Novel scaffold HIV-1 vaccine immunogen
A novel HIV-1 vaccine immunogen using a self-assembling nanoparticle with a T-helper epitope stabilizes the HIV-1 Env-derived trimer, enhancing T-cell recognition and B-cell responses, addressing the challenge of developing effective HIV-1 vaccines by inducing potent neutralizing antibodies.
Patent Information
- Application Number
- JP2020524049
- Authority / Receiving Office
- JP · JP
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2017-11-01
- Filing Date
- 2018-10-31
- Publication Date
- 2025-08-28
- Estimated Expiration
- 2038-10-31
AI Technical Summary
Current HIV-1 vaccine development has been hindered by the unstable nature of the HIV-1 envelope glycoprotein (Env) trimers, making it difficult to develop effective trimer-based vaccines, and the utility of nanoparticles as carriers for displaying native-like trimers has not been fully explored.
A novel HIV-1 vaccine immunogen comprising an HIV-1 Env-derived trimeric protein presented on a self-assembling nanoparticle with a T-helper epitope sequence, where the epitope is linked to the C-terminus of the HIV-1 trimeric protein subunit at the N-terminus of the nanoparticle subunit, forming a hydrophobic core to stabilize the nanoparticle structure and promote T-cell recognition.
The novel HIV-1 vaccine immunogen induces robust T-cell responses and directs B-cell development toward broadly neutralizing antibodies, demonstrating rapid development of tier-2 neutralizing antibodies and balanced T and B-cell responses, making it the most potent HIV-1 vaccine candidate identified to date.
Smart Images

Figure 0007730640000001 
Figure 0007730640000002 
Figure 0007730640000003
Abstract
Description
[Technical Field]
[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This patent application claims the benefit of priority to U.S. Provisional Patent Application No. 62 / 580,038, filed November 1, 2017, currently pending. The complete disclosure of the priority application is incorporated herein by reference in its entirety for all purposes.
[0002] Government support statement This invention was made with government support under Grant Nos. AI129698, AI125078 and AI124337 awarded by the National Institutes of Health, and Grant No. DE-AC02-76F00515 awarded by the U.S. Department of Energy. The government has certain rights in this invention. [Background technology]
[0003] Human immunodeficiency virus type 1 (HIV-1) is the primary cause of acquired immune deficiency syndrome (AIDS). HIV-1 can be divided into several distinct clades, including A, B, C, D, E, F, G, H, J, and K, which vary in prevalence worldwide. Each clade consists of different HIV-1 strains grouped based on genetic similarity. The HIV-1 envelope glycoprotein (Env) contains epitopes for broadly neutralizing antibodies (bNAb) and is the sole target for vaccine design. Cleaved and mature Envs are displayed on the surface of HIV-1 virions as metastable trimers of heterodimers, each containing the (co)receptor-binding protein gp120 and the transmembrane protein gp41, which anchors the trimeric spike to the viral membrane and facilitates the fusion process during cellular transport. Due to its unstable nature and dense layer of surface glycans, determining the structure of Env has long been difficult, hindering efforts to develop trimer-based vaccines.
[0004] Native-like Env trimers are considered a desirable vaccine platform due to the encouraging success achieved recently by the BG505 SOSIP.664 trimer. In addition to SOSIP, other trimer design platforms that have generated native-like Env trimers have also been proposed, including single-chain gp140 (sc-gp140) trimers, native flexibly linked (NFL) trimers, and uncleaved prefusion-optimized (UFO) trimers. However, gp140 trimers may not be the optimal format for HIV-1 vaccines because subunit vaccines, which display dense arrays of antigens on the particle surface and induce potent and long-lasting immune responses upon vaccination, are often less immunogenic than virus-like particles (VLPs). Summary of the Invention [Problem to be solved by the invention]
[0005] Despite growing recognition of the benefits of VLP vaccines in eliciting bNAb, the utility of nanoparticles as carriers for displaying native-like trimers has not been rigorously explored in HIV-1 vaccine development. There remains an unmet medical need for a safe and effective HIV-1 vaccine. The present invention addresses this and other needs in the art. [Means for solving the problem]
[0006] In one aspect, the present invention provides an HIV-1 vaccine immunogen. The novel HIV-1 vaccine immunogen of the present invention comprises an HIV-1 Env-derived trimeric protein presented on a self-assembling nanoparticle and a T-helper epitope sequence. In some embodiments, the T-helper epitope is linked to the C-terminus of the HIV-1 trimeric protein subunit at the N-terminus of the nanoparticle subunit. In other embodiments, the T-helper epitope sequence is fused to the C-terminus of the nanoparticle subunit, while the C-terminus of the HIV-1 trimeric protein is fused to the N-terminus of the nanoparticle subunit. In some of the latter embodiments, a short peptide spacer is used to fuse the T-helper epitope to the nanoparticle subunit. This allows for the formation of a hydrophobic core within the nanoparticle, which functions to stabilize the nanoparticle structure and promote T-cell recognition of the fused immunogen. In some of these embodiments, the short peptide spacer used can be, for example, one to five tandem repeats of GGGGS (SEQ ID NO: 4) or GSGSG (SEQ ID NO: 19), or any other peptide sequence that is essentially structurally flexible. In some of these embodiments, an additional short peptide segment or spacer can be used to fuse the HIV-1 protein to the N-terminus of the nanoparticle subunit, such as a 1G linker or any of the other short peptide spacers described herein. In some embodiments, the T helper epitope sequence comprises the amino acid sequence set forth in any one of SEQ ID NOs: 1-3, a conservatively modified variant thereof, or a substantially identical sequence.
[0007] Typically, self-assembled nanoparticles of HIV-1 vaccine immunogens are generated using a trimeric protein sequence. In some embodiments, the subunits of the self-assembled nanoparticles are (1) the polypeptide set forth in SEQ ID NO: 18, a conservatively modified variant thereof, or a substantially identical sequence, (2) the polypeptide set forth in any one of SEQ ID NOs: 5-17, a conservatively modified variant thereof, or a substantially identical sequence, (3) E2p, or (4) ferritin.
[0008] In various embodiments, the HIV-1 Env-derived trimeric protein in the vaccine immunogen of the invention is a gp140 trimer. In some embodiments, the HIV-1 Env-derived trimeric protein used is an uncleaved prefusion optimized (UFO) gp140 trimer. In some of these embodiments, the UFO gp140 trimer is a modified gp41 trimer derived from HIV-1 strain BG505. ECTO Some HIV-1 vaccine immunogens of the present invention comprise an HIV-1 Env-derived trimer that is a UFO gp140 trimer, self-assembled nanoparticles produced using a subunit sequence set forth in any one of SEQ ID NOS: 5-18, and a T helper epitope comprising the sequence set forth in SEQ ID NO: 1.
[0009] In another aspect, the present invention provides an HIV-1 vaccine immunogen comprising an HIV-1 Env-derived trimeric protein displayed on self-assembled nanoparticles formed by subunit polypeptides set forth in any one of SEQ ID NOS: 5-18, conservatively modified variants thereof, or substantially identical sequences. In some embodiments, the HIV-1 Env-derived trimeric protein used is an uncleaved prefusion optimized (UFO) gp140 trimer. In some of these embodiments, the UFO gp140 trimer is a modified gp41 trimer derived from HIV-1 strain BG505. ECTOThe UFO gp140 trimeric subunit is a chimeric trimer containing a domain. In some embodiments, the HIV-1 trimeric protein in the HIV-1 vaccine immunogen is linked at its C-terminus to the N-terminus of the nanoparticle via a linker sequence. In some other embodiments, the linker sequence is fused to the C-terminus of the nanoparticle subunit via a short peptide spacer to form a hydrophobic core inside the nanoparticle, while the UFO gp140 trimeric subunit is fused to the N-terminus of the nanoparticle subunit. This serves to stabilize the nanoparticle structure and facilitate T cell recognition of the trimeric immunogen. In some of these embodiments, the short peptide spacer used can be, for example, GGGGS (SEQ ID NO: 4), GSGSG (SEQ ID NO: 19), or any other peptide that is essentially structurally flexible. In various embodiments, the linker sequence used comprises a T helper epitope sequence or a glycine-serine linker. In some embodiments, the linker sequence comprises a peptide sequence set forth in any one of SEQ ID NOs: 1-3, a conservatively modified variant thereof, or a substantially identical sequence. In some embodiments, the linker sequence comprises 1 to 5 tandem repeats (e.g., 1 or 2 repeats) of GGGGS (SEQ ID NO: 4) or GSGSG (SEQ ID NO: 19). In some embodiments, as exemplified herein, an additional short peptide spacer or segment can be used to fuse an HIV-1 protein to the N-terminus of the nanoparticle subunit.
[0010] In a related aspect, the present invention provides pharmaceutical compositions containing one of the novel scaffold HIV-1 vaccine immunogens described herein. Pharmaceutical compositions typically also contain a pharmaceutically acceptable carrier. In some embodiments, the pharmaceutical composition further contains an adjuvant. In another related aspect, the present invention provides isolated or recombinant polynucleotides encoding the HIV-1 vaccine immunogens described herein, cloning and expression vectors containing such polynucleotide sequences, and host cells into which the nucleic acid or vector has been introduced or incorporated.
[0011] In another aspect, the present invention provides methods for preventing HIV-1 infection in a subject or inducing an immune response against HIV-1 in a subject. These methods involve administering to the subject a therapeutically effective amount of one of the novel scaffold HIV-1 vaccine immunogens described herein. Typically, the HIV-1 vaccine immunogen is administered to the subject via a pharmaceutical composition. In some embodiments, the administered HIV-1 vaccine immunogen comprises a UFO gp140 trimer, self-assembled nanoparticles generated using the subunit sequence set forth in SEQ ID NO: 18, and a T-helper epitope sequence set forth in SEQ ID NO: 1. In these embodiments, the T-helper epitope sequence functions to covalently link the UFO gp140 trimer at its C-terminus to the N-terminus of the nanoparticle subunit. Alternatively, the T-helper epitope sequence is fused to the C-terminus of the nanoparticle subunit via a short peptide spacer, while the UFO gp140 trimeric subunit is fused to the N-terminus of the nanoparticle subunit.
[0012] In another aspect, the present invention provides methods for treating HIV-1 infection in a subject or inducing an immune response against HIV-1 in a subject. Generally, the methods include administering to the subject a pharmaceutical composition containing a therapeutically effective amount of an HIV-1 vaccine immunogen described herein. In some embodiments, the administered HIV-1 vaccine immunogen comprises a UFO gp140 trimer, self-assembled nanoparticles produced using the subunit sequence set forth in SEQ ID NO: 18, and a T-helper epitope sequence set forth in SEQ ID NO: 1. In these methods, the T-helper epitope sequence functions to covalently link the UFO gp140 trimer at its C-terminus to the N-terminus of the nanoparticle subunit. Alternatively, the T-helper epitope sequence is fused to the C-terminus of the nanoparticle subunit via a short peptide spacer, while the UFO gp140 trimeric subunit is fused to the N-terminus of the nanoparticle subunit.
