRAF6 binding site comprises the amino acid residues DFS at the C-terminus.
321. A modified STING protein according to any one of claims 300 to 320, comprising a modification that increases type I interferon signaling activity or makes the activity constitutive in the absence of intracytoplasmic nucleic acid.
322. A modified STING protein as described in claim 321, wherein the modifications correspond to mutations that occur in interferonosis by reference to and alignment with human STING, and the human STING protein has a sequence set forth in any of SEQ ID NOs: 305 to 309.
323. The modifications are as follows: S102P, V147L, V147M, N154S, V155M, G166E, C206Y, G207E, S102P / F279L, F279L, R281Q, R284G, R284S, R284M, R284K, R284T, R197A, D205A, R310A, R293A, T294A, E296A, R197A / D205A, S272A / Q273A, R310A / E31 323. The modified STING protein of any one of claims 300 to 322, wherein the one or more amino acid substitutions correspond to one or more of: S358A / E360A / S366A, D231A / R232A / K236A / R238A, S358A, E360A, S366A, R238A, R375A, and S324A / S326A.
324. A modified STING protein according to claim 323, comprising a substitution corresponding to C206Y or R284G, with reference to the sequence of human STING set forth in any of SEQ ID NOs: 305 to 309 for alignment.
325. A modified STING protein as described in claim 324, comprising a substitution corresponding to N154S / R284G.
326. The modified STING protein of claim 300 is a Tasmanian devil, marmoset, cow, cat, ostrich, wild boar, bat, manatee, ibis, coelacanth, mouse, and chimaera STING protein.
327. A delivery vehicle comprising a nucleic acid encoding a modified STING protein of any one of claims 300 to 326.
328. A delivery vehicle comprising a nucleic acid encoding a STING protein derived from a non-human species, wherein the STING protein has type I IFN signaling activity and attenuated NF-κB signaling activity compared to the NF-κB signaling activity of human STING.
329. The delivery vehicle of claim 328, wherein the human STING protein has a sequence set forth in any one of SEQ ID NOs: 305-309 or is a human allelic variant thereof having at least 98% sequence identity to the amino acid sequence set forth in any one of SEQ ID NOs: 305-309.
330. The delivery vehicle of claim 328 or claim 329, wherein the type I IFN signaling activity is at least or at least about 30% of the type I IFN signaling activity of wild-type human STING.
331. A delivery vehicle described in any of claims 327 to 330, wherein the NF-κB signaling activity of the non-human STING protein is less than 30%, less than 20%, less than 15%, less than 10%, or less than 5% of the NF-κB signaling activity of human STING.
332. 332. The delivery vehicle of any one of claims 327 to 331, wherein the non-human species is Tasmanian devil, marmoset, cow, cat, ostrich, wild boar, bat, manatee, ibis, coelacanth, mouse, and chimaera shark.
333. 333. The delivery vehicle of any of claims 327-332, which is a cell, an exosome, an oncolytic virus or viral vector, a liposome or other lipid-based vehicle, or an immunostimulatory bacterium.
334. The delivery vehicle of claim 333, wherein the delivery vehicle is a cell that is a stem cell or an immune cell.
335. The delivery vehicle of claim 333, wherein the delivery vehicle is the immunostimulatory bacteria of any of claims 26-243.
336. Immunostimulatory bacteria are ansB - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), and pagP - The delivery vehicle of claim 335,
337. Immunostimulatory bacteria are ansB - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), pagP - , lppA - , and lppB - The delivery vehicle of claim 335,
338. An immunostimulatory bacterium comprising a plasmid encoding a modified STING protein described in any one of claims 300 to 326 or encoding a STING protein derived from a non-human species, wherein the encoded STING protein has type I IFN signaling activity and attenuated NF-κB signaling activity compared to the NF-κB signaling activity of human STING.
339. ansB - , asd - , csgD - , purI - , msbB - , flagellin - and the wild-type bacterium has flagella and pagP - The immunostimulatory bacterium of claim 338,
340. ansB - , asd - , csgD - , purI - , msbB - , flagellin - (fliC - / fljB - ), where wild-type bacteria have flagella and pagP - , lppA - And lppB - The immunostimulatory bacterium of claim 338,
341. The immunostimulatory bacterium of any one of claims 338 to 340, wherein the non-human species is selected from among Tasmanian devil, marmoset, cow, cat, ostrich, wild boar, bat, manatee, ibis, coelacanth, mouse, and chimaera shark.
