Substituted oxoisoindolinylpiperidine-2,6-dione compounds

Abstract

Formula (I): TIFF2026500094000217.tif37107 [Wherein R is and rings A, L, R1, R2, R3, m, and n are defined in this disclosure], its stereoisomers, its tautomers, or salts thereof. Also disclosed are methods of using the compounds to decrease cyclin E1 levels; and pharmaceutical compositions containing the compounds. These compounds are useful for treating proliferative diseases (e.g., cancer).

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims priority to U.S. Provisional Application No. 63 / 582,266, filed September 13, 2023, which is incorporated herein by reference in its entirety.

[0002] explanation The present invention generally relates to substituted oxoisoindolinylpiperidine-2,6-dione compounds that are effective in reducing cyclin E1 protein levels. The present invention provides substituted oxoisoindolinylpiperidine-2,6-dione compounds, compositions containing such compounds, and methods for their use. The present invention also relates to pharmaceutical compositions containing at least one compound described herein that are effective in treating proliferative diseases (e.g., cancer). [Background technology]

[0003] Cyclin E1, encoded by the CCNE1 gene, is a member of the E-type cyclin family. Cyclin E1 regulates various cellular processes, including cell cycle progression, DNA replication, histone biosynthesis, and transcriptional regulation. During the G1 phase of the cell cycle, cyclin E1 binds to and activates cyclin-dependent kinases (CDKs), particularly CDK2, to form an active cyclin E1 / CDK2 complex. This complex phosphorylates RB1 and other RB family proteins, leading to the activation of E2F family transcription factor proteins and subsequent cell cycle progression (Asghar et al., Nat. Rev. Drug. Dis. 14:130-146(2015); Otto & Sicinski, Nat. Rev. Can. 17:93-115(2017)).

[0004] Dysregulation of the cell cycle is a hallmark of cancer. Cyclin E1 is frequently overexpressed and proliferated in cancer cells, and is associated with cell cycle deregulation (Witkiewicz et al., Trends in Cancer Vol 8(9) 711-725(2022)). CCNE1 amplification is associated with poor clinical outcomes in various cancers, including gynecological cancers (breast, ovarian, and endometrial cancers), gastrointestinal cancers (e.g., gastric and bladder cancers), and other solid or hematologic cancers (Keyomarsi et al., NEJM 347(20):1566-1575(2002); Macheret et al., Nature 555:112-116(2018); Etemadmoghadam et al., PLos One 5(11):e15498 pages 1-14(2010); Au-Yeung et al., Clin. Can. Res. 23(7):1862-1874(2017)). Depletion of cyclin E1 protein is a promising strategy for treating such cancers.

[0005] Overexpression of cyclin E1 is involved in resistance to several anticancer drugs, such as CDK4 / 6 inhibitors, endocrine therapy, Her2-targeted drugs, PARP inhibitors, and chemotherapy, suggesting that depletion of cyclin E1 protein, either alone or in combination, may overcome or prevent resistance to these drugs (Turner et al. J. Clin. Oncol. 37(14):1169-1178(2019); Herrera-Abreu et al., Cancer Res. 76(8):2301-2313(2016); Scaltriti et al., PNAS 108(9):3761-3766(2011); Freeman-Cook et al., Cancer Cell 39, 1-18(2021)).

[0006] There is a need for therapeutic approaches that directly target cyclin E1 to reduce cyclin E1 protein levels in cancer. A therapeutic approach that selectively reduces cyclin E1 protein levels in cancer cells while minimizing GSPT1 (transcription termination factor: G1-to-S phase transition protein 1) degradation in normal tissues is needed to maximize the therapeutic index and promote effective clinical responses. Reduction of GSPT1 protein in normal human tissues has been associated with dose-limiting and on-target toxicity (Uy et al., Blood 13 November 2019, http: / / doi.org / 10.1182 / blood-2019-123966).

[0007] There is a need for therapeutic methods that reduce cyclin E protein levels.

[0008] There is a need for therapeutic approaches that reduce cyclin E protein levels and minimize GSPT1 degradation.

[0009] The present invention fulfills the above needs by providing compounds that are effective in reducing cyclin E levels and that are selective for the degradation of GSPT1. Summary of the Invention

[0010] The present invention provides substituted oxoisoindolinylpiperidine-2,6-dione compounds of formula (I), including their stereoisomers, their tautomers, their salts, and their prodrugs, that are effective in reducing cyclin E1 levels.

[0011] The present invention further provides a pharmaceutical composition comprising a compound of formula (I), a stereoisomer thereof, a tautomer thereof, a salt thereof, or a prodrug thereof; and a pharmaceutically acceptable carrier.

[0012] The present invention further provides a method of treating a disease or disorder caused by a decrease in cyclin E1 levels, comprising administering to a patient a compound of formula (I), a stereoisomer thereof, a tautomer thereof, a salt thereof, or a prodrug thereof.

[0013] The present invention further provides processes and intermediates for preparing compounds of formula (I), their stereoisomers, their tautomers, or their salts.

[0014] The present invention further provides a method of using a compound of formula (I), a stereoisomer thereof, a tautomer thereof, a pharmaceutically acceptable salt thereof, or a prodrug thereof, for the manufacture of a medicament for reducing cyclin E protein levels for the treatment of certain diseases, including cancer.