[0013] A further understanding of the nature and advantages of the present invention may be realized by reference to the remaining portions of the specification and claims. [Brief explanation of the drawings]
[0014] [Figure 1]Ferritin nanoparticles displaying various UFO2-BG trimers and I3-01-based gp140 nanoparticles incorporating a T-help signal are shown. (A) Surface model of UFO2-BG gp140-ferritin (FR) nanoparticles, with gp120, UFO-designed BG505 gp41ECTO, and ferritin surrounded by dotted lines and indicated by arrows on the gp140-FR image. (B) BN-PAGE of eight UFO2-BG-FR nanoparticles after single-step 2G12 antibody affinity purification. (C) Reference-free 2D class averages derived from negative-stain EM of five representative UFO2-BG-FR nanoparticles. (D) Antigen profiles of five representative UFO2-BG-FR nanoparticles against a small panel of six bNAbs and four non-NAbs. Sensorgrams were acquired on an Octet RED96 using an antigen titration series of six concentrations (starting at 35 nM with two-fold dilutions). The peak values at the highest concentrations are summarized in a matrix, and six bNAbs and four non-NAbs are shown in the upper and lower panels, respectively. Higher gray shading indicates greater binding signals measured by Octet. (E) A surface model of the I3-01 nanoparticle (light gray) is shown on the left. The subunits surrounding the five-fold axis on the front are highlighted in dark gray, and the three subunits forming the three-fold axis are indicated by a black dotted triangle. The spacing between the N-termini of the three I3-01 subunits surrounding the three-fold axis (top view) and the anchoring of the gp140 trimer to the three I3-01 subunits by a flexible linker (indicated by a black dotted line) are shown in the center. A schematic diagram of the I3-01 nanoparticle construct containing both gp140 and T-helper epitopes is shown on the right, listing the sequences for three such T-helper epitopes: PADRE, D, and TpD (SEQ ID NOs: 1-3, respectively). (F) SEC profiles of three I3-01 nanoparticles displaying HR1-redesigned BG505 gp140 trimers with different T-helper epitopes as linkers. (G) BN-PAGE of the above three I3-01 nanoparticles after single-step 2G12 affinity antibody purification.(H) Reference-free 2D class averages derived from negative-stain EM of I3-01 nanoparticles displaying HR1-redesigned BG505 gp140 trimers with PADRE used as a linker. (I) Antigen profiles of gp140-PADRE-I3-01 nanoparticles against a small panel of six bNAbs and four non-NAbs. Sensorgrams were acquired on an Octet RED96 using an antigen titration series of six concentrations (starting at 14 nM with two-fold dilutions). The six antigen concentrations corresponding to the six lines from top to bottom for each of the 10 antibody profiles are shown next to the PGT151 binding profile on the right. [Figure 2] Effective B cell activation by trimer-presenting nanoparticles. Ca2+ mobilization in B cell transfectants carrying (A) PGT145, (B) PGT121, and (C) VRC01 receptors. WEHI231 cells expressing a doxycycline-inducible bNAb B cell receptor (BCR) were stimulated with 10 μg ml-1 of anti-BCR antibodies or the indicated antigens (anti-human Ig κ-chain F(ab')2; anti-mouse IgM; UFO2-BG-FR nanoparticles derived from clade A, B, C, B / C, or A / E strains; or BG505 gp140-PADRE-I3-01 nanoparticles containing a redesigned HR1 bend within gp41ECTO). [Figure 3]Initial neutralizing antibody responses to trimers and nanoparticles upon mouse immunization are shown. (A) A schematic diagram of the mouse immunization protocol is shown on the left, with key formulation and immunization parameters listed in the center and the serum IgG purification protocol listed on the right. (B) Testing of the BG505 trimer-based immunogen and ELISA binding of purified mouse serum IgG to three HIV-1 antigens (BG505 UFO trimer, ferritin nanoparticles displaying an N332 scaffold (1GUT_A_ES-FR) or I3-01 nanoparticles displaying an alternative N332 scaffold (1KIG_L_ES-2-I3-01), and clade-C V1V2-ferritin nanoparticles (V1V2-FR)). EC50 values are displayed for all ELISA plots except when the highest OD450 value is below 0.1 or in cases of ambiguous data fitting. (C) HIV-1 neutralization by purified mouse serum IgG. IC50 values are shown in shades of gray. Higher intensity of gray indicates stronger neutralization. (D) Neutralization profile of group-combined mouse serum IgG obtained from the scaffold trimer group (S1G5). (E) Neutralization profile of group-combined mouse serum IgG and mouse A serum IgG obtained from the ferritin nanoparticle group (S2G1). (F) Neutralization profile of group-combined mouse serum IgG, mouse A, and mouse D serum IgG obtained from the I3-01 nanoparticle group (S2G5). Two HIV-1 pseudoviruses, clade A tier-2 BG505 and clade B tier-1 SF162, were tested, including MLV for comparison. Structural models of the scaffold gp140 trimer, ferritin nanoparticle, and I3-01 nanoparticle are shown next to the group-combined mouse serum IgG neutralization profiles. [Figure 4]Design concept, SEC profile, and negative-stain EM images of HIV-1 gp140 trimer-displaying nanoparticles with T-helper epitopes fused to the C-terminus of the nanoparticle subunits are shown. (A) Schematic of the E2p and I3-01 nanoparticle design with pan-reactive T-helper epitopes fused to the C-terminus of the nanoparticle subunits. (B) SEC profile of BG505 gp140 trimer-displaying E2p and I3-01 nanoparticles obtained from a Superose 6 10 / 300 GL column after purification using a 2G12 antibody affinity column. (C) Raw micrograph of BG505 gp140 trimer-displaying E2p and I3-01 nanoparticles obtained from negative-stain EM. DETAILED DESCRIPTION OF THE INVENTION
[0015] I. overview The present invention is based, in part, on the inventors' development of novel HIV-1 gp140 nanoparticle immunogens. As detailed in the Examples herein, the inventors utilized a T-helper epitope that not only acts as a linker between gp140 and the display nanoparticle scaffold but also acts as an integrated T-help signal to elicit robust T cell responses and direct B cell development toward bNAbs. The inventors further explored a previously unutilized protein (1VLW) to provide a stable nanoparticle scaffold for the display of HIV-1 gp140 trimers. Various scaffold HIV-1 gp140 immunogens exhibit excellent purity and homogeneity when purified using affinity columns and size-exclusion chromatography. The novel HIV-1 gp140 nanoparticles described herein exhibit an exceptional antigenic profile, with strong PG16 binding not observed with other known HIV-1 gp140 nanoparticles, when evaluated with bNAbs and non-NAbs. As further illustration, we investigated the immunogenicity of nanoparticles displaying BG505 gp140 trimers by immunizing mice and assessing the HIV-1 neutralizing activity of IgG isolated from the mice. Neutralization of the autologous tier-2 BG505.N332 HIV-1 virus was observed for two of the HIV-1 gp140 nanoparticles disclosed herein (S2G5 and S2G6) as well as control HIV-1 immunogens (scaffold gp140.681 trimer (S1G5) and ferritin nanoparticle (S2G1)). Importantly, the novel HIV-1 gp140 nanoparticle immunogen described herein produced IC50 values indicative of rapid development of tier-2 NAbs just 8 weeks after immunization, demonstrating balanced T and B cell responses, making it the most potent HIV-1 vaccine candidate identified to date.
[0016] Thus, the present invention provides novel scaffold HIV-1 vaccine immunogens bearing T-helper epitopes, as exemplified herein. The present invention also provides scaffold HIV-1 vaccine immunogens comprising stable nanoparticles formed by 1VLW mutants. The present invention further provides therapeutic and prophylactic uses of these novel scaffold HIV-1 immunogens for the treatment or prevention of HIV-1 infection.
[0017] Unless otherwise specified herein, the vaccine immunogens, encoding polynucleotides, expression vectors and host cells of the present invention, as well as related therapeutic applications, can all be produced or carried out according to procedures exemplified herein or routinely practiced methods well known in the art, see, for example, Methods in Enzymology, Volume 289: Solid-Phase Peptide Synthesis, JN Abelson, MI Simon, GB Fields (Editors), Academic Press; 1st edition (1997) (ISBN-13:978-0121821906); U.S. Patent Nos. 4,965,343 and 5,849,954; Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, NY, (3 rdBrent et al., Current Protocols in Molecular Biology, John Wiley&Sons, Inc (ringbou ed., 2003); Davis et al., Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc, New York, USA (1986); or Methods in Enzymology: Guide to Molecular Cloning Techniques Vol 152, SL Berger and AR Kimmerl Eds, Academic Press Inc, San Diego, USA (1987); Current Protocols in Protein Science (CPPS) (John E Coligan, et.al., ed, John Wiley and Sons, Inc), Current Protocols in Cell Biology (CPCB) (Juan S Bonifacino et.al. ed., John Wiley and Sons, Inc), and Culture of Animal Cells: A Manual of Basic Technique by R Ian Freshney,Publisher:Wiley-Liss;5th See, for example, "Methods in Cell Biology, Vol. 57, Jennie P Mather and David Barnes editors, Academic Press, 1st edition, 1998," in "Animal Cell Culture Methods" (Methods in Cell Biology, Vol. 57, Jennie P Mather and David Barnes editors, Academic Press, 1st edition, 1998). The following sections provide additional guidance for practicing the compositions and methods of the present invention.
[0018] II. definition Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. The following references provide those skilled in the art with general definitions of many of the terms used in this invention: Academic Press Dictionary of Science and Technology, Morris (Ed.), Academic Press (1999). st ed,1992);Oxford Dictionary of Biochemistry and Molecular Biology,Smith et al.(Eds),Oxford University Press(revised ed,2000);Encyclopaedic Dictionary of Chemistry,Kumar(Ed),Anmol Publications Pvt Ltd(2002);Dictionary of Microbiology and Molecular Biology,Singleton et al.(Eds),John Wiley&Sons(3 rd ed,2002);Dictionary of Chemistry,Hunt(Ed),Routledge(1 st ed,1999); Dictionary of Pharmaceutical Medicine, Nahler(Eds), Springer-Verlag Telos(1994); Dictionary of Organic Chemistry, Kumar and Anandand(Eds), Anmol Publications Pvt Ltd(2002); and A Dictionary of Biology(Oxford Paperback Reference), Martin and Hine(Eds), Oxford University Press(4 th ed., 2000). Further clarification of some of these terms that apply specifically to the present invention is provided herein.
[0019] As used herein, the singular forms "a," "an," and "the" refer to both the singular and the plural unless the context clearly indicates otherwise. For example, "Env-derived trimer" can refer to both a single or multiple Env-derived trimer molecules and can be considered equivalent to the phrase "at least one Env-derived trimer."
[0020] Unless otherwise specified, the terms "antigen" and "immunogen" are used interchangeably to refer to a substance, typically a protein, that can elicit an immune response in a subject. The term also refers to a protein that is immunologically active, in the sense that once administered to a subject (either directly or by administering to the subject a nucleotide sequence or vector encoding the protein), it can elicit a humoral and / or cellular immune response directed against the protein. Thus, in some embodiments, the term "immunogen" can broadly encompass a polynucleotide that encodes a polypeptide or protein antigen described herein.
[0021] The term "conservatively modified variants" applies to both amino acid and nucleic acid sequences. With respect to a particular nucleic acid sequence, conservatively modified variants refer to nucleic acids that encode identical or essentially identical amino acid sequences, or, if the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Due to the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. With respect to polypeptide sequences, "conservatively modified variants" refer to variants with conservative amino acid substitutions (amino acid residues substituted with other amino acid residues having side chains with similar charges). Families of amino acid residues with side chains having similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0022] Epitope refers to an antigenic determinant. These are specific chemical groups or peptide sequences on a molecule that are antigenic enough to induce a specific immune response. For example, an epitope is the region of an antigen to which B cells and / or T cells respond. Epitopes can be formed from both contiguous or non-contiguous amino acids juxtaposed by tertiary folding of a protein.
[0023] An effective amount of a vaccine or other agent sufficient to produce a desired response, such as reducing or eliminating the signs or symptoms of a condition or disease, such as AIDS. For example, this can be the amount necessary to inhibit viral replication or measurably change an outward symptom of viral infection, such as an increase in T cell count in the case of HIV-1 infection. Generally, this amount is sufficient to measurably inhibit the replication or infectivity of a virus (e.g., HIV). When administered to a subject, a dosage that will achieve a target tissue concentration (e.g., in lymphocytes) shown to achieve in vitro inhibition of viral replication is generally used. In some examples, an "effective amount" is an amount that treats (including prevents) one or more symptoms and / or underlying causes of any of the disorders or diseases, e.g., for treating HIV. In one example, an effective amount is a therapeutically effective amount. In one example, an effective amount is an amount that prevents the onset of one or more signs or symptoms of a particular disease or condition, such as one or more signs or symptoms associated with AIDS.
[0024] Ferritin is a globular protein found in all animals, bacteria, and plants. Ferritin primarily acts to control the rate and location of polynuclear Fe(III)2O3 formation through the transport of hydrated iron ions and protons to and from the mineralized core. The globular form of ferritin is composed of monomeric subunit proteins (also called monomeric ferritin subunits), which are polypeptides with molecular weights of approximately 17-20 kDa.
[0025] As used herein, a fusion protein is a recombinant protein containing amino acid sequences from at least two unrelated proteins linked together via peptide bonds to form a single protein. The unrelated amino acid sequences can be linked directly to each other or can be linked using a linker sequence. As used herein, proteins are unrelated if their amino acid sequences are not normally found linked together via peptide bonds in their(s) natural environment(s) (e.g., intracellularly). For example, the amino acid sequences of the monomer subunits that make up ferritin and the amino acid sequences of the HIV-1 gp120 or gp41 glycoproteins are not normally found linked together via peptide bonds.
[0026] The HIV-1 envelope protein (Env) is initially synthesized as a relatively long precursor protein of 845–870 amino acids, called gp160. gp160 forms a homotrimer and undergoes glycosylation in the Golgi apparatus. In vivo, the gp160 glycoprotein is processed by endoproteolysis into the mature envelope glycoproteins gp120 and gp41, which then bind noncovalently to each other as a complex on the surface of the virus. The gp120 surface protein contains high-affinity binding sites for human CD4, the primary HIV receptor, as well as domains that interact with fusion coreceptors such as the chemokine receptors CCR5 and CXCR4. The gp41 protein spans the viral membrane and contains amino acid sequences at its amino terminus that are important for fusion of the viral membrane with the cellular membrane. The native fusion-permissive form of the HIV-1 envelope glycoprotein complex is a trimeric structure composed of three gp120 subunits and three gp41 subunits. The receptor binding (CD4 and co-receptor) sites are located in the gp120 portion, while the fusion peptide is located in the gp41 component. Exemplary sequences of wild-type gp160 polypeptides are shown in GenBank, for example, under accession numbers AAB05604 and AAD12142.
[0027] Gp140 refers to the oligomeric form of the HIV envelope protein, which contains both the gp120 and the entire gp41 ectodomain. As used herein, HIV-1 gp140 trimer immunogens typically contain the gp140 domain and a modified or redesigned ectodomain of gp140 (gp41 ECTO ) and
[0028] gp120 is the envelope protein of the human immunodeficiency virus (HIV). gp120 comprises most of the outer surface-exposed domain of the HIV envelope glycoprotein complex, and it is gp120 that binds to both the cellular CD4 receptor and cellular chemokine receptors (such as CCR5). The mature wild-type gp120 polypeptide has approximately 500 amino acids in its primary sequence. Gp120 is heavily N-glycosylated and has an apparent molecular weight of 120 kD. This polypeptide is composed of five conserved regions (C1-C05) and five highly variable regions (V1-V5). In its tertiary structure, the gp120 glycoprotein is composed of three major structural domains (the ectodomain, the endodomain, and the bridging sheet) and a variable loop. See, for example, Wyatt et al., Nature 393, 705-711, 1998 and Kwong et al., Nature 393, 649-59, 1998. The endodomain is thought to interact with the gp41 envelope glycoprotein, whereas the ectodomain is exposed on the assembled envelope glycoprotein trimer.