342. The immunostimulatory bacterium of any of claims 338-341 or the delivery vehicle of any of claims 327-337, wherein the immunostimulatory bacterium is a gram-negative bacterium.
343. 342. The immunostimulatory bacterium of any of claims 338 to 342 or a delivery vehicle of any of claims 327 to 337, wherein the immunostimulatory bacterium is a strain of the genus Salmonella, Shigella, Escherichia coli, Bifidobacteriae, Rickettsia, Vibrio, Listeria, Klebsiella, Bordetella, Neisseria, Aeromonas, Francisella, Cholera, Corynebacterium, Citrobacter, Chlamydia, Haemophilus, Brucella, Mycobacterium, Mycoplasma, Legionella, Rhodococcus, Pseudomonas, Helicobacter, Bacillus, or Erysipelothrix, or an attenuated or modified strain thereof of any of the preceding lists of bacterial strains.
344. Immunostimulatory bacteria include Rickettsia rickettsiae, Rickettsia typhi, Rickettsia tsutsugamushi, Rickettsia typhi, Rickettsia sibirica, Bordetella bronchiseptica, Neisseria meningitidis, Neisseria gonorrhoeae, Aeromonas eucleophila, Aeromonas salmonicida, Francisella tularensis, Mycobacterium pseudotuberculosis, Citrobacter freundii, Chlamydia pneumoniae, Haemophilus somnus, Brucella 342. The immunostimulatory bacterium of any of claims 338-342 or the delivery vehicle of any of claims 327-337 which is Bacillus abortus, Mycobacterium intracellulare, Legionella pneumophila, Rhodococcus equi, Pseudomonas aeruginosa, Helicobacter mustelae, Vibrio cholerae, Bacillus subtilis, Erysipelothrix rhusiopathiae, Yersinia enterocolitica, Roshalimea quintana, or Agrobacterium tumefaciens, or an attenuated or modified strain thereof of any of the preceding listed bacterial strains.
345. The immunostimulatory bacterium of any of claims 338-342 or the delivery vehicle of any of claims 327-337, wherein the immunostimulatory bacterium is an attenuated bacterium.
346. The immunostimulatory bacterium of any of claims 338-342 or the delivery vehicle of any of claims 327-337, wherein the bacterium is a strain of the genus Salmonella.
347. The immunostimulatory bacterium or delivery vehicle of claim 346, wherein the bacterium is a Salmonella typhimurium strain.
348. The immunostimulatory bacterium or delivery vehicle of claim 346 or claim 347, wherein the unmodified Salmonella is a wild-type strain.
349. The immunostimulatory bacterium or delivery vehicle of claim 346 or claim 347, wherein the unmodified Salmonella strain is attenuated.
350. 350. The immunostimulatory bacterium or delivery vehicle of any of claims 327 to 349, wherein the immunostimulatory bacterium is derived from strain AST-100 (VNP20009 or YS1646) or strain ATCC14028 or a strain having all of the identifying characteristics of strain ATCC14028.
351. A pharmaceutical composition comprising a modified STING protein of any of claims 300-326, or a delivery vehicle of any of claims 327-337, or an immunostimulatory bacterium of any of claims 338-350 in a pharmaceutically acceptable vehicle.
352. An isolated cell comprising a modified STING protein described in any one of claims 300-326, or a delivery vehicle described in any one of claims 327-337, or an immunostimulatory bacterium described in any one of claims 338-350, wherein the cell is not a zygote of a human fertilized egg.
353. 353. The cell of claim 352, which is an immune cell, a stem cell, a tumor cell, or a primary cell line.
354. 351. An isolated cell or culture comprising the immunostimulatory bacterium of any of claims 338-350.
355. A cell described in claim 353 or claim 354 which is a hematopoietic cell.
356. The cell of claim 355, which is a T cell.
357. The cell of any of claims 352-356, produced ex vivo by infecting the cell with an immunostimulatory bacterium or delivery vehicle.