[0015] The compounds of formula (I) and compositions containing the compounds of formula (I) can be used to treat, prevent, or cure various proliferative diseases (e.g., cancer). Pharmaceutical compositions containing these compounds are useful for treating, preventing, or slowing the progression of diseases or disorders (e.g., cancer) in various treatment sites.

[0016] These and other features of the present invention are set forth in the broader disclosure that follows.

[0017] The present invention will now be described with reference to the accompanying drawings. [Brief explanation of the drawings]

[0018] [Figure 1] FIG. 1 shows the dose response of Example 35 in the degradation of cyclin E1 (FIG. 1A), inhibition of RB1 phosphorylation (FIG. 1B), and degradation of GSPT1 (FIG. 1C) in HCC1569 cells. [Figure 2] FIG. 2 shows the antitumor activity of Example 35 administered orally once daily at 10 mpk, 30 mpk and 100 mpk for 28 days against HCC1569 xenografts in mice. [Figure 3]FIG. 3 shows the antitumor activity of Example 35 administered orally once daily at 30 mpk, 100 mpk and 250 mpk for 28 days against OVCAR3 xenografts in mice. [Figure 4] FIG. 4 shows the antitumor activity of Example 35 administered orally once daily at 3 mpk, 10 mpk and 30 mpk for 28 days against MKN1 xenografts in mice. DETAILED DESCRIPTION OF THE INVENTION

[0019] Applicant has discovered substituted oxoisoindolinylpiperidine-2,6-dione compounds that reduce cyclin E1 protein levels. It is believed that the substituted oxoisoindolinylpiperidine-2,6-dione compounds promote the interaction of cyclin E1 protein with the corresponding E3 ubiquitin ligase complex (Cullin4-cereblon, CUL4-CRBN), resulting in the degradation of the cyclin E1 protein. These compounds are useful for treating certain diseases, including cancer. The compounds provide useful pharmaceuticals with desirable stability, bioavailability, therapeutic index, and toxicity profile, all of which are important for druggability.

[0020] A first aspect of the present invention provides a compound having at least one formula (I): [ka] [In the formula, R is [ka] and; L is -O-, -CH2-, -C(CH3)2-, -CF2-, -NH-, -N(CH3)-, or [ka] and; Ring A is phenyl, naphthalenyl, or benzo[b]thiophenyl; R1 is -OCH3, -OCH2CH3, -OCH(CH3)2, -OCH2CH(CH3)2, -OCHF2, -OCH2C(CH3)2OH, -OCH2CH2OCH3, -OCH2C(O)OCH3, -OCH2C(O)NH2, -OCH2C(O)N(CH3)2, -OCH2C(O)N(CH3)(CH2CH3), -OCH2CH2CH2(phenyl), -OCH2C(O)(morpholinyl), -O(C4-6cycloalkyl), -O(hydroxycyclohexyl), -O(oxetanyl), -O(tetrahydrofuranyl), -O(tetrahydropyranyl), -O(oxepanyl), -O(phenyl), -O(pyridinyl), or O(acetylpiperidinyl); R2 is F, Cl, -CH3, or -OCH3; each R3 is independently F, Cl, Br, -CH3, -CD3, -CHF2, -CF3, -OCH3, or cyclopropyl; m is 0 or 1; and n is 0, 1, 2, or 3] or a stereoisomer thereof, a tautomer thereof, or a salt thereof.

[0021] A second aspect of the present invention relates to a compound having at least one formula (I): [ka] [In the formula, R is [ka] and; L is -O-, -CH2-, -C(CH3)2-, -CF2-, -NH-, -N(CH3)-, or [ka] and; R1 is -OCH3, -OCH2CH3, -OCH(CH3)2, -OCHF2, or -O(phenyl); R2 is F, Cl, -CH3, or -OCH3; each R3 is independently F, Cl, Br, -CH3, or -OCH3; m is 0 or 1; and n is 0, 1, 2, or 3] or a stereoisomer thereof, a tautomer thereof, or a salt thereof.

[0022] Certain embodiments provide a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof:

[0023] Certain embodiments provide a compound of formula (I), a stereoisomer thereof, or a tautomer thereof:

[0024] Certain embodiments provide a salt of a compound of formula (I), a stereoisomer thereof, or a tautomer thereof.

[0025] Certain embodiments provide a pharmaceutically acceptable salt of a compound of formula (I), a stereoisomer thereof, or a tautomer thereof.

[0026] An embodiment provides a salt of a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein ring A is phenyl.

[0027] Certain embodiments provide a salt of a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein ring A is naltalenyl or benzo[b]thiophenyl.

[0028] In one embodiment, R is [ka] The present invention provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein

[0029] In one embodiment, R is [ka] The present invention provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein

[0030] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein L is -O-, -CH2-, -C(CH3)2-, -CF2-, -NH-, or -N(CH3)-.

[0031] One embodiment provides a compound of Formula (I), a stereoisomer thereof, or a tautomer thereof, wherein L is -O-, -CH2-, -C(CH3)2-.