[0029] The variable region 1 and variable region 2 (V1 / V2 domains) of gp120 consist of approximately 50–90 residues, including two of the most variable parts of HIV-1 (the V1 and V2 loops), and one of every 10 residues in the V1 / V2 domain is N-glycosylated.
[0030] gp41 is a proteolytic product of the precursor HIV envelope protein. gp41 contains an N-terminal fusion peptide (FP), a transmembrane domain, and an ectodomain that connects the fusion peptide and the transmembrane domain. gp41 remains in a trimeric configuration and interacts non-covalently with gp120. The amino acid sequence of an exemplary gp41 is listed in GenBank under accession number CAD20975.
[0031] BG505 SOSIP.664 gp140 is an HIV-1 Env immunogen developed using a gp140 trimer from clade A strain BG505. It contains truncated gp120 and gp41. ECTO It contains a covalently engineered disulfide bond (termed SOS) between the gp41 and the HIV-1 spike. Furthermore, it contains the I559P mutation (termed IP) that destabilizes the gp41 postfusion conformation and a truncation of the membrane-proximal external region (MPER) at residue 664 that improves solubility. This HIV-1 immunogen possesses an exceptional antigenic profile and excellent structural mimicry of the native spike. Using the SOSIP trimer as a screening probe, novel bNAbs were identified and characterized. The SOSIP design has been extended to other HIV-1 strains, allowing the incorporation of additional stabilizing mutations. Recently, the immunogenicity of the SOSIP trimer in rabbits and nonhuman primates has been reported, paving the way for human vaccine trials.
[0032] An immune response refers to a response of a cell of the immune system, such as a B cell, T cell, or monocyte, to a stimulus. In some embodiments, the response is specific for a particular antigen (an "antigen-specific response"). In some embodiments, the immune response is a T cell response, such as a CD4+ response or a CD8+ response. In some other embodiments, the response is a B cell response, resulting in the production of specific antibodies.
[0033] An immunogenic composition refers to a composition comprising an immunogenic polypeptide that elicits a measurable CTL response against a virus expressing the immunogenic polypeptide or elicits a measurable B cell response (such as the production of antibodies) against the immunogenic polypeptide.
[0034] Sequence identity or similarity between two or more nucleic acid sequences or two or more amino acid sequences is expressed in terms of the identity or similarity between the sequences. Sequence identity can be measured as a percentage of identity, with higher percentages indicating more identical sequences. Two sequences are "substantially identical" when they have a specified percentage of identical amino acid residues or nucleotides (i.e., 60% identity over a specified region, or if not specified, over the entire sequence, sometimes 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity) when compared and aligned for maximum correspondence over a comparison window, or when specifying a region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Identity may exist over a region at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region 100 to 500 or 1000 or more nucleotides (or 20, 50, 200, or more amino acids) in length.
[0035] Homologs or orthologs of nucleic acid or amino acid sequences have a relatively high degree of sequence identity / similarity when aligned using standard methods. Methods for aligning sequences for comparison are well known in the art. Various programs and alignment algorithms are described in Smith & Waterman, Adv Appl Math 2:482, 1981; Needleman & Wunsch, J Mol Biol 48:443, 1970; Pearson & Lipman, Proc Natl Acad Sci USA 85:2444, 1988; Higgins & Sharp, Gene, 73:237-44, 1988; Higgins & Sharp, CABIOS 5:151-3, 1989; Corpet et al., Nuc Acids Res 16:10881-90, 1988; Huang et al. Computer Appls. in the Biosciences 8, 155-65, 1992; and Pearson et al., Meth Mol Bio 24:307-31, 1994. Altschul et al., J Mol Biol 215:403-10 1990, present a detailed discussion of sequence alignment methods and homology calculations.
[0036] The term "subject" refers to any animal classified as a mammal, for example, a human or non-human mammal. Examples of non-human animals include dogs, cats, cows, horses, sheep, pigs, goats, rabbits, etc. Unless otherwise specified, the terms "patient" or "subject" are used interchangeably herein. Preferably, the subject is a human.
[0037] The terms "treating" or "alleviating" include administering a compound or agent to a subject to prevent or delay the onset of symptoms, complications, or biochemical manifestations of a disease (e.g., HIV infection), alleviating symptoms, or arresting or inhibiting the further progression of a disease, condition, or disorder. Subjects in need of treatment include those already suffering from a disease or disorder and those at risk of developing a disorder. Treatment can be prophylactic suppression (to prevent or delay the onset of a disease or to prevent the manifestation of its clinical or subclinical symptoms), or therapeutic suppression or alleviation of symptoms after the manifestation of a disease.
[0038] The uncleaved prefusion optimized (UFO) trimer is a combination of the gp120 protein and a redesigned gp41 ECTO This refers to the HIV-1 gp140 trimeric protein formed by the redesigned gp41 domain, which results in a more stable HIV-1 gp140 trimer. ECTO The domains are based on the prototype HIV-1 strain BG505 (and the prototype gp140 trimer BG505 SOSIP664 gp140) and wild-type BG505 gp41 ECTO The UFO trimer contains one or more modifications to the sequence. These modifications include (1) replacing the 21-residue N-terminus of HR1 (residues 548-568) with a relatively short loop sequence to stabilize the pre-fusion gp140 structure, and (2) replacing the furin cleavage site between gp120 and gp41 (residues 508-511) with a flexible linker sequence, such as tandem repeats of the GGGGS (SEQ ID NO: 4) motif. In some embodiments, the UFO trimer may further include an engineered disulfide bond between gp120 and gp41 and / or a stabilizing mutation in gp41. For example, a UFO trimer based on HIV-1 strain BG505 can include an engineered disulfide bond between residues A501C and T605C and / or the stabilizing mutation I559P. A detailed description of the UFO trimer is described, for example, in Kong et al., Nat Comm 7:12040, 2016. In addition to the UFO trimer based on the BG505 strain sequence, engineered gp41 ECTOThe domains can be used to pair with gp120 polypeptides from many different HIV-1 strains or subtypes to form "chimeric" gp140 trimers. Such chimeric trimers are designated "UFO-BG" or "UFO" as exemplified herein. 2 It's called "-BG".
[0039] Vaccine refers to a pharmaceutical composition that induces a preventive or therapeutic immune response in a subject. In some cases, the immune response is a protective immune response. Typically, a vaccine induces an antigen-specific immune response against an antigen of a pathogen, such as a viral pathogen, or a cellular component that correlates with a pathological condition. A vaccine can include a polynucleotide (such as a nucleic acid encoding a disclosed antigen), a peptide or polypeptide (such as a disclosed antigen), a virus, a cell, or one or more cellular components.
[0040] Virus-like particle (VLP) refers to a non-replicating viral shell derived from any of several viruses. VLPs are generally composed of one or more viral proteins, such as, but not limited to, proteins called capsid, coat, shell, surface and / or envelope proteins, or particle-forming polypeptides derived from these proteins. VLPs can spontaneously form upon recombinant expression of proteins in an appropriate expression system. Methods for producing specific VLPs are known in the art. The presence of VLPs after recombinant expression of viral proteins can be detected using conventional techniques known in the art, such as electron microscopy, biophysical characterization, etc. See, for example, Baker et al. (1991) Biophys J 60:1445-1456 and Hagensee et al. (1994) J Virol 68:4503-4505. For example, VLPs can be isolated by density gradient centrifugation and / or identified by characteristic density banding. Alternatively, cryo-electron microscopy can be performed on vitrified aqueous samples of the VLP preparation in question and images recorded under appropriate exposure conditions.
[0041] III. Novel scaffold HIV-1 trimeric immunogen The present invention provides HIV-1 immunogens comprising a heterologous scaffold that displays or incorporates a trimeric HIV-1 Env-derived protein (e.g., a gp140 trimer) and a T helper or linker sequence. In some embodiments, the heterologous display scaffold is a self-assembling nanoparticle. In some other embodiments, the heterologous display scaffold is a bacteriophage Q βThe HIV-1 trimeric protein subunits are virus-like particles (VLPs), such as VLPs. In some embodiments (as exemplified in Example 1 herein), the trimeric HIV-1 protein subunits are linked to the N-terminus of the display scaffold (e.g., nanoparticle) subunits via a linker sequence described herein, e.g., a T helper epitope polypeptide, which also functions to facilitate T cell recognition of the fusion immunogen. In some other embodiments (as exemplified in Example 7 herein), the HIV-1 trimeric protein subunits are connected (e.g., covalently linked) to the N-terminus of the display scaffold subunits, and a T helper or linker epitope is fused to the C-terminus of the display scaffold (e.g., nanoparticle) subunits. In the latter embodiment, the T helper epitope can be fused to the nanoparticle subunit via a short peptide spacer. This allows for the formation of a hydrophobic core within the nanoparticle, which functions to stabilize the nanoparticle structure and facilitate T cell recognition of the fusion immunogen. In various embodiments, the short peptide spacer can be, for example, one to five repeats of GGGGS (SEQ ID NO: 4), GSGSG (SEQ ID NO: 19), or essentially any structurally flexible peptide. As an example, a 5-aa GGGGS spacer can be used to fuse the T helper epitope PADRE to the C-terminus of the E2p and I3-01 subunits (Example 7). In addition to fusing a T helper epitope to the C-terminus of a nanoparticle subunit using a short peptide spacer, a second peptide spacer or segment can be used to fuse an HIV-1 trimer to the N-terminus of a nanoparticle subunit. For example, an HIV-1 protein can be fused to the N-terminus of a display nanoparticle subunit via, for example, a single glycine residue ("1G linker") or a 10-aa GGGGSGGGGS (SEQ ID NO: 20) spacer, as exemplified herein (Example 7).
[0042] Any Env-derived HIV-1 trimeric protein can be used in the nanoparticle-displayed vaccine composition. The Env-derived trimeric protein can be obtained from various HIV-1 strains. In some embodiments, the nanoparticles display the native trimeric form of an HIV-1 Env-based glycoprotein or domain, e.g., gp140, gp120, or V1V2 domain. In some embodiments, the Env-derived trimer is derived from HIV-1 strain BG505, e.g., BG505.SOSIP664 gp140 trimer. In some embodiments, the nanoparticles display a modified gp140 trimer immunogen, e.g., the HR1-modified gp140 trimer ("UFO trimer") described in Kong et al., Nat Comm 7, 12040, 2016. In some embodiments, the HIV-1 trimeric immunogen used in the present invention is the UFO trimer exemplified herein. 2 -BG trimer. UFO 2 The BG505 gp41 trimer is a chimeric gp140 trimer containing (1) the BG505 gp41 domain with a redesigned HR1 N-terminal bend and cleavage site linker (described in Kong et al., Nat Comm 7, 12040, 2016) and (2) a gp120 protein from one of various other HIV-1 strains or subtypes. ECTO In addition to the gp41 domain, the gp41 domain in the chimeric gp140 trimers suitable for the present invention may also be a consensus gp41 domain derived from the HIV-1 sequence database. ECTO It can be a domain.
[0043] In various embodiments, nanoparticles displaying any of these HIV-1 Env-derived immunogens can be constructed by fusing a trimeric immunogen to a nanoparticle subunit (e.g., I3-01, 1VLW-derived polypeptide sequence, or ferritin subunit). The antigenicity and structural integrity of these nanoparticle-based HIV-1 immunogens can be readily analyzed via standard assays, such as antibody binding assays and negative staining electron microscopy (EM). As exemplified herein, various fusion molecules can all self-assemble into nanoparticles displaying immunogenic epitopes of Env-derived trimers (e.g., gp140). These nanoparticles are useful for vaccinating individuals against a broad range of HIV-1 viruses by eliciting robust trimer-specific bnAbs.
[0044] In some embodiments, the scaffold gp140 trimer immunogens of the present invention contain a T-helper epitope that serves as a linker to connect the gp140 trimer to the nanoparticle scaffold. In some other embodiments, the T-helper epitope is fused to the C-terminus of the nanoparticle subunit via a short peptide spacer and encapsulated within the nanoparticle scaffold. Short peptide spacers that can be used in these embodiments can be, for example, GGGGS, GSGSG, or any other peptide that is inherently structurally flexible. In addition to serving as a structural element of the scaffold immunogen, the T-helper epitope also provides an integrated T-help signal to elicit robust T-cell responses and direct B-cell development toward bNAbs. Any T-helper epitope sequence or peptide known in the art can be used in the practice of the present invention. These include any polypeptide sequence that contains an MHC class II epitope and can effectively activate helper T cells upon immunization. See, for example, Alexander et al., Immunity 1,751-761, 1994; Ahlers et al., J. Clin. Invest. 108:1677-1685, 2001; Fraser et al., Vaccine 32,2896-2903, 2014; De Groot et al., Immunol. Cell Biol. 8:255-269, 2002; and Gene Ther. 21:225-232, 2014. In some preferred embodiments, the T helper epitope used is the common pan DR epitope peptide (PADRE). In some of these embodiments, the linker comprises the sequence AKFVAAWTLKAAA (SEQ ID NO: 1), a conservatively modified variant thereof, or a substantially identical (e.g., at least 90%, 95%, or 99% identical) sequence. In some other embodiments, the T helper epitope used is the DT helper epitope QSIALSSLMVAQAIP (SEQ ID NO: 2) or the TpD epitope ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ (SEQ ID NO: 3).In various embodiments, the linker can comprise the sequence set forth in SEQ ID NO:2 or SEQ ID NO:3, a substantially identical (e.g., at least 90%, 95%, or 99% identical) sequence thereof, or a conservatively substituted sequence.