358. The cell of claim 357, which is a T cell or a hematopoietic cell.
359. A method of treating cancer comprising administering to a subject having cancer that comprises a solid tumor or is a hematological tumor, a modified STING protein of any of claims 300-326, or a delivery vehicle of any of claims 327-337, or an immunostimulatory bacterium of any of claims 338-350, or a pharmaceutical composition of claim 351, or a cell of any of claims 352-358.
360. 360. The method of claim 359, wherein the cancer comprises a solid tumor.
361. The method of claim 359 or claim 360, wherein the cancer is metastatic.
362. 362. The method of any of claims 359-361, wherein the cancer is selected from among lymphoma; leukemia; gastric cancer; and cancer of the breast, heart, lung, small intestine, colon, spleen, kidney, bladder, head and neck, colorectal, ovary, prostate, brain, pancreas, skin, bone, bone marrow, blood, thymus, uterus, testicle, cervix, and liver.
363. Use of a modified STING protein according to any of claims 300-326, or a delivery vehicle according to any of claims 327-337, or an immunostimulatory bacterium according to any of claims 338-350, or a pharmaceutical composition according to claim 351, or a cell according to any of claims 352-358 for the treatment of cancer.
364. The use of claim 363, wherein the cancer comprises a solid tumor or a hematological tumor.
365. The use of claim 363 or claim 364, wherein the cancer is metastatic.
366. 366. The use of any of claims 363 to 365, wherein the cancer is selected from among lymphoma; leukemia; gastric cancer; and cancer of the breast, heart, lung, small intestine, colon, spleen, kidney, bladder, head and neck, colorectal, ovary, prostate, brain, pancreas, skin, bone, bone marrow, blood, thymus, uterus, testicle, cervix, and liver.
367. A modified STING protein, delivery vehicle, immunostimulatory bacterium, pharmaceutical composition, cell, method, or use described in any of claims 300 to 366, wherein the non-human STING protein has an amino acid sequence set forth in any of SEQ ID NOs: 349, 356, or 359-369, or is an allelic variant of a STING protein having at least 98% sequence identity to the amino acid sequence set forth in any of SEQ ID NOs: 349, 356, or 359-369.
368. A modified STING protein, delivery vehicle, immunostimulatory bacterium, pharmaceutical composition, cell, method, or use described in any of claims 300 to 366, wherein the non-human STING protein or chimera has an amino acid sequence set forth in any of SEQ ID NOs: 350 to 355, 357, or 358.
369. 10. A method of converting M2 macrophages to an M1 or M1-like phenotype, comprising administering the immunostimulatory bacteria of any of claims 26-243 and 338-350 to a subject having a condition, disease, or disorder that is treated by enhancing an anti-tumor immune response.
370. 10. Use of the immunostimulatory bacteria of any of claims 26 to 243 and 338 to 350 or the immunostimulatory bacteria of any of claims 25 to 343 and 338 to 350 for use in converting M2 macrophages to M1 or M1-like phenotype macrophages in a subject with cancer, thereby inducing or enhancing an anti-tumor immune response.
371. The method of claim 369 or the use or bacterium of claim 370, wherein the disease, disorder, or condition is cancer, including solid tumors.
372. An isolated cell comprising the immunostimulatory bacterium of any of claims 26-243 and 338-350.
373. The cell of claim 372, which is an immune cell or a stem cell.
374. The cell of claim 373, wherein the cell is a stem cell that is not an embryonic stem cell.
375. The cell described in claim 373, which is a T cell.
376. The cell of claim 375, which is a CAR-T cell.
377. A method of treating cancer comprising administering the cells of any of claims 372-376.
378. A cell according to any one of claims 372 to 376 for use in treating cancer.
379. Use of a cell according to any one of claims 372 to 376 for the treatment of cancer.
Citation Information
Patent Citations
Immunostimulatory bacterial delivery platform and its use for the delivery of therapeutic products - Patent Application 20070122999
JP2023501539A
Microorganisms programmed to produce immune modulators and Anti-cancer therapeutics in tumor cells
WO2018129404A1
Combinatorial cancer immunotherapy
WO2018191619A1
Engineered immunostimulatory bacterial strains and uses thereof
WO2019014398A1
Compositions and methods for modulating sting protein
WO2019035901A1