[0032] An embodiment provides a compound of Formula (I), a stereoisomer thereof, or a tautomer thereof, wherein L is -O- or -CH2-.

[0033] One embodiment provides a compound of formula (I), a stereoisomer thereof, or a tautomer thereof, wherein L is -O-.

[0034] In some embodiments, L is -CH2-, -C(CH3)2-, -CF2-, or [ka] The present invention provides a compound of formula (I), a stereoisomer thereof, or a tautomer thereof, wherein:

[0035] In some embodiments, L is -CH2-, -C(CH3)2-, or [ka] The present invention provides a compound of formula (I), a stereoisomer thereof, or a tautomer thereof, wherein:

[0036] One embodiment provides a compound of Formula (I), a stereoisomer thereof, or a tautomer thereof, wherein L is —CH 2 — or —C(CH 3 ) 2 —.

[0037] An embodiment provides a compound of Formula (I), a stereoisomer thereof, or a tautomer thereof, wherein L is -CH2-.

[0038] An embodiment provides a compound of Formula (I), a stereoisomer thereof, or a tautomer thereof, wherein L is -C(CH3)2-.

[0039] An embodiment provides a compound of Formula (I), a stereoisomer thereof, or a tautomer thereof, wherein L is -CF2-.

[0040] In some embodiments, L is [ka] The present invention provides a compound of formula (I), a stereoisomer thereof, or a tautomer thereof, wherein:

[0041] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein L is -NH- or -N(CH3)-.

[0042] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein L is -NH-.

[0043] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein L is —N(CH 3 )—.

[0044] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is independently F, Cl, Br, -CH3, -CD3, -CHF2, -CF3, or -OCH3.

[0045] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is independently F, Cl, Br, -CH3, or -CD3.

[0046] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is independently F, Cl, Br, or -CH3.

[0047] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is independently F, Cl, or -CH3.

[0048] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is independently F or Cl.

[0049] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is F.

[0050] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is independently F, Cl, -CH3, -CD3, or -OCH3.

[0051] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is independently F, Cl, -CH3, or -OCH3.

[0052] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is independently F, -CH3, or -OCH3.

[0053] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is independently F, -CH3, -CD3, or -OCH3.

[0054] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein each R3 is F.

[0055] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 0.

[0056] An embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1.

[0057] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein n is 0.

[0058] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein n is 1, 2, or 3.

[0059] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein n is 1 or 2.

[0060] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein n is 2 or 3.

[0061] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein n is 1.

[0062] An embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein n is 2.

[0063] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein n is 3.

[0064] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 0 and n is 0, 1, or 2.

[0065] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 0 and n is 1, 2, or 3.

[0066] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 0 and n is 0 or 2.

[0067] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 0 and n is 0.

[0068] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 0 and n is 1.

[0069] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 0 and n is 2.

[0070] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 0 and n is 3.

[0071] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and n is 0, 1, or 2.

[0072] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and n is 1, 2, or 3.

[0073] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and n is 0 or 2.

[0074] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and n is 0.

[0075] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and n is 1.

[0076] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and n is 2.

[0077] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and n is 3.

[0078] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is F, -CH3, or -OCH3.

[0079] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is Cl, -CH3, or -OCH3.

[0080] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is F, Cl, or -OCH3.

[0081] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is F, Cl, or -CH3.

[0082] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is F.

[0083] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is Cl.

[0084] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is F or Cl.

[0085] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is -CH3.

[0086] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is -OCH3.

[0087] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is -CH3 or -OCH3.

[0088] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 1 and R2 is F or -OCH3.

[0089] One embodiment provides a compound of Formula (I), its stereoisomer, its tautomer, or a salt thereof, wherein n is 1; and R is F, Cl, -CH, or -OCH. This embodiment includes compounds where R is F, Cl, or -CH.

[0090] One embodiment provides a compound of Formula (I), its stereoisomer, its tautomer, or a salt thereof, wherein n is 2; and each R is independently F, Cl, -CH, or -OCH. This embodiment includes compounds where each R is independently F, Cl, or -CH.

[0091] One embodiment provides a compound of Formula (I), its stereoisomer, its tautomer, or a salt thereof, wherein n is 3; and each R is independently F, Cl, -CH, or -OCH. This embodiment includes compounds where each R is independently F, Cl, or -CH.

[0092] One embodiment provides a compound of Formula (I), its stereoisomer, its tautomer, or a salt thereof, wherein m is 0; n is 1; and R is F, Cl, -CH, or -OCH. This embodiment includes compounds where R is F, Cl, or -CH.

[0093] One embodiment provides a compound of Formula (I), its stereoisomer, its tautomer, or a salt thereof, wherein m is 0; n is 2; and each R is independently F, Cl, -CH, or -OCH. This embodiment includes compounds where each R is independently F, Cl, or -CH.

[0094] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein m is 0; n is 3; and each R3 is independently F, Cl, -CH3, or -OCH3.

[0095] One embodiment provides a compound of Formula (I), its stereoisomer, its tautomer, or a salt thereof, wherein m is 1; n is 1; and R3 is F, Cl, -CH3, or -OCH3. This embodiment includes compounds where R3 is F, Cl, or -CH3.