[0045] As described above, the heterologous scaffold for displaying trimeric HIV-1 proteins is preferably a nanoparticle. A variety of nanoparticle platforms can be used to generate the vaccine compositions of the present invention. Generally, nanoparticles used in the present invention must be formed from multiple copies of a single subunit. Additionally or alternatively, the amino termini of the particle subunits must be exposed in close proximity to the three-fold axis, and the spacing between the three amino termini must closely match the spacing between the carboxyl termini of the various HIV-1 trimer components. In some preferred embodiments, the immunogen comprises self-assembled nanoparticles with a diameter of approximately 20 nm or less (typically assembled from 12, 24, or 60 subunits) and a three-fold axis on the particle surface. Such nanoparticles provide a suitable particle platform for generating multivalent HIV-1 trimer vaccines.
[0046] In some embodiments, the scaffolded gp140 trimer immunogens of the present invention are constructed using an ultrastable nanoparticle scaffold. For example, self-assembled nanoparticles can be generated using the I3-01 protein described in Hsia et al., Nature 535, 136-139, 2016. The amino acid sequence of this protein is set forth in SEQ ID NO: 18. In some other embodiments, the ultrastable nanoparticle scaffold can be based on variants of I3-01 described in Hsia et al. (supra), including conservatively modified variants or those with substantially identical (e.g., at least 90%, 95%, or 99% identical) sequences. In some embodiments, the linker sequence connecting the gp140 trimer to the I3-01-derived nanoparticle platform comprises a T-helper epitope, as described above. In some other embodiments, a glycine-serine polypeptide is used as a second peptide spacer to connect the gp140 trimer to the I3-01-derived nanoparticle platform, and a T-helper epitope is fused to the C-terminus of the nanoparticle subunit via a short peptide spacer. This structural design creates a hydrophobic core within the nanoparticle, thereby enhancing T cell recognition of the gp140 trimer displayed on the nanoparticle surface. In various embodiments, the short peptide spacer used to attach the T-helper epitope to the C-terminus of the nanoparticle subunit can be, for example, GGGGS, GSGSG, or any other peptide with inherent structural flexibility.
[0047] I3-01 sequence (SEQ ID NO: 18): MHHHHHHGGSGGSGGSGGSMKMEELFKKHKIVAVLRANSVEEAKKKALAVFLGGVHLIEITFTVPDADTVIKELSFLKEMGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLD EEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGTPVEVAEKAKAFVEKIRGCTE In some embodiments, the ultrastable nanoparticles in the scaffold gp140 trimer immunogens of the present invention are constructed using ferritin, a natural nanoparticle derived from Helicobacter pylori. For example, the scaffold gp140 trimer immunogens are constructed using UFOs that are bound to and displayed on ferritin. 2In some of these embodiments, the UFO2-BG trimer is directly connected to the ferritin subunit without a linker sequence, as exemplified herein. In other embodiments, a linker sequence, such as a T-helper epitope or a simple glycine-serine linker, may be used. In some of these embodiments, a T-helper epitope can be fused to the C-terminus of the nanoparticle subunit via a short peptide spacer, thereby forming a hydrophobic core within the nanoparticle scaffold. As described herein, the short peptide spacer used in these embodiments can be, for example, GGGGS, GSGSG, or any other peptide that is structurally flexible in nature. Ferritin is a globular protein found in all animals, bacteria, and plants. The globular form of ferritin is composed of monomeric subunit proteins (also called monomeric ferritin subunits), which are polypeptides with molecular weights of approximately 17-20 kDa. The monomeric ferritin subunit used in the present invention is a full-length single polypeptide of ferritin protein or any part thereof, which can induce the self-assembly of the monomeric ferritin subunit into a globular protein.As long as the monomeric ferritin subunit can self-assemble into nanoparticles that display HIV-1 epitopes on their surface, the amino acid sequence derived from the monomeric ferritin subunit of any known ferritin protein can be used to produce the fusion protein of the present invention.In addition to ferritin, the present invention can also use many other self-assembling nanoparticles with similar molecular properties.These include, for example, molecules with the following PDB IDs: 1JIG (12-mer Dlp-2 from Bacillus anthracis), 1UVH (12-mer DPS from Mycobacterium smegmatis), 2YGD (24-mer eye lens chaperone αB-crystallin), 3CS0 (24-mer DegP24), 3MH6 and 3MH7 (24-mer HtrA protease), 3PV2 (12-mer HtrA homolog DegQ), and 3PV3 (12-mer HtrA homolog DegQ). These include WT), 4A8C (12-mer DegQ from E. coli), 4A9G (24-mer DegQ from E. coli), 4EVE (12-mer HP-NAP from Helicobacter pylori strain YS29), and 4GQU (24-mer HisB from Mycobacterium tuberculosis).
[0048] In some embodiments, the scaffold gp140 trimer immunogens of the present invention can be constructed using nanoparticle scaffolds derived from protein 1VLW (SEQ ID NO: 5) or variants thereof (SEQ ID NOs: 6-17), as exemplified herein. In various embodiments, the nanoparticle platforms for constructing the scaffold gp140 immunogens of the present invention can be generated using polypeptide sequences that are conservatively modified variants or substantially identical sequences of any one of SEQ ID NOs: 5-18. In some embodiments, the linker sequence for connecting the gp140 trimer to the 1VLW-derived nanoparticle platform comprises a T-helper epitope, as described above. In some other embodiments, the linker for connecting the gp140 trimer to the 1VLW-derived nanoparticle platform comprises a simple peptide sequence. For example, the scaffold immunogens can be constructed using a linker comprising one to five repeats (e.g., one or two repeats) of a glycine-serine linker, such as GGGGS (SEQ ID NO: 4) or GSGSG (SEQ ID NO: 19). In some other embodiments, T-helper epitopes can be fused to the C-terminus of the nanoparticle subunit via a short peptide spacer to form a hydrophobic core within the nanoparticle. In various embodiments, the short peptide spacer used can be, for example, GGGGS, GSGSG, or any other peptide that is structurally flexible in nature.
[0049] In some other embodiments, the nanoparticle scaffold for presenting HIV-1 trimeric immunogens is a redesigned variant of dihydrolipoyl acyltransferase (E2p) from Bacillus stearothermophilus. E2p is a thermostable 60-mer nanoparticle with a diameter of 23.2 nm and 12 large openings separating the three-fold vertices on the particle surface. Nanoparticles formed by the redesigned E2p variants used to construct HIV-1 trimeric immunogen scaffolds of the present invention have enhanced stability compared to wild-type E2p nanoparticles. In some embodiments, HIV-1 gp140 trimers can be connected to E2p nanoparticles using linkers containing the T-helper epitopes described above. In some other embodiments, T-helper epitopes can be fused to the C-terminus of the E2p subunit via a short peptide spacer so that fully assembled E2p nanoparticles encapsulate the hydrophobic core formed by the T-helper epitopes. The hydrophobic core also functions to enhance T cell recognition of the gp140 trimer on the E2p nanoparticle surface. Short peptide spacers suitable for use in these embodiments to link E2p and T helper epitopes can be, for example, GGGGS, GSGSG, or any other peptide that is structurally flexible in nature.
[0050] Scaffold HIV-1 trimer immunogens of the present invention can be constructed according to the protocols described herein (e.g., Examples 1-7) and / or other methods described in the art, e.g., He et al., Nat Comm 7, 12041, 2016; and Kong et al., Nat Comm 7, 12040, 2016.
[0051] IV. Vectors and host cells for expressing HIV-1 vaccine immunogens The present invention provides polynucleotide sequences encoding the HIV-1 vaccine immunogens and related polypeptides described herein, expression vectors carrying the polynucleotide sequences, and host cells carrying the polynucleotides or expression constructs. The cells can be, for example, eukaryotic or prokaryotic cells, such as animal cells, plant cells, bacteria, or yeast. A variety of expression vector / host systems are suitable for expressing the fusion polypeptides of the present invention. Examples include, for example, microorganisms, such as bacteria transformed with recombinant bacteriophage, plasmid, or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with viral expression vectors (e.g., baculovirus); plant cell systems transfected with viral expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with bacterial expression vectors (e.g., Ti or pBR322 plasmids); or animal cell systems.
[0052] Vectors useful in the present invention preferably contain sequences operably linked to the fusion polypeptide coding sequence that enable transcription and translation of the encoding polynucleotide sequence. The sequences enabling transcription of the linked fusion polypeptide coding sequence include a promoter and may also contain one or more enhancer elements that enable strong expression of the linked sequence. The term "transcriptional regulatory sequence" refers to the combination of a promoter and any additional sequences that confer desired expression characteristics (e.g., high-level expression, inducible expression, tissue- or cell-type-specific expression) to the operably linked nucleic acid sequence. The promoter sequence can be constitutive or inducible. Examples of constitutive viral promoters include HSV, TK, RSV, SV40, and CMV promoters. Examples of suitable inducible promoters include promoters derived from genes such as cytochrome P450 genes, heat shock protein genes, metallothionein genes, and hormone-inducible genes such as estrogen gene promoters.
[0053] In addition to the promoter / enhancer element, the expression vector of the present invention may further comprise a suitable terminator. Such terminators include, for example, the human growth hormone terminator, or in the case of yeast or fungal hosts, the TPI1 (Alber & Kawasaki, J Mol Appl Genet 1:419-34, 1982) or ADH3 terminator (McKnight et al., 1985, EMBO J 4:2093-2099). Vectors useful in the present invention may also contain a polyadenylation sequence (e.g., SV40 or Ad5E1b poly(A) sequence) and a translation enhancer sequence (e.g., from adenovirus VA RNA). Furthermore, vectors useful in the present invention may encode a signal sequence that directs the fusion polypeptide to a specific cellular compartment, or may encode a signal that directs the secretion of the fusion polypeptide.
[0054] In some preferred embodiments, the vector expressing the vaccine immunogen of the present invention is a viral vector for mammalian expression. Generally, any viral vector that allows the introduction and expression of the sequence encoding the fusion HIV immunogen of the present invention is acceptable for the present invention. In various embodiments, mammalian expression vectors can be used to practice the present invention, including adenovirus vectors, pSV and pCMV series plasmid vectors, vaccinia and retrovirus vectors, and baculovirus. For example, the HIV-1 vaccine immunogen of the present invention can be expressed from the viral vector phCMV3.
[0055] Depending on the particular vector used to express the fusion polypeptide, a variety of known cells or cell lines can be used in the practice of the present invention. Host cells can be any cell useful in the present invention, provided that a recombinant vector carrying a fusion HIV immunogen of the present invention can be introduced and the vector is enabled to promote expression of the fusion polypeptide. Host cells can be prokaryotic cells, such as any of a number of bacterial strains, or eukaryotic cells, such as yeast or other fungal cells, insect cells, or amphibian cells, or mammalian cells, including rodent, ape, or human cells. Cells expressing the fusion polypeptides of the present invention can be primary cells, e.g., primary human fibroblasts or keratinocytes, or established cell lines, such as NIH3T3, HEK293, HEK293T, HeLa, MDCK, WI38, or CHO cells. In some embodiments, host cells for expressing the HIV-1 vaccine immunogens of the present invention can be ExpiCHO or HEK293F cells, as exemplified herein. Those skilled in the art can readily establish and maintain in culture a selected host cell type that expresses the fusion vaccine immunogens of the present invention. Many other specific examples of suitable cell lines that can be used for expression of fusion polypeptides have been described in the art.See also Smith et al.,1983.,J.Virol 46:584;Engelhard,et al.,1994,Proc Nat Acad Sci 91:3224;Logan and Shenk,1984,Proc Natl Acad Sci,81:3655;Scharf,et al.,1994,Results Probl Cell Differ,20:125;Bittner et al.,1987,Methods in Enzymol,153:516;Van Heeke&Schuster,1989,J Biol Chem 264:5503;Grant et al.,1987,Methods in Enzymology 153:516;Brisson et al.,1984,Nature 310:511;Takamatsu et al.,1987,EMBO J 6:307;Coruzzi et al.,1984,EMBO J 3:1671;Broglie et al.,1984,Science,224:838;Winter J and Sinibaldi RM,1991,Results Probl Cell Differ.,17:85;Hobbs S or Murry LE in McGraw Hill Yearbook of Science and Technology(1992)McGraw Hill New York NY,pp 191-196 and Weissbach and Weissbach(1988)Methods for Plant Molecular Biology,Academic Press,New York,pp 421-463.
[0056] Fusion polypeptide expression vectors can be introduced into selected host cells by any of a number of suitable methods known to those skilled in the art. The method used to introduce a vector encoding a fusion polypeptide into mammalian cells depends on the form of the vector. In the case of a plasmid vector, the DNA encoding the fusion polypeptide sequence can be introduced by any of a number of transfection methods, including, for example, lipid-mediated transfection ("lipofection"), DEAE-dextran-mediated transfection, electroporation, or calcium phosphate precipitation. These methods are described in detail, for example, in Brent et al., supra. Lipofection reagents and methods suitable for transient transfection of a wide variety of transformed and non-transformed or primary cells are widely available, making lipofection an attractive method for introducing constructs into eukaryotic cells, particularly mammalian cells in culture. For example, LipofectAMINE™ (Life Technologies) or LipoTaxi™ (Stratagene) kits are available. Other companies that provide reagents and methods for lipofection include Bio-Rad Laboratories, CLONTECH, Glen Research, InVitrogen, JBL Scientific, MBI Fermentas, PanVera, Promega, Quantum Biotechnologies, Sigma-Aldrich, and Wako Chemicals USA.