[0096] One embodiment provides a compound of Formula (I), its stereoisomer, its tautomer, or a salt thereof, wherein m is 1; n is 2; and each R is independently F, Cl, -CH, or -OCH. This embodiment includes compounds where each R is independently F, Cl, or -CH.

[0097] One embodiment provides a compound of Formula (I), its stereoisomer, its tautomer, or a salt thereof, wherein m is 1; n is 3; and each R is independently F, Cl, -CH, or -OCH. This embodiment includes compounds where each R is independently F, Cl, or -CH.

[0098] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH3, -OCH2CH3, -OCH(CH3)2, -OCH2CH(CH3)2, -OCHF2, -OCH2C(CH3)2OH, -OCH2CH2OCH3, -OCH2C(O)OCH3, -OCH2C(O)NH2, -OCH2C(O)N(CH3)2, or -OCH2C(O)N(CH3)(CH2CH3).

[0099] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH3, -OCH2CH3, -OCH(CH3)2, -OCH2CH(CH3)2, -OCHF2, -OCH2C(CH3)2OH, -OCH2CH2OCH3, or -OCH2C(O)OCH3.

[0100] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH3, -OCH2CH3, -OCH(CH3)2, or -OCH2CH(CH3)2.

[0101] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH3, -OCH2CH3, or -OCH(CH3)2.

[0102] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH3 or -OCH2CH3.

[0103] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH3.

[0104] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH2CH3.

[0105] One embodiment provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH2CH2CH2(phenyl), -OCH2C(O)(morpholinyl), -O(C4-6cycloalkyl), -O(hydroxycyclohexyl), -O(oxetanyl), -O(tetrahydrofuranyl), -O(tetrahydropyranyl), -O(oxepanyl), -O(phenyl), -O(pyridinyl), or O(acetylpiperidinyl).

[0106] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -O(C4-6 cycloalkyl) or -O(hydroxycyclohexyl). Included within this embodiment are compounds where R1 is -O(cyclobutyl) or -O(cyclopentyl). Also included within this embodiment are compounds where R1 is -O(cyclohexyl) or -O(hydroxycyclohexyl).

[0107] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH3, -OCH2CH3, or -OCH(CH3)2; m is 0; n is 1; and R3 is F, Cl, -CH3, or -OCH3. Included in this embodiment are compounds wherein R3 is F, Cl, or -CH3. Also included in this embodiment are compounds wherein R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0108] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, where R1 is -OCH3, -OCH2CH3, or -OCH(CH3)2; m is 0; n is 2; and each R3 is independently F, Cl, -CH3, or -OCH3. Included in this embodiment are compounds where each R3 is independently F, Cl, or -CH3. Also included in this embodiment are compounds where R1 is -OCH3; and each R3 is independently F, Cl, or -CH3.

[0109] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, where R1 is -OCH3, -OCH2CH3, or -OCH(CH3)2; m is 0; n is 3; and each R3 is independently F, Cl, -CH3, or -OCH3. Included in this embodiment are compounds where each R3 is independently F, Cl, or -CH3. Also included in this embodiment are compounds where R1 is -OCH3; and each R3 is independently F, Cl, or -CH3.

[0110] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein R1 is -OCH3, -OCH2CH3, or -OCH(CH3)2; m is 1; n is 1; and R3 is F, Cl, -CH3, or -OCH3. Included in this embodiment are compounds wherein R3 is F, Cl, or -CH3. Also included in this embodiment are compounds wherein R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0111] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, where R1 is -OCH3, -OCH2CH3, or -OCH(CH3)2; m is 1; n is 2; and each R3 is independently F, Cl, -CH3, or -OCH3. Included in this embodiment are compounds where each R3 is independently F, Cl, or -CH3. Also included in this embodiment are compounds where R1 is -OCH3; and each R3 is independently F, Cl, or -CH3.

[0112] One embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, where R1 is -OCH3, -OCH2CH3, or -OCH(CH3)2; m is 1; n is 3; and each R3 is independently F, Cl, -CH3, or -OCH3. Included in this embodiment are compounds where each R3 is independently F, Cl, or -CH3. Also included in this embodiment are compounds where R1 is -OCH3; and each R3 is independently F, Cl, or -CH3.

[0113] In one embodiment, The following structure: [ka]

[0013] Provided is a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, having the formula:

[0014] Included in this embodiment are compounds where n is 0, 1, or 2. Also included in this embodiment are compounds where n is 1. Furthermore, included in this embodiment are compounds where n is 2. Additionally, included in this embodiment are compounds where L is -O- or -CH2-.

[0114] In one embodiment, The following structure: [ka] The present invention provides a compound of formula (I), a stereoisomer thereof, or a tautomer thereof, having the formula: Included in this embodiment are compounds where n is 0, 1, or 2. Also included in this embodiment are compounds where n is 1. Additionally included in this embodiment are compounds where n is 2.

[0115] In one embodiment, The following structure: [ka] The present invention provides a compound of formula (I), a stereoisomer thereof, or a tautomer thereof, having the formula: Included in this embodiment are compounds where n is 0, 1, or 2. Also included in this embodiment are compounds where n is 1. Additionally included in this embodiment are compounds where n is 2.

[0116] In one embodiment, The following structure: [ka] and m is 0 or 1. Included in this embodiment are compounds where m is 0. Also included in this embodiment are compounds where m is 1. Furthermore, included in this embodiment are compounds where L is -O- or -CH2-. Moreover, included in this embodiment are compounds where L is -O-.

[0117] In one embodiment, The following structure: [ka] and m is 0 or 1. Included in this embodiment are compounds where m is 0. Also included in this embodiment are compounds where m is 1. Furthermore, included in this embodiment are compounds where L is -O- or -CH2-. Moreover, included in this embodiment are compounds where L is -O-.

[0118] In one embodiment, The following structure: [ka] and m is 0 or 1. Included in this embodiment are compounds where m is 0. Also included in this embodiment are compounds where m is 1. Furthermore, included in this embodiment are compounds where L is -O- or -CH2-. Moreover, included in this embodiment are compounds where L is -O-.

[0119] In one embodiment, The following structure: [ka] and m is 0 or 1. Included in this embodiment are compounds where m is 0. Also included in this embodiment are compounds where m is 1. Furthermore, included in this embodiment are compounds where L is -O- or -CH2-. Moreover, included in this embodiment are compounds where L is -O-.

[0120] In one embodiment, The following structure: [ka] and m is 0 or 1. Included in this embodiment are compounds where m is 0. Also included in this embodiment are compounds where m is 1. Furthermore, included in this embodiment are compounds where L is -O- or -CH2-. Moreover, included in this embodiment are compounds where L is -O-.

[0121] In one embodiment, The following structure: [ka] and m is 0 or 1. Included in this embodiment are compounds where m is 0. Also included in this embodiment are compounds where m is 1. Furthermore, included in this embodiment are compounds where L is -O- or -CH2-. Moreover, included in this embodiment are compounds where L is -O-.

[0122] In one embodiment, The following structure: [ka] and m is 0 or 1. Included in this embodiment are compounds where m is 0. Also included in this embodiment are compounds where m is 1. Furthermore, included in this embodiment are compounds where L is -O- or -CH2-. Moreover, included in this embodiment are compounds where L is -O-.

[0123] In one embodiment, The following structure: [ka] and m is 0 or 1. Included in this embodiment are compounds where m is 0. Also included in this embodiment are compounds where m is 1. Furthermore, included in this embodiment are compounds where L is -O- or -CH2-. Moreover, included in this embodiment are compounds where L is -O-.

[0124] In one embodiment, The following structure: [ka]

[0013] Provided is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, having the formula:

[0014] Included in this embodiment are compounds where L is -O- or -CH2-. Also included in this embodiment are compounds where L is -O-. Further included in this embodiment are compounds where R1 is -OCH3 or -OCH2CH3; and R3 is F, Cl, -CH3, or -OCH3. Also included in this embodiment are compounds where L is -O-; R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0125] In one embodiment, The following structure: [ka]

[0013] Provided is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, having the formula:

[0014] Included in this embodiment are compounds where L is -O- or -CH2-. Also included in this embodiment are compounds where L is -O-. Further included in this embodiment are compounds where R1 is -OCH3 or -OCH2CH3; and R3 is F, Cl, -CH3, or -OCH3. Also included in this embodiment are compounds where L is -O-; R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0126] In one embodiment, The following structure: [ka]

[0013] Provided is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, having the formula:

[0014] Included in this embodiment are compounds where L is -O- or -CH2-. Also included in this embodiment are compounds where L is -O-. Further included in this embodiment are compounds where R1 is -OCH3 or -OCH2CH3; and R3 is F, Cl, -CH3, or -OCH3. Also included in this embodiment are compounds where L is -O-; R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0127] In one embodiment, The following structure: [ka]

[0013] Provided is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, having the formula:

[0014] Included in this embodiment are compounds where L is -O- or -CH2-. Also included in this embodiment are compounds where L is -O-. Further included in this embodiment are compounds where R1 is -OCH3 or -OCH2CH3; and R3 is F, Cl, -CH3, or -OCH3. Also included in this embodiment are compounds where L is -O-; R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0128] In one embodiment, The following structure: [ka]

[0013] Provided is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, having the formula:

[0014] Included in this embodiment are compounds where L is -O- or -CH2-. Also included in this embodiment are compounds where L is -O-. Further included in this embodiment are compounds where R1 is -OCH3 or -OCH2CH3; and R3 is F, Cl, -CH3, or -OCH3. Also included in this embodiment are compounds where L is -O-; R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0129] In one embodiment, The following structure: [ka]

[0013] Provided is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, having the formula:

[0014] Included in this embodiment are compounds where L is -O- or -CH2-. Also included in this embodiment are compounds where L is -O-. Further included in this embodiment are compounds where R1 is -OCH3 or -OCH2CH3; and R3 is F, Cl, -CH3, or -OCH3. Also included in this embodiment are compounds where L is -O-; R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0130] In one embodiment, The following structure: [ka]

[0013] Provided is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, having the formula:

[0014] Included in this embodiment are compounds where L is -O- or -CH2-. Also included in this embodiment are compounds where L is -O-. Further included in this embodiment are compounds where R1 is -OCH3 or -OCH2CH3; and R3 is F, Cl, -CH3, or -OCH3. Also included in this embodiment are compounds where L is -O-; R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0131] In one embodiment, The following structure: [ka]

[0013] Provided is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, having the formula:

[0014] Included in this embodiment are compounds where L is -O- or -CH2-. Also included in this embodiment are compounds where L is -O-. Further included in this embodiment are compounds where R1 is -OCH3 or -OCH2CH3; and R3 is F, Cl, -CH3, or -OCH3. Also included in this embodiment are compounds where L is -O-; R1 is -OCH3; and R3 is F, Cl, or -CH3.