[0057] Stable expression is preferred for long-term, high-yield production of recombinant fusion polypeptides. Rather than using expression vectors containing viral origins of replication, host cells can be transformed with the fusion polypeptide coding sequence controlled by appropriate expression control elements (e.g., promoter, enhancer, sequence, transcription terminator, polyadenylation site, etc.) and a selectable marker. The selectable marker in the recombinant vector confers resistance to selection and allows cells to stably integrate the vector into their chromosomes. Commonly used selectable markers include neo, which confers resistance to the aminoglycoside G-418 (Colberre-Garapin, et al., J. Mol. Biol., 150:1, 1981), and hygro, which confers resistance to hygromycin (Santerre, et al., Gene, 30:147, 1984). With appropriate selection, transfected cells can contain integrated copies of the fusion polypeptide coding sequence.
[0058] V. Pharmaceutical Compositions and Therapeutic Uses The present invention provides pharmaceutical compositions and related methods that use scaffold HIV-1 immunogen polypeptides or polynucleotides encoding the vaccine polypeptides described herein to prevent and treat HIV-1 infection. In some embodiments, the immunogens disclosed herein are included in pharmaceutical compositions. Pharmaceutical compositions can be either therapeutic or prophylactic formulations. Typically, the compositions further comprise one or more pharmaceutically acceptable vehicles and may further comprise other therapeutic ingredients (e.g., antibiotics or antivirals). Various pharmaceutically acceptable additives can also be used in the compositions.
[0059] Some of the pharmaceutical compositions of the present invention are vaccines. For vaccine compositions, a suitable adjuvant can be further included. Examples of suitable adjuvants include, for example, aluminum hydroxide, lecithin, Freund's adjuvant, MPL™, and IL-12. In some embodiments, the scaffold HIV-1 immunogens disclosed herein can be formulated as controlled-release or time-release formulations. This can be achieved in compositions containing slow-release polymers, or via microencapsulated delivery systems or bioadhesive gels. Various pharmaceutical compositions can be prepared according to standard procedures well known in the art. See, e.g., Remington's Pharmaceutical Sciences, 19th Ed., Mack Publishing Company, Easton Pa., 1995; Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York, 1978); U.S. Pat. Nos. 4,652,441 and 4,917,893; U.S. Pat. Nos. 4,677,191 and 4,728,721; and U.S. Pat. No. 4,675,189.
[0060] The pharmaceutical compositions of the present invention can be readily used for a variety of therapeutic or prophylactic purposes to treat HIV-1 infection in a subject or to induce an immune response against HIV-1 in a subject. For example, the compositions can be administered to a subject to induce an immune response against HIV-1, e.g., to induce the production of broadly neutralizing antibodies against HIV-1. A vaccine composition of the present invention can be administered to a subject at risk of developing HIV infection to provide prophylactic protection against viral infection. Depending on the particular subject and condition, the pharmaceutical compositions of the present invention can be administered to a subject by various administration methods known to those skilled in the art, such as intramuscular, subcutaneous, intravenous, intraarterial, intraarticular, intraperitoneal, or parenteral routes. Generally, the pharmaceutical composition is administered to a subject in need of such treatment for a time and under conditions sufficient to prevent, inhibit, and / or ameliorate the selected disease or condition or one or more symptoms thereof. The immunogenic composition is administered in an amount sufficient to induce an immune response against HIV-1. For therapeutic use, the composition should contain a therapeutically effective amount of the scaffold HIV-1 immunogen described herein. For prophylactic use, the composition should contain a prophylactically effective amount of the scaffold HIV-1 immunogen described herein. The appropriate amount of immunogen can be determined based on the particular disease or condition being treated or prevented, its severity, the subject's age, and other personal attributes of the particular subject (e.g., the subject's general state of health and the robustness of the subject's immune system). Determination of effective dosages will further be guided by animal model studies and subsequent human clinical trials, and by administration protocols that significantly reduce the occurrence or severity of the target disease symptom or condition in the subject.
[0061] In prophylactic applications, the immunogenic composition is provided prior to any symptoms, e.g., prior to infection. Prophylactic administration of the immunogenic composition serves to prevent or ameliorate any subsequent infection. Thus, in some embodiments, the subject being treated is one who has HIV infection or is at risk of developing HIV infection, e.g., due to exposure or potential exposure to HIV. After administration of a therapeutically effective amount of the disclosed therapeutic composition, the subject can be monitored for HIV-1 infection, symptoms associated with HIV-1 infection, or both.
[0062] In therapeutic applications, the immunogenic compositions are provided at or after the onset of symptoms of disease or infection, e.g., after the onset of symptoms of HIV-1 infection or after diagnosis of HIV-1 infection. Thus, the immunogenic compositions can be provided prior to anticipated exposure to the HIV virus, after exposure or suspected exposure to the virus, or after the actual onset of infection, to reduce the anticipated severity, duration, or extent of infection and / or associated disease symptoms.
[0063] The pharmaceutical composition of the present invention can be combined with other drugs known in the art for treating or preventing HIV infection. These include, for example, antibodies or other antiviral agents, such as nucleoside reverse transcriptase inhibitors, such as abacavir, AZT, didanosine, emtricitabine, lamivudine, stavudine, tenofovir, zalcitabine, zidovudine, etc., non-nucleoside reverse transcriptase inhibitors, such as delavirdine, efavirenz, nevirapine, protease inhibitors, such as amprenavir, atazanavir, indinavir, lopinavir, nelfinavir, osamprenavir, ritonavir, saquinavir, tipranavir, etc., and fusion protein inhibitors, such as enfuvirtide, etc. The pharmaceutical composition and known anti-HIV drugs can be administered simultaneously or sequentially.
[0064] The HIV-1 vaccine immunogen or pharmaceutical composition of the present invention can be provided as a component of a kit. Such a kit can include additional components, such as packaging, instructions, and various other reagents, such as buffers, substrates, antibodies or ligands, e.g., control antibodies or ligands, and detection reagents. Optional instructions can also be provided with the kit.
[0065] [Example] The following examples are offered to illustrate, but not to limit, the present invention.
[0066] [Example 1] UFO 2 Design and characterization of -BG trimers A major obstacle facing current trimer designs is the deterioration of yield, purity, and stability once they are expanded from BG505 to other strains. Solutions proposed so far include (1) purification methods aimed at separating native-like trimers from misfolded Env proteins, such as bNAb affinity columns, negative selection, multi-cycle SEC, and combined chromatographic approaches, and (2) auxiliary mutations informed by atomic structure or derived from library screening. However, these solutions are essentially empirical and often result in suboptimal results, such as reduced trimer yields and unexpected changes in Env properties. We previously identified the HR1 bend (residues 547–569) as a major contributor to Env metastability (Kong et al., Nat Comm 7, 12040, 2016). gp41 ECTO Rational redesign of this structurally distorted region in HR1 significantly improved trimer yield and purity for multiple HIV-1 strains, but still resulted in variable amounts of misfolded Env, suggesting that other regions besides HR1 also contribute to Env metastability. Thus, uncovering the source of these "secondary factors of metastability" may prove important for trimer design.
[0067] All factors in Env metastability are involved in gp41 ECTO Coded in UFO designed BG505 GP41 ECTO (UFO 2 We hypothesized that diverse HIV-1 Envs could be stabilized using the HIV-1 Envs (referred to as HIV-1-BG). To test this hypothesis, we selected 10 Envs from five clade origins (A, B, C, B / C, and A / E) from either a large panel of HIV-1 pseudoviruses or available databases (https: / / www.hiv.lanl.gov), including three Envs tested in our previous study (Kong et al., Nat Comm 7, 12040, 2016). Notably, seven of the 10 Envs tested here were derived from tier-2 / 3 isolates, which pose significant challenges to trimer stabilization. For each Env, we analyzed SOSIP, UFO, and UFO. 2 The BG-designed gp140 constructs were transiently expressed in ExpiCHO cells and co-transfected with furin for the SOSIP constructs. Following GNL purification, SEC profiles of 30 gp140 constructs were generated from a Superdex 200 16 / 600 column for comparison. With the exception of BG505, all SOSIP constructs exhibited significant aggregate fractions (40-50 ml), accompanied by extremely low yields and sometimes the absence of a trimer peak. UFO significantly improved trimer yield and purity for all but clade A / E, with the most visible improvement observed for clade C. UFO 2 UFO-BG demonstrated excellent trimer purity and yield in 8 of 10 strains using either no or minimal dimer and monomer cues, covering all seven tier-2 / 3 isolates. All 30 gp140 constructs were then characterized by BN-PAGE. Overall, UFO 2The GNL-BG dramatically reduced the dimer and monomer content of SOSIP and UFO, resulting in a trimeric band across the SEC fractions, with occasional faint lower molecular weight bands. Based on this finding, we compared the total Env protein obtained from the GNL column with the subsequent SEC and trimeric portion after fraction analysis by BN-PAGE. Surprisingly, the simple GNL purification process significantly reduced the dimer and monomer content of SOSIP and UFO derived from tier-2 clade B and tier-3 clade B / C strains. 2 The eight purified UFOs were then analyzed by differential scanning calorimetry (DSC). 2 The thermal stability of the -BG trimer was evaluated. In particular, the DSC profile showed a thermal denaturation midpoint (T ) in the range of 60.9–68.4°C. m ) showed clade / strain-specific patterns. Of the eight trimers tested, UFO 2 - BG505, which has the same BG as UFO, has the highest T m (68.4 °C), followed by two clade C trimers (65.2–66.2 °C). In the absence of additional cavity-filling mutants and disulfide bonds, the DSC data largely reflected the thermal stability of WT Env. Notably, the CN54 UFO and UFO tested here exhibited similar thermal stability. 2 The -BG construct contains 14 mutations (CN54M14) that reduce trimeric aggregates produced by 293 F. Additionally, four UFOs of clades B, C, and B / C were selected for expression in 293 F cells and SEC purification. 2 The results showed that UFO-BG trimers were consistent regardless of the cell line used. 2 -BG can improve trimer properties, but only reaches the highest purity when used in combination with the ExpiCHO system, consistent with our findings for BG505.
[0068] Therefore, the results show that gp41 ECTO is the only source of Env metastability, and the UFO-designed BG505 gp41 ECTOThis confirms our hypothesis that UFO can stabilize diverse HIV-1 Envs. The nearly identical trimer purity before and after SEC purification was observed for UFO. 2 This suggests a simple, robust, and cost-effective manufacturing process for UFO-BG trimers. 2 -Facilitate the development and clinical trials of nucleic acid vaccines expressing the BG trimer.
[0069] [Example 2] UFOs of various subtypes 2 Nanoparticle presentation of -BG trimers We followed a previously reported design strategy (He et al., Nat Comm 7, 12041, 2016) to construct UFOs derived from diverse HIV-1 strains. 2 We investigated whether the BG505 gp41 trimer could be displayed on 24-mer ferritin (FR) nanoparticles. ECTO We hypothesize that gp41 fused to the N-terminus (Asp5) of the ferritin subunit can promote both gp140 trimerization and nanoparticle assembly (Figure 1A). ECTO 8 UFOs with C-terminus (residue 664) 2 The resulting fusion constructs were transiently expressed in ExpiCHO cells and then easily purified using a 2G12 affinity column. BN-PAGE revealed well-formed UFOs for all eight strains tested. 2 The nanoparticle assembly was consistently confirmed by negative stain EM, which showed visible particle cores decorated with regular arrays of gp140 trimers protruding from the surface. DSC analysis revealed UFOs derived from all five subtypes. 2 -BG-FR nanoparticles exhibited high thermal stability, and T m The temperature ranged from 68 to 70°C. UFO was performed on five representative designs using a panel of six bNAbs and four non-NAbs. 2The antigenicity of the -BG-FR nanoparticles was evaluated. Overall, multivalent display preserved and, in some cases, enhanced native-like trimer antigenicity, demonstrating epitope- and subtype-specific patterns. At the V2 apex, all five nanoparticles bound PGDM1400 with affinities comparable to or significantly higher than those of individual trimers, confirming that trimers displayed on the nanoparticle surface adopt a native-like closed conformation. For H078.14, restored bNAb binding could be explained by a shift in conformational equilibrium influenced by adjacent trimers on the nanoparticle surface, whereas for Du172.17 and 93JP_NH1, the increased affinity appeared to be the result of an avidity effect. In contrast, little improvement was observed in nanoparticle binding to another apex bNAb, PG16. At the N332 supersite and CD4bs, multivalent display enhanced H078.14 UFO binding. 2 At the gp120-gp41 interface, UFO showed a more favorable effect on the -BG trimer. 2 Both -BG-FR nanoparticles retained trimeric binding to PGT151, which recruits elements from two adjacent gp140 protomers, whereas a cross-clade reduction in binding signal was observed for 35O22, which interacts with only one protomer. For non-NAbs, the nanoparticles exhibited a trimer-like binding profile.
[0070] Next, we investigated the utility of a 60-unit ultrastable nanoparticle, I3-01 (Hsia et al., Nature 535, 136-139, 2016), for the multivalent display of native-like Env trimers. In terms of symmetry (dodecahedron) and size (25 nm), I3-01 closely resembles the 60-mer E2p nanoparticles tested in our previous study, but is more stable (Figure 1E, left). However, due to the long distance between the N-termini of the I3-01 subunits (approximately 50.5 Å), a long linker is required to connect them to the C-termini of the gp140 trimer (Figure 1E, center). We hypothesize that T-helper epitopes are used not only as linkers between the gp140 and I3-01 subunits but also as integrated T-help signals, inducing robust T cell responses and directing B cell development toward bNAbs. To test this hypothesis, we selected and evaluated the Pan DR epitope peptide (PADRE), AKFVAAWTLKAAA (SEQ ID NO: 1) (Alexander et al., Immunity 1, 751-761, 1994), as well as two recently reported T helper epitopes, D and TpD (Fraser et al., Vaccine 32, 2896-2903, 2014) (Figure 1E, right). Three fusion constructs were designed, including the HR1-redesigned BG505 gp140 (Kong et al., Nat Comm 7, 12040, 2016), T helper epitopes, and the I3-01 subunit. Following coexpression of furin in ExpiCHO cells, the 2G12-purified material was characterized by SEC (Figure 1F). Surprisingly, the PADRE-containing I3-01 construct produced highly pure nanoparticles, as further confirmed by BN-PAGE (Figure 1G) and negative-stain EM (Figure 1H). When assessed using the same panel of bNAb and non-NAb antibodies, the nanoparticles displayed an exceptional antigen profile with strong PG16 binding not observed in any nanoparticles tested to date (Figure 1I).
[0071] In summary, our results demonstrate that UFOs of diverse HIV-1 strains 2We demonstrate that I3-01 and I3-BG trimers can be displayed on ferritin nanoparticles. Furthermore, the use of ultrastable nanoparticles such as I3-01 and T helper epitopes provides a novel platform for developing multivalent HIV-1 vaccines with more balanced T and B cell responses.
[0072] [Example 3] Nanoparticles potently activate bNAb-expressing B cells We previously demonstrated that various BG505 gp120 and gp140 nanoparticles could engage B cells expressing the cognate VRC01 receptor (He et al., 2016). In this study, five UFOs were identified for each trimer. 2 B cell activation by BG-FR nanoparticles and BG505 gp140-PADRE-I3-01 nanoparticles was evaluated (Figure 2). The assay used B cells expressing the bNAbs PGT145, VRC01, and PGT121 (Ota et al., J. Immunol. 189, 4816-4824, 2012). Overall, trimer-presenting nanoparticles were able to stimulate bNAb-expressing B cells more effectively than individual trimers, with peak signals approaching maximal activation with ionomycin. However, the results also revealed patterns related to the epitopes examined. When tested with B cells expressing PGT121, which recognizes the N332 supersite, some trimers and all nanoparticles elicited detectable Ca. 2 + flux signal. In contrast, few trimers activated B cells expressing PGT145 and VRC01, which target the V2 apex and CD4bs, respectively. Notably, H078.14 UFO 2 Stimulation of PGT145-expressing B cells with -BG-FR nanoparticles provides additional evidence that apex can be restored by multivalent display without the V2 mutation, consistent with the BLI data (Figure 1D). A similar effect was observed by BLI, where PGT125 only weakly binds PGT121 but produces visible, long-lasting Ca2+ in PGT121-expressing B cells. 2+Clade A / E 93JP_NH1 UFO induces flux signals 2 This was also observed with the -BG-FR nanoparticles, suggesting that cross-linking of B cell receptors (BCRs) on the cell surface may further help to overcome the inherent low affinity. Together, by combining biochemical, structural, and antigenic approaches with B cell activation assays, we established a panel of gp140 nanoparticles that allows us to examine their vaccine potential in vivo.
[0073] [Example 4] Induction of autologous neutralizing antibodies in wild-type mice The immunogenicity of various forms of native-like Env trimers has been evaluated. When wild-type mice were immunized with SOSIP trimers, no autologous tier-2 NAb responses to BG505.N332 were observed over 18 weeks (Hu et al., J Virol 89, 10383-10398, 2015). It was concluded that the glycan shield of well-formed Env trimers is impermeable to mouse antibodies due to their short heavy chain complementarity-determining region 3 (HCDR3) loop. Nevertheless, it was reported that engineered BG505 SOSIP trimers elicited tier-2 NAbs in mice carrying knock-in bNAb precursors. Using vaccination regimens ranging from 6 months to 1 year, native-like trimers have also been reported to induce autologous tier-2 NAb responses in rabbits and weaker responses in macaques (de Taeye et al., 2015; Klasse et al., 2016; Martinez-Murillo et al., 2017; Pauthner et al., 2017; Sanders et al., 2015). Thus, the induction of tier-2 NAb remains a significant challenge for HIV-1 vaccine development, especially in wild-type mouse models.
[0074] Here, we immunized WT BALB / c mice with BG505 gp140 trimers and nanoparticles containing the HR1 redesign central to the UFO design (Kong et al., 2016a) using a simple 6-week regimen and serum IgG purification procedure to eliminate nonspecific antiviral activity (Figure 3A). We obtained a human-compatible vaccine formulation using PIKA, a human adjuvant that demonstrated enhanced T cell and antibody responses in a phase 1 rabies vaccine trial (Wijaya et al., 2017). A total of eight trimers and four nanoparticles were tested (Figure 3B, top), and group-combined serum IgG was assessed for antigen binding by ELISA (Figure 3B, bottom). One V1V2 probe and two N332 nanoparticle probes were utilized to measure B cell responses to the apex and N332 suprasegmental sites, respectively (Morris et al., 2017). First, we examined mouse IgG elicited by 293F- and ExpiCHO-produced trimers (S1G3 and S1G4), which showed specific binding to the 293F-produced probe, and confirmed the cell line-specific patterns of glycosylation and B cell responses (Figure 1D and Figure 1E). The three scaffold gp140.681 trimers elicited strong IgG responses in mice, as indicated by relatively low EC50 values (S1G5, S1G6, and S1G7), consistent with our previous report (Morris et al., 2017). Ferritin nanoparticles (S2G1) appeared to elicit a relatively strong antibody response against the N332 supersite, suggesting a positive effect of multivalent display. All three gp140-T-epitope-I3-01 nanoparticles (S2G5, S2G6, and S2G7) outperformed their respective trimers containing PADRE, D, and TpD epitopes at the C-terminus (S1G8, S1G9, and S1G10). Finally, in the initial screening, serum IgG obtained from 12 immunized groups was tested for HIV-1 neutralization at IgG concentrations of 3–8 mg / ml, and a naive group was included as a control (S1G10) (Figure 3C).In contrast to previous negative reports (Hu et al., supra), we observed neutralization of autologous tier-2 BG505.N332 with the scaffold gp140.681 trimer (S1G5), ferritin nanoparticles (S2G1), and two I3-01 nanoparticles (S2G5 and S2G6). When tested at a relatively low IgG concentration (1 mg / ml), S1G5 showed borderline neutralization (just below the threshold) (Figure 3D). However, one subject with S2G1 (Figure 3E) and two subjects with S2G5 (Figure 3F) appeared to develop NAb antibodies against autologous tier-2 BG505.N332. Notably, the gp140-PADRE-I3-01 nanoparticles not only demonstrated excellent purity, structural uniformity, and antigenicity (Figure 1, 1E-1I), but also yielded IC50 values indicative of rapid development of tier-2 NAb antibodies after only 8 weeks. These data suggest that immunization with gp140-PADRE-I3-01 nanoparticles will likely induce stronger tier-2 NAb responses and have improved spectrum than current trimer vaccines in rabbits, NHPs, and humans.
[0075] [Example 5] Other ultrastable nanoparticles for displaying HIV-1 gp140 trimers In addition to the I3-01 nanoparticles, we also explored other stable nanoparticles for constructing the gp140-T helper epitope nanoparticle platform HIV-1 vaccine immunogen described herein. Specifically, we tested the protein "2-dehydro-3-deoxyphosphogluconic acid aldolase 4-hydroxy-2-oxoglutaric acid aldolase (Tm0066) from Thermotoga maritima (PDB ID: 1VLW)," which has a 2.30 Å resolution crystal structure. Using the gene sequence encoding 1VLW as a basis and the 2.30 Å resolution crystal structure as a scaffold, we designed a protein that could automatically assemble into 60-mer nanoparticles with more desirable properties than I3-01. Eleven amino acids within the 1VLW sequence (SEQ ID NO: 5) were submitted for assembly-based protein design or manual design following visual inspection. Twelve designed 1VLW variants were synthesized (SEQ ID NOs: 6–17). Using the same protocols described above for the gp140-PADRE-I3-01 nanoparticle immunogen, we will examine the construction of gp140 trimers displayed on nanoparticles of these sequences, the expression of the nanoparticle immunogens, and their immunogenicity.
[0076] 1VLW wild-type amino acid sequence (SEQ ID NO: 5) (residues subject to redesign are underlined): MKMEELFKKHKIVAVLRANSVEEAK E KA LA VF EG GVHLIEITFTVPDADTVIKELSFLKE K GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGT PD EV RE KA K AFVEKIRGCTE 1VLW mutants (SEQ ID NOs: 6-17) redesigned to display gp140 trimers (altered residues are double underlined): >1VLW-SS1 (SEQ ID NO: 6) MKMEELFKKHKIVAVLRANSVEEAKK K A LA VF LG GVHLIEITFTVPDADTVIKELSFLKE M GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGT PC EV AC KA K AFVEKIRGCTE >1VLW-MUT (Accession No. 7) MKMEELFKKHKIVAVLRANSVEEAK W KA LA VF IG GVHLIEITFTVPDADTVIKELSFLKE L GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGT PA EV VE KA K AFVEKIRGCTE >1VLW-JZ1 (Accession No. 8) MKMEELFKKHKIVAVLRANSVEEAK M KA LH VF SG GVHLIEITFTVPDADTVIKELSFLKE Q GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGT WD EV SR KA K AFVEKIRGCTE >1VLW-JZ2 (Accession No. 9) MKMEELFKKHKIVAVLRANSVEEAK W KA LH VF T.G. GVHLIEITFTVPDADTVIKELSFLKE Q GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGT WH EV AA KA K AFVEKIRGCTE >1VLW-JZ3 (Sequence number 10) MKMEELFKKHKIVAVLRANSVEEAK M KA LH VF T.G. GVHLIEITFTVPDADTVIKELSFLKE W GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGT WD EV AA KA K AFVEKIRGCTE >1VLW-JZ4 (Sequence number 11) MKMEELFKKHKIVAVLRANSVEEAK K KA LA VF LA GVHLIEITFTVPDADTVIKELSFLKE M GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGT VV EV AA K A AAFVEKIRGCTE >1VLW-JZ5 (Sequence number 12) MKMEELFKKHKIVAVLRANSVEEAK K KA LA VF LG GVHLIEITFTVPDADTVIKELSFLKE M GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFCAGVLAVGVGSALVKGT IV EV AA K A AAFVEKIRGCTE 1VLW-JZ6 MKMEELFKKHKIVAVLRANSVEEAK K KA LA VF LG GVHLIEITFTVPDADTVIKELSFLKE M GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFCAGVLAVGVGSALVKGT WV EV AA KA A AFVEKIRGCTE 1VLW-JZ7 MKMEELFKKHKIVAVLRANSVEEAK M KA LQ VF VG GVHLIEITFTVPDADTVIKELSFLKE A GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFCAGVLAVGVGSALVKGT LA EV AA KA E AFVEKIRGCTE 1VLW-JZ8 MKMEELFKKHKIVAVLRANSVEEAK W KA LH VF VG GVHLIEITFTVPDADTVIKELSFLKE A GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFCAGVLAVGVGSALVKGT WA EV AA KA K AFVEKIRGCTE 1VLW-JZ9 MKMEELFKKHKIVAVLRANSVEEAK M KA LA VF VG GVHLIEITFTVPDADTVIKELSFLKE L GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFCAGVLAVGVGSALVKGT IA EV AA KA A AFVEKIRGCTE 1VLW-JZ10 MKMEELFKKHKIVAVLRANSVEEAK M KA LA VF YG GVHLIEITFTVPDADTVIKELSFLKE A GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFCAGVLAVGVGSALVKGT FV EV AA KA A AFVEKIRGCTE [example 6] Some exemplary experimental procedures Antibodies: A panel of bNAbs and non-NAbs was utilized to characterize the antigenicity of various native-like trimer and gp140 nanoparticles. Except for the bNAbs PGDM1400, PGT145, PGT121, and PGT151 and the non-NAb 19b, which were obtained in-house at Scripps Research Institute, the antibodies were requested from the NIH AIDS Reagent Program (https: / / www.aidsreagent.org / ).