[0132] An embodiment provides a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein n is 2; and each R3 is independently F, Cl, or -CH3.

[0133] In one embodiment, The following structure: [ka] The present invention provides a compound of formula (I), a tautomer thereof, or a salt thereof, having the formula:

[0134] In one embodiment, The following structure: [ka] The present invention provides a compound of formula (I), a tautomer thereof, or a salt thereof, having the formula:

[0135] In one embodiment, The following structure: [ka] The present invention provides a compound having the formula:

[0136] In one embodiment, The following structure: [ka] or a tautomer thereof, or a salt thereof.

[0137] In one embodiment, The following structure: [ka] or a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0138] In one embodiment, The following structure: [ka] The present invention provides a compound having the formula:

[0139] In one embodiment, The following structure: [ka] The present invention provides a compound having the formula:

[0140] In one embodiment, The following structure: [ka] The present invention provides a compound having the formula:

[0141] In one embodiment, the compound is: [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (1); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (2); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)phenyl]carbamate (3);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (4);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (5);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3-fluorophenyl)methyl]phenyl}carbamate (6); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(1-phenylcyclopropyl)phenyl]carbamate (7); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3-fluorophenyl)(methyl)amino]phenyl}carbamate (8); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3-fluorophenyl)amino]phenyl}carbamate (9);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-bromophenoxy)phenyl]carbamate (10); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-methylphenoxy)phenyl]carbamate (11); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-dimethylphenoxy)phenyl]carbamate (12);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)phenyl]carbamate (13);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chloro-4-fluorophenoxy)phenyl]carbamate (14);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-Fluoro-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (15);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-Fluoro-4-(3-fluorophenoxy)phenyl]carbamate (16);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3,4-difluorophenyl)methyl]phenyl}carbamate (17);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3,4-difluorophenyl)methyl]-2-methylphenyl}carbamate (18);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3,4,5-trifluorophenyl)methyl]phenyl}carbamate (19); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{2-fluoro-4-[(3-fluorophenyl)methyl]phenyl}carbamate (20); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3-chloro-4-fluorophenyl)methyl]phenyl}carbamate (21);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)-2-fluorophenyl]carbamate (22);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (23);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)-2-fluorophenyl]carbamate (24);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-chloro-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (25);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)-2-fluorophenyl]carbamate (26);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-chloro-4-(3-fluorophenoxy)phenyl]carbamate (27);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluorophenoxy)phenyl]carbamate (28); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[difluoro(phenyl)methyl]phenyl}carbamate (29); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-fluorophenyl]carbamate (30);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-methoxyphenoxy)phenyl]carbamate (31);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-methoxyphenoxy)phenyl]carbamate (32);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methoxyphenoxy)-2-methylphenyl]carbamate (33);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-methoxy-4-(2,4,5-trifluorophenoxy)phenyl]carbamate (34);{2-[(3S)-2,6-dioxopiperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (35); {2-[(3R)-2,6-dioxopiperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (36);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)-2-methoxyphenyl]carbamate (37); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-methylphenyl]carbamate (38); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)-2-methylphenyl]carbamate (39);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-methyl-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (40);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-phenylpropan-2-yl)phenyl]carbamate (41);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-methylphenyl]carbamate (42);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(2,4,5-trifluorophenoxy)phenyl]carbamate (43);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4,5-trifluorophenoxy)phenyl]carbamate (44);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-methyl-4-(2,4,5-trifluorophenoxy)phenyl]carbamate (45);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-chloro-4-(3,4-difluorophenoxy)phenyl]carbamate (46);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-methoxyphenyl]carbamate (47);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)-2-methoxyphenyl]carbamate (48);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-methoxyphenyl]carbamate (49);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-2-methoxyphenoxy)-2-methoxyphenyl]carbamate (50);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)-2-methylphenyl]carbamate (51);[2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (52);[2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (53);[2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)phenyl]carbamate (54);[2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (55); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (56); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (57); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)phenyl]carbamate (58); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)phenyl]carbamate; Bamate (59); [4-(Difluoromethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (60); [4-(Difluoromethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (61); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (62); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (63); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (64); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-fluorophenoxy)phenyl]carbamate (65);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl]carbamate (66);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (67);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)phenyl]carbamate (68);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (69); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (70); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-chloro-3-fluorophenoxy)phenyl]carbamate (71);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-methoxy-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (72);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methylphenoxy)-2-methoxyphenyl]carbamate (73);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methylphenoxy)-2-methylphenyl]carbamate (74);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-2-methylphenoxy)-2-methoxyphenyl]carbamate (75);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-2-methylphenoxy)-2-methylphenyl]carbamate (76);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4,5-trifluorophenoxy)phenyl]carbamate (77);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methylphenoxy)phenyl]carbamate (78); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-fluorophenoxy)phenyl]carbamate (79); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl] Carbamate (80); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-2-methylphenoxy)phenyl]carbamate (81); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-3-methylphenoxy)-2-methylphenyl]carbamate (82); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chloro-4-fluorophenoxy)-2-methylphenyl] Carbamate (83); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)phenyl]carbamate (84); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-(difluoromethyl)phenoxy]phenyl}carbamate (85); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-(difluoromethyl)phenoxy]-2-fluorophenyl}carbamate (86);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-cyclopropylphenoxy)phenyl]carbamate (87); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-(difluoromethyl)phenoxy]-2-methoxyphenyl}carbamate (88); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-(difluoromethyl)-4-fluorophenoxy]phenyl}carbamate (89);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{2-chloro-4-[2-(trifluoromethyl)phenoxy]phenyl}carbamate (90);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-chloro-3-fluorophenoxy)-2-fluorophenyl]carbamate (91);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-(; 2H3) Methylphenoxy]phenyl}carbamate (92); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(2-methoxy-4-phenoxyphenyl)carbamate (93); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methylphenoxy)-2-fluorophenyl]carbamate (94); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-Fluoro-4-(4-fluoro-2-methylphenoxy)phenyl]carbamate (95);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-3-methylphenoxy)phenyl]carbamate (96);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-3-methylphenoxy)-2-methoxyphenyl]carbamate (97);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chloro-4-fluorophenoxy)-2-fluorophenyl]carbamate (98); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluoro-3-methylphenoxy)phenyl]carbamate (99); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chloro-4-fluorophenoxy)-2-methoxyphenyl]carbamate (100);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-methylphenoxy)phenyl]carbamate (101); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (102); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)-2-methylphenyl] Carbamate (103); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)-2-methoxyphenyl]carbamate (104); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)-2-fluorophenyl]carbamate (105); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-5-fluorophenoxy)phenyl] Carbamate (106); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)-2-fluorophenyl]carbamate (107); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4,5-difluorophenoxy)-2-methoxyphenyl]carbamate (108); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4,5-difluorophenoxy)-2-fluorophenyl]carbamate (109);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)phenyl]carbamate (110); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-3-fluorophenoxy)phenyl]carbamate (111); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,6-difluorophenoxy)phenyl]carbamate (112);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(naphthalen-1-yloxy)phenyl]carbamate (113);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(1-benzothiophen-5-yloxy)phenyl]carbamate (114);[2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(1-benzothiophen-6-yloxy)phenyl]carbamate (115); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-dichlorophenoxy)-2-fluorophenyl]carbamate (116); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-dichlorophenoxy)-2-fluorophenyl]carbamate; Carbamate (117); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-dichlorophenoxy)-2-fluorophenyl]carbamate (118); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (119); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)phenyl]carbamate (120);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-fluorophenoxy)phenyl]carbamate (121);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl]carbamate (122);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (123);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (124);{2-[(3S)-2,6-dioxopiperidin-3-yl]-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (125);[4-Cyclobutoxy-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (126);[4-Cyclobutoxy-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl]carbamate (127);[4-Cyclobutoxy-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (128);[2-(2,6-dioxopiperidin-3-yl)-4-(oxetan-3-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (129);[2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl] Carbamate (130); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl]carbamate (131); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (132); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)phenyl]carbamate (133);[2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (134);[2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluorophenoxy)phenyl]carbamate (135); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-fluorophenyl]carbamate (136); [4-(cyclohexyloxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (137);[2-(2,6-dioxopiperidin-3-yl)-4-(2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (138);[2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (139);[2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)-2-fluorophenyl]carbamate (140);[2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (141); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (142);[2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (143); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)phenyl]carbamate (144); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (145);[2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (146);[2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-Fluoro-4-(4-fluorophenoxy)phenyl]carbamate (147);[2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-fluorophenyl]carbamate (148);[2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)-2-fluorophenyl]carbamate (149); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (150);[4-(Cyclopentyloxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (151);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3S)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (152);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (153);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (154);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (155);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)phenyl]carbamate (156);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (157); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)phenyl]carbamate (158);[2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (159); [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (160); [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (161);[2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluorophenoxy)phenyl]carbamate (162);[2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-fluorophenyl]carbamate (163);[2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)-2-fluorophenyl]carbamate (164);[2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (165); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-{[(1r,4r)-4-hydroxycyclohexyl]oxy}-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (166);[2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-{[(1s,4s)-4-hydroxycyclohexyl]oxy}-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (167); [2-(2,6-dioxopiperidin-3-yl)-4-(2-methoxyethoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (168); [2-(2,6-dioxopiperidin-3-yl)-4-(2-methoxyethoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (169); [2-(2,6-dioxopiperidin-3-yl)-4-(oxepan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (170); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(pi; [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(pyridin-3-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (171); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(pyridin-3-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (172); {2-[(3S)-2,6-dioxopiperidin-3-yl]-3-oxo-4-(3-phenylpropoxy)-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl] Carbamate (173); 2-({5-[({[4-(3,4-difluorophenoxy)phenyl]carbamoyl}oxy)methyl]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-4-yl}oxy) methyl acetate (174); {4-[(dimethylcarbamoyl)methoxy]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (175); [4-(carbamoylmethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (176); [2-(2,6-dioxopiperidin-3-yl)-4-{[ethyl(methyl)carbamoyl]methoxy}-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (177); [2-(2,6-dioxopiperidin-3-yl)-4-[2-(morpholin-4-yl)-2-oxoethoxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (178);{4-[(1-acetylpiperidin-4-yl)oxy]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (179); or {2-[(3S)-2,6-dioxo(3,4,4,5,5-; 2 H5) Piperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (180) The present invention provides a compound of formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof, wherein

[0142] The compounds of formula (I), their stereoisomers, their tautomers, or their salts are useful for decreasing cyclin E1 protein levels.

[0143] The present invention may be embodied in other specific forms without departing from its spirit or essential characteristics. The present invention includes any and all combinations of the aspects and / or embodiments of the present invention described herein. It is understood that any and all embodiments of the present invention may be combined with any and all other embodiments to describe additional embodiments. It is also understood that individual elements of an embodiment are meant to be combined with any and all other elements from any embodiment to describe additional embodiments.

[0144] The features and advantages of the present invention will be more readily understood by those skilled in the art upon reading the following detailed description. It will be understood that, for clarity, certain features of the invention that are described before or after the context of separate embodiments may be combined to form a single embodiment. Conversely, various features of the invention that are described for brevity in the context of a single embodiment may also be combined to form subcombinations thereof. The embodiments identified herein as exemplary or preferred are intended to be illustrative, not limiting.

[0145] Unless otherwise stated herein, words referred to in the singular may also include the plural. For example, "a" and "an" may refer to either "one" or "one or more."

[0146] As used herein, the phrase "compound and / or salt thereof" refers to at least one compound, a salt of at least one compound, or a combination thereof. For example, a compound of Formula (I) and / or a salt thereof includes one compound of Formula (I); two compounds of Formula (I); a salt of one compound of Formula (I); one compound of Formula (I) and one or more salts of compounds of Formula (I); and a salt of two or more compounds of Formula (I).

[0147] Unless otherwise specified, any atom with unsatisfied valences is assumed to contain enough hydrogen atoms to satisfy the valences.

[0148] The definitions set forth herein supersede any definitions set forth in any patents, patent applications, and / or published patent applications incorporated herein by reference.

[0149] Listed below are definitions of various terms used to describe this invention. These definitions apply to the terms as they are used throughout the specification, either individually or as part of a larger group (unless limited in specific instances).

[0150] Throughout the specification, groups and substituents may be chosen by one skilled in the art to provide stable moieties and compounds.

[0151] According to the practice used in the art, [ka] is used in structural formulas herein to represent the bond that is the point of attachment of a moiety or substituent to the core or backbone structure.

[0152] The term "amino" refers to the group --NH.sub.2.

[0153] The term "oxo" refers to the group =O.

[0154] The compounds of the present invention contain all isotopes of atoms contained in the compounds of the present invention. Isotopes include atoms having the same atomic number but different quantum numbers. By way of general example and without limitation, isotopes of hydrogen include deuterium (D) and tritium (T). Isotopes of carbon include 13 C and 14 C. Isotopically labeled compounds of the invention can generally be prepared by conventional techniques known to those skilled in the art, or by methods analogous to those described herein, substituting the appropriate isotopically labeled reagent for the unlabeled reagent otherwise used.

[0155] As used herein, the term "tautomer" refers to each of two or more isomers of a compound that exist simultaneously in equilibrium and are readily interconverted by the movement of atoms or groups within the molecule. For example, one skilled in the art would recognize that 1,2,3-triazole exists as two tautomers defined below: [ka] It is readily apparent that compounds of formula (I) exist as the following tautomers: Thus, the present invention is intended to encompass all possible tautomers, even if only one of the tautomers is depicted. For example, compounds of formula (I) may exist as the following tautomers: [ka] It can exist as.

[0156] As used herein, the phrase "pharmaceutically acceptable" refers to compounds, substances, compositions, and / or dosage forms that are, within the scope of ordinary medical judgment, suitable for contact with the tissues of human beings and animals without undue toxicity, irritation, allergic response, or other problem or complication, and that offer a reasonable benefit / risk ratio.

[0157] Compounds of formula (I) can form salts, and such salts are also within the scope of the present invention. Unless otherwise specified, reference to a compound of the invention is understood to include reference to one or more salts thereof. The term "salt" refers to acid salts formed with inorganic and / or organic acids. Furthermore, the term "salt" can include zwitterions (internal salts), for example, when a compound of formula (I) contains both a basic moiety (e.g., an amine, pyridine, or imidazole ring) and an acidic moiety (e.g., a carboxylic acid). Pharmaceutically acceptable (i.e., non-toxic and physiologically acceptable) salts are preferred, for example, acceptable metal salts and amine salts in which the cation does not significantly contribute to the toxicity or biological activity of the salt. However, other salts may also be useful, for example, in isolation or purification steps that may be used in manufacturing processes, and therefore, other salts are also considered within the scope of the present invention. Salts of compounds