[0077] Expression and Purification of HIV-1 Env Trimers and Nanoparticles: Except for materials used for crystallographic analysis, trimers were transiently expressed in HEK293 F or ExpiCHO cells (Thermo Fisher). The protocol used for trimer generation in HEK293 F cells has been previously described (Kong et al., supra; Morris et al., mBio 8, e00036-00017, 2017). For truncated HR1-redesigned trimers, a furin plasmid was added at the time of transfection. The protocol used for trimer and nanoparticle generation in ExpiCHO cells is as follows. Briefly, ExpiCHO cells were thawed and incubated with ExpiCHO™ Expression Medium (Thermo Fisher) in a shaker incubator at 37°C, 135 rpm, and 8% CO2. When 10 × 10 cells were added, the furin plasmid was added at the time of transfection. 6 ml -1 Upon reaching a density of 6×10, ExpiCHO™ Expression Medium was added to bring the cell density to 6×10 for transfection. 6 ml -1 The ExpiFectamine™ CHO / plasmid DNA complexes were prepared for 200 ml transfections in ExpiCHO cells according to the manufacturer's instructions. For I3-01 nanoparticles displaying SOSIP and HR1 redesigned trimers, and BG505 HR1 redesigned trimers, 160 μg of antigen plasmid, 60 μg of furin plasmid, and 640 μl of ExpiFectamine™ CHO reagent were mixed in 15.4 ml of cold OptiPRO™ medium (Thermo Fisher), whereas for UFO and UFO2 Trimers and UFOs 2 For the -BG-FR nanoparticles, 200 μg of antigen plasmid was used without furin. After the first feed on day 1, ExpiCHO cells were cultured in a shaker incubator at 32°C, 120 rpm, and 8% CO2 according to the Max Titer protocol (Thermo Fisher). An additional feed was performed on day 5. Culture supernatants were collected 13–14 days after transfection, clarified by centrifugation at 4000 rpm for 20 minutes, and filtered using a 0.45 μm filter (Thermo Fisher). For trimers, Env proteins were extracted from the supernatant using a Galanthus nivalis lectin (GNL) column (Vector Labs), whereas for nanoparticles, Env fusion proteins were purified using a 2G12 affinity column. The trimer may be further purified by size exclusion chromatography (SEC) using a Superdex 200 Increase 10 / 300 GL column or a HiLoad 16 / 600 Superdex 200 PG column (GE Healthcare). The purity of I3-03 nanoparticles was characterized by SEC using a Superose 6 10 / 300 GL column. UV absorption spectra along with theoretical extinction coefficients were obtained for both the trimer and nanoparticles. 280 Absorbance was used to determine protein concentration.
[0078] Analysis of total and site-specific glycosylation profiles: Total glycan profiles of ExpiCHO and 293 F-produced trimers were generated by HILIC-UPLC. N-linked glycans were enzymatically released from the envelope glycoprotein via in-gel digestion with peptide-N-glycosidase F (PNGase F), followed by fluorescent labeling with 2-aminobenzoic acid (2-AA) and analysis by HILIC-UPLC. Digestion of the released glycans with Endo H allowed for quantification of oligomannose-type glycans. Glycan composition was determined by analyzing the glycans released from the trimers by PNGase F digestion using ion mobility MS. Negative ion mass, collision-induced dissociation (CID), and ion mobility spectra were recorded using a Waters Synapt G2Si mass spectrometer (Waters Corp.) equipped with a nanoelectrospray ion source. Waters Driftscope (version 2.8) software and MassLynx™ (version 4.1) were used for data acquisition and processing. Spectra were interpreted as previously described (Harvey et al., Anal Biochem 376, 44-60, 2008). The results served as the basis for the generation of sample-specific glycan libraries, which were subsequently used for site-specific N-glycosylation analysis. For site-specific N-glycosylation analysis, prior to digestion, the trimers were denatured and incubated in 50 mM Tris / HCl, pH 8.0, containing 6 M urea and 5 mM dithiothreitol (DTT) for 1 h at room temperature (RT). Subsequently, they were alkylated by adding 20 mM iodoacetamide (IAA) and incubating in the dark for an additional 1 h at RT, followed by an additional 1 h of DTT addition to remove residual IAA. The alkylated trimers were buffer-exchanged into 50 mM Tris / HCl, pH 8.0, using a Vivaspin column and digested separately with trypsin and chymotrypsin (mass spectrometry grade, Promega) at a 1:30 (w / w) ratio.Glycopeptides were selected from the protease-digested samples using the ProteoExtract Glycopeptide Enrichment Kit (Merck Millipore). Enriched glycopeptides were analyzed by LC-ESI MS on an Orbitrap Fusion Mass Spectrometer (Thermo Fisher Scientific) using high-energy collision dissociation (HCD) fragmentation. Data analysis and glycopeptide identification were performed using Byonic™ (version 2.7) and Byologic™ software (version 2.3; Protein Metrics Inc).
[0079] BN-PAGE: Env proteins and nanoparticles were analyzed by blue native polyacrylamide gel electrophoresis (BN-PAGE) and stained with Coomassie blue. Protein samples were mixed with G250 loading dye and loaded onto a 4-12% Bis-Tris NuPAGE gel (Life Technologies). BN-PAGE gels were run at 150 V for 2.5 h using NativePAGE™ running buffer (Life Technologies) according to the manufacturer's instructions.
[0080] Differential scanning calorimetry (DSC): 20°C to 120°C, 90°C -1 UFO was measured using a MicroCal VP capillary calorimeter (Malvern) in PBS buffer at a scan rate of 2 -BG trimer, UFO 2 The thermal stability of the -U trimer and trimer-displaying nanoparticles was measured. Data were analyzed using VP Capillary DSC automated data analysis software.
[0081] Protein production and purification for crystallization: Clade B tier-3 H078.14 UFO in FreeStyle 293 S cells 2The -BG trimer was expressed and purified from the culture supernatant using a 2G12-binding affinity matrix followed by size-exclusion chromatography (SEC). Fabs PGT124 and 35O22 were transiently transfected into mammalian FreeStyle 293F cells (Invitrogen) and purified using an LC-λ capture selection column, followed by further purification by ion-exchange chromatography and SEC using a Superdex 200 16 / 60 column. H078.14 UFO 2 Trimeric complexes were prepared by mixing the -BG trimeric protein with PGT124 and 35O22 at a molar ratio of 1:3:2 for 30 minutes at room temperature. To reduce the heterogeneity of the trimeric complex, endoglycosidase H (New England Biolabs) was used to prepare H078.14 UFO produced in 293S cells. 2 -BG.664 was deglycosylated overnight at 4° C. After further purification of the complex by SEC, the trimeric complex was subjected to crystallography.
[0082] Protein crystallization and data collection: H078.14 UFO purified by SEC 2 The UFO-BG trimeric complex was concentrated to approximately 5 mg / ml and subjected to large-scale crystallization experiments at both 4°C and 20°C. UFO was crystallized from 0.1 M calcium acetate, 0.1 M MES (pH 6.0), and 15% (v / v) PEG400. 2 Crystals of a protein complex containing the Fab PGT124 and 35O22 bound to a -BG trimer were obtained by harvesting, cryoprotection with 25% glycerol, and immediate flash-cooling in liquid nitrogen. The best crystals to date diffracted to 6.20 Å resolution. Data were collected on beamline 12-2 at the Stanford Synchrotron Radiation Lightsource, processed using HKL-2000, and indexed in 99.7% complete space group P63 with unit cell dimensions a = b = 129.3 Å, c = 314.5 Å.
[0083] Structure determination and refinement: H078.14 UFO bound to PGT124 and 35O22 by molecular replacement (MR) using Phaser with one protomer of the 35O22:BG505 SOSIP.664 structure (PDB: 5CEZ) and the PGT124 Fab structure (PDB: 4R26). 2 The BG trimer structure was solved. The structure was refined using Phenix, Coot for model building, and MolProbity for structure validation. Due to the limited resolution of the dataset, two B factor sets per residue refinement were used. Further refinement of the position coordinates was performed using a reference model set of restraints. The final R of the complex structure was cryst value and R free The values are 25.0% and 31.4%. Figures were generated with PyMol and Chimera. In the crystal structures, residues are numbered according to the Kabat definition for FAb and the HXBc2 system for gp140.
[0084] Negative stain electron microscopy: UFOs by negative stain EM 2 The β-BG trimer and trimer-displaying nanoparticles were analyzed. Approximately 0.01 mg ml -1 A 3 μL aliquot containing trimers or nanoparticles was applied for 15 seconds onto a carbon-coated 400Cu mesh grid glow-discharged at 20 mA for 30 seconds, then negatively stained with 2% (w / v) uranyl formate for 30 seconds. Approximately 25 e resulted in a pixel size of 2.05 Å on the specimen surface. - Å -2 Data were collected using an FEI Tecnai Spirit electron microscope operating at 120 kV with an electron dose of 1000 kJ and a magnification of 52,000x. Images were acquired with a Tietz 4k x 4k TemCam-F416 CMOS camera using a nominal defocus of 1500 nm and a Leginon package. UFOs were extracted from the raw micrographs using DoG Picker. 2The -BG trimer particles were automatically selected, and trimer-presenting nanoparticles were manually selected using Appion Manual Picker. Both were placed into particle stacks using the software package. Reference-free two-dimensional (2D) class averages were calculated using particles divided into two bins and sorted into classes by iterative multivariate statistical analysis (MSA) / multiple reference alignment (MRA). To analyze the quality of the trimers (native-like and non-native), the reference-free 2D class averages were visually inspected as previously described (de Taeye et al., Cell 163, 1702-1715, 2015).
[0085] Biolayer Interferometry (BLI): The kinetics of trimer and nanoparticle binding to bNAb and non-NAb were measured using an Octet Red 96 instrument (forteBio, Pall Life Sciences). All assays were performed in ForteBio 1x kinetic buffer with stirring set at 1000 rpm. The final volume of all solutions was 200 μl / well. Assays were performed in solid black 96-well plates (Geiger Bio-One) at 30°C. 5 μg ml of anti-human Fc capture biosensor (AHC) was applied to the surface of the AHC in 1x kinetic buffer. -1 The antibody was loaded for 300 seconds. A 60-second biosensor baseline step was applied, and then the binding of the antibody to the antigen on the biosensor in solution was analyzed over 200 seconds. A two-fold concentration gradient of antigen, starting at 200 nM for trimers and 14–35 nM for nanoparticles, was used in six titration series, depending on size. The dissociation of the interaction was followed for 300 seconds. Correction for baseline fluctuations was performed by subtracting the mean shift recorded for sensors loaded with antibody but not incubated with antigen, and for sensors without antibody but incubated with antigen. Octet data were processed using forteBio's Data Acquisition Software v.8.1. Notably, for apex-directed bNAbs, the experimental data were fitted using a binding equation representing a 2:1 interaction to achieve the best fit results.
[0086] B cell activation assay: The generation of K46 B cell lines expressing PGT121, PGT145, or VRCO1 was previously described (Ota et al., J. Immunol. 189, 4816-4824, 2012). Briefly, cells were cultured in 10% FCS, Pen / Strep antibiotics, and 2 μg ml -1 K46 cells expressing doxycycline-inducible bNAb B-cell receptor (BCR) were maintained in advanced DMEM (Gibco) supplemented with puromycin (Gibco). Cells were incubated at 1 μg ml -1 Human BCR expression was induced by overnight treatment with doxycycline (Clontech). After loading with 1 μM Indo-1 (Molecular Probes) for 1 hour at 37°C, 10 μg / ml -1 Concentrations of the indicated agents: anti-mouse IgM (Jackson ImmunoResearch); UFO with a T-helper epitope fused to the C-terminus (PADRE); 2 -BG or HR1-redesigned gp140 trimer; UFO presenting HR1-redesigned gp140 trimer 2 Washed cells were stimulated with ‐BG‐FR or I3‐01 nanoparticles. Calcium mobilization was assessed using an LSR II flow cytometer (BD). In each run, unstimulated B cells were first recorded for 60 seconds, the test immunogen was added, mixed thoroughly, and recorded for 180 seconds, followed by 1 μg ml -1 1 μl of ionomycin (Sigma) was added and recorded for an additional 60 seconds to confirm indo loading.
[0087] Mouse immunization and serum IgG purification: Seven-week-old BALB / c mice were purchased from the Jackson Laboratory. Mice were housed in ventilated cages in an environmentally controlled room at TSRI in accordance with approved IACUC protocols and AAALAC guidelines. At week 0, each mouse was immunized intraperitoneally (ip) with 200 μl of an antigen / adjuvant mixture containing 50 μg of antigen and 100 μl of AddaVax adjuvant (Invivogen) or 50 μl of PIKA adjuvant (Yisheng Biopharma) according to the manufacturer's instructions. At weeks 3 and 6, animals were boosted with 50 μg of antigen formulated in AddaVax or PIKA adjuvant. At week 8, animals were terminally bled through the retroorbital membrane using a heparinized capillary tube. The sample was diluted with an equal volume of PBS and then layered on 4.5 ml of Ficoll / Histopaque in a 15 ml SepMate tube (StemCell) and centrifuged at 1200 RPM for 10 minutes at 20°C to separate plasma and cells. Plasma was heat-inactivated at 56°C for 1 hour, centrifuged at 1200 RPM for 10 minutes, and sterile filtered. Cells were washed once with PBS and then resuspended in 1 ml of ACK red blood cell lysis buffer (Lonza). After washing twice with PBS, PBMCs were resuspended in 2 ml of Bambanker Freezing Media (Lymphotec Inc.). Spleens were also harvested and ground through a 40 μm cell strainer (BD Falcon) to release splenocytes into a cell suspension. Cells were centrifuged, washed with PBS, and then treated with 10 ml of RBC lysis buffer according to the manufacturer's specifications and resuspended in Bambanker Freezing Media for cell freezing. One-third of the total serum per mouse, i.e., 600 μl of serum, was purified using a 0.2 ml Protein G spin kit (Thermo Scientific) according to the manufacturer's instructions. Purified serum IgG from four mice within each group was combined for characterization by ELISA and HIV-1 neutralization assays.
[0088] Enzyme-linked immunosorbent assay (ELISA): First, each well of a Costar™ 96-well assay plate (Corning) was coated with 50 μl of PBS containing 0.2 μg of the appropriate antigen. The plate was incubated overnight at 4°C and then washed five times with a wash buffer containing PBS and 0.05% (v / v) Tween 20. PBS, 20 mg ml -1 Each well was coated with 150 μl of blocking buffer consisting of blotting-grade blocker (Bio-Rad) and 5% (v / v) FBS. The plate was incubated with blocking buffer for 1 hour at room temperature and then washed five times with wash buffer. Purified mouse IgG was added to the blocking buffer at a maximum concentration of 100 μg ml. -1 The antibody was diluted to 1:1000, followed by 10-fold serial dilutions. A total of 50 μl of each antibody dilution was added to the appropriate wells. Each plate was incubated for 1 hour at room temperature and then washed five times with wash buffer. Next, a 1:2000 dilution of horseradish peroxidase (HRP)-labeled goat anti-mouse IgG antibody (Jackson ImmunoResearch Laboratories) was made in wash buffer, and 50 μl of this diluted secondary antibody was added to each well. The plate was incubated with the secondary antibody for 1 hour at room temperature and then washed five times with wash buffer. Finally, the wells were reacted with 50 μl of TMB (Life Sciences) for 3–5 minutes, followed by quenching with 50 μl of 2N sulfuric acid. The resulting plate reading was measured at 450 nm.
[0089] Pseudovirus generation and neutralization assay: Pseudovirus was generated by transfecting 293 T cells with an HIV-1 Env expression plasmid and an Env-deleted genome backbone plasmid (pSG3ΔEnv) as described previously. Pseudovirus was harvested 72 hours posttransfection for use in neutralization assays. The neutralization activity of purified mouse serum IgG was assessed using a single-replicate pseudovirus assay and TZM-bl target cells as described previously. Briefly, TZM-bl cells were seeded into 96-well flat-bottom plates. Pseudovirus was added to the plates, which were then preincubated with serial dilutions of mouse serum IgG at 37°C for 1 hour. Luciferase reporter gene expression was quantified 72 hours postinfection by lysis and addition of Bright-Glo™ luciferase substrate (Promega). Dose-response curves were fitted by nonlinear regression to determine IC50 values.
[0090] Mouse repertoire sequencing and bioinformatics analysis: As previously described, a 5'-RACE protocol was developed for unbiased sequencing of the mouse B cell repertoire. Briefly, RNA (including mRNA) was extracted from total PBMCs of each mouse in 30 μl of water using the RNeasy Mini Kit (Qiagen). 5'-RACE was performed using the SMARTer RACE cDNA Amplification Kit (ClonTech). Immunoglobulin PCR was set up using a total volume of 50 μl of Platinum Taq High-Fidelity DNA Polymerase (Life Technologies), 5 μl of cDNA as template, 1 μl of 5'-RACE primer, and 1 μl of 10 μM reverse primer. The 5'-RACE primer contained a PGM / S5 P1 adapter, and the reverse primer contained a PGM / S5 A adapter. The reverse primer for 5'-RACE PCR of the heavy chain was a mouse 3'-C γ 1-3 and 3'-C μThe inner primers were adapted. A total of 25 PCR cycles were performed, and the expected PCR products (500-600 bp) were gel-purified (Qiagen). Next generation sequencing was performed using the Ion S5 system. Briefly, heavy chain libraries obtained from the same group were quantified using a Qubit® 2.0 fluorometer with the Qubit® dsDNA HS Assay Kit and then mixed at a 1:1:1:1 ratio for sequencing. Template preparation (Ion 520) and chip loading were performed using Ion Chef with the Ion 520 / 530 Ext kit, followed by sequencing using the Ion S5 system with default settings. The mouse antibodyomics pipeline was used to process the raw data and determine the distribution of heavy chain germline gene usage.
[0091] [Example 7] Nanoparticles encapsulating T-helper epitopes Although the use of T helper epitopes as linkers connecting HIV-1 gp140 and the nanoparticle backbone generated HIV-1 trimer-displaying nanoparticles with desirable antigenic and immunogenic properties (Figures 1-3), the assembly of such nanoparticles appeared to be affected by the hydrophobic T helper epitopes exposed on the nanoparticle surface. To improve nanoparticle assembly and purity, we explored an alternative strategy for incorporating T cell helper epitopes into the nanoparticle vaccine design. Instead of inserting a T helper epitope between the antigen on the outer surface and the nanoparticle backbone, we genetically fused this T helper epitope to the C-terminus of the nanoparticle subunit via a short, flexible peptide spacer. The predicted result was a nanoparticle vaccine with 20 HIV-1 gp140 trimers displayed on the outer surface and 60 hydrophobic T helper epitopes encapsulated within the nanoparticle shell (Figure 4A). This design was devised based on the observation that both E2p and I3-01 are large 60-mer nanocages with hollow interiors, and that almost all proteins prefer a hydrophobic core and a charged / hydrophilic surface to achieve stability in solution.
[0092] This strategy was tested using the pan-reactive T-helper epitope PADRE. The constructs consisted of a 1G spacer (for E2p) or a 10aa GGGGSGGGGS spacer (for I3-01) containing an enzyme site (AS) before the spacer, followed by a 5aa GGGGS spacer to fuse the C-terminus of PADRE to the C-terminus of the nanoparticle subunit. The resulting two fusion constructs were transiently expressed in 25 ml of ExpiCHO cells and purified using a 2G12 antibody affinity column. The resulting proteins were analyzed by size-exclusion chromatography (SEC) using a Superose 6 10 / 300 GL column. For both constructs, a peak at 6–7 ml was observed, corresponding to well-formed nanoparticles (Figure 4B). Considering the relatively small-scale transfection volume (25 ml vs. 100 ml in Figure 1F), the actual nanoparticle yield was significantly improved compared to designs in which T-helper epitopes were used as external linkers to the nanoparticles. The 2G12-purified nanoparticles were further analyzed by negative-stain EM. Fully assembled nanoparticles with spikes on their surface can be recognized from the raw micrographs obtained from negative-stain EM (Figure 4C). Collectively, the SEC and EM data confirmed that T-helper epitope encapsulation may represent an effective strategy for designing HIV-1 nanoparticle vaccines incorporating T-cell help.
[0093] T-helper epitopes can be fused to the C-terminus of the subunits of self-assembled nanoparticles via short peptide spacers. The C-terminus of HIV-1 gp140 can be fused to the N-terminus of the subunits of the nanoparticles. When these fused subunits are assembled into nanoparticles, 8 or 24 HIV-1 gp140 trimers are displayed on the outer surface of the nanoparticle, and 24 or 60 T-helper epitopes are encapsulated within the nanoparticle shell. The HIV-1 gp140 trimers on the outer surface of the nanoparticles elicit anti-HIV-1 B cell responses, while the dense clusters of T-helper epitopes within the nanoparticles elicit broadly reactive T cell responses upon digestion of the nanoparticle protein.
[0094] Thus, the present invention has been broadly disclosed and illustrated with reference to the above exemplary embodiments, and it will be understood that various modifications can be made thereto without departing from the spirit and scope of the invention.
[0095] Furthermore, it should be noted that all publications, sequence accession numbers, patents, and patent applications cited herein are expressly incorporated by reference in their entirety for all purposes, as if each were individually so indicated. Definitions contained in text incorporated by reference herein are excluded if they conflict with definitions in this disclosure.
Claims
1. An HIV-1 vaccine immunogen comprising an HIV-1 Env-derived trimeric protein displayed on self-assembled nanoparticles, wherein a subunit of the self-assembled nanoparticle comprises a polypeptide set forth in any one of SEQ ID NOs: 6 to 17, and wherein a linker sequence is either (a) fused to the C-terminus of the nanoparticle subunit while the HIV-1 Env-derived trimeric protein subunit is fused to the N-terminus of the nanoparticle subunit, or (b) attaches the HIV-1 Env-derived trimeric protein to the N-terminus of the nanoparticle subunit.
2. 2. The HIV-1 vaccine immunogen of claim 1, wherein the C-terminus of the nanoparticle subunit is fused to the N-terminus of the linker sequence via a short peptide spacer.
3. The HIV-1 vaccine immunogen described in claim 1, wherein the HIV-1 Env-derived trimeric protein subunit is fused to the N-terminus of the nanoparticle subunit via a second peptide spacer.
4. 2. The HIV-1 vaccine immunogen of claim 1, wherein the HIV-1 Env-derived trimeric protein is an uncleaved pre-fusion optimized (UFO) gp140 trimer.
5. UFO gp140 trimer is a modified gp41 derived from HIV-1 strain BG505. ECTO A chimeric trimer containing a modified gp41 domain ECTO 5. The HIV-1 vaccine immunogen of claim 4, wherein the domain comprises (1) an HR1 N-terminal vent replaced with a stabilizing loop sequence and (2) a cleavage site linker.
6. 2. The HIV-1 vaccine immunogen of claim 1, wherein the linker sequence comprises a T-helper epitope sequence or a glycine-serine linker, or both.
7. 2. The HIV-1 vaccine immunogen of claim 1, wherein the linker sequence comprises a T helper epitope sequence set forth in any one of SEQ ID NOs: 1 to 3, or a variant thereof having at least 95% sequence identity.
8. 2. The HIV-1 vaccine immunogen of claim 1, wherein the linker sequence comprises 1 to 5 tandem repeats of GGGGS (SEQ ID NO: 4) or GSGSG (SEQ ID NO: 19).
9. 2. The HIV-1 vaccine immunogen of claim 1, wherein the linker sequence is fused to the C-terminus of the nanoparticle subunit via a short peptide spacer, and a second peptide spacer connects the HIV-1 Env-derived trimeric protein subunit to the N-terminus of the nanoparticle subunit.
10. An isolated or recombinant polynucleotide encoding the HIV-1 vaccine immunogen of claim 1.
11. An isolated or recombinant polynucleotide encoding the HIV-1 vaccine immunogen of claim 1.
12. A pharmaceutical composition comprising the HIV-1 vaccine immunogen of claim 1 and a pharmaceutically acceptable carrier.
13. 13. The pharmaceutical composition of claim 12, further comprising an adjuvant.
14. A pharmaceutical composition comprising the HIV-1 vaccine immunogen of claim 1 and a pharmaceutically acceptable carrier.
15. 15. The pharmaceutical composition of claim 14, further comprising an adjuvant.
16. The pharmaceutical composition of claim 12 or 13 for preventing HIV-1 infection in a subject.
17. 17. The pharmaceutical composition of claim 16, wherein the HIV-1 vaccine immunogen comprises a UFO gp140 trimer, self-assembled nanoparticles produced using a subunit sequence set forth in any one of SEQ ID NOs: 6-17, and a T-helper epitope sequence comprising the sequence set forth in SEQ ID NO: 1, wherein the T-helper epitope sequence covalently links the UFO gp140 trimer subunit at its C-terminus to the N-terminus of the nanoparticle subunit.
18. The pharmaceutical composition according to claim 14 or 15 for preventing HIV-1 infection.
19. 19. The pharmaceutical composition of claim 18, wherein the HIV-1 vaccine immunogen comprises a UFO gp140 trimer, self-assembled nanoparticles produced using a subunit sequence set forth in any one of SEQ ID NOs: 6-17, and a T helper epitope sequence comprising the sequence set forth in SEQ ID NO: 1, wherein the T helper epitope sequence is fused to the C-terminus of the nanoparticle subunit via a short peptide spacer, while the UFO gp140 trimer subunit is fused to the N-terminus of the nanoparticle subunit.
20. 19. The pharmaceutical composition of claim 18, wherein the T helper epitope sequence fused to the C-terminus of the nanoparticle subunit is encapsulated within the nanoparticle upon self-assembly of the nanoparticle.
21. The pharmaceutical composition of claim 12 or 13 for treating HIV-1 infection in a subject or for inducing an immune response against HIV-1 in a subject.
22. 22. The pharmaceutical composition of claim 21, wherein the HIV-1 vaccine immunogen comprises a UFO gp140 trimer, self-assembled nanoparticles produced using a subunit sequence set forth in any one of SEQ ID NOs: 6-17, and a T-helper epitope sequence comprising the sequence set forth in SEQ ID NO: 1, wherein the T-helper epitope sequence covalently links the UFO gp140 trimer at its C-terminus to the N-terminus of the nanoparticle subunit.
23. The pharmaceutical composition of claim 14 or 15 for treating HIV-1 infection in a subject or for inducing an immune response against HIV-1 in a subject.
24. 24. The pharmaceutical composition of claim 23, wherein the HIV-1 vaccine immunogen comprises a UFO gp140 trimer, self-assembled nanoparticles produced using a subunit sequence set forth in any one of SEQ ID NOs: 6-17, and a T helper epitope sequence comprising the sequence set forth in SEQ ID NO: 1, wherein the T helper epitope sequence is fused to the C-terminus of the nanoparticle subunit via a short peptide spacer, while the UFO gp140 trimer subunit is fused to the N-terminus of the nanoparticle subunit.
25. 25. The pharmaceutical composition of claim 24, wherein the T helper epitope sequence fused to the C-terminus of the nanoparticle subunit is encapsulated within the nanoparticle upon self-assembly of the nanoparticle.
Citation Information
Patent Citations
Compositions and methods relating to diseases associated with the deposition of amyloid, tau, and α-synuclein.
JP2015527369A
Stabilized human immunodeficiency virus (hiv) envelope (env) trimer vaccine and methods of using same
JP2016503819A
HLA-a1, a2 -a3,-a24,-b7,and -b44 tumor associated antigen peptides and compositions
WO2004052917A2
Polypeptide assemblies and methods for the production thereof
WO2016138525A1
Engineered outer domain (EOD) of HIV GP120, mutants and use thereof
WO2016205704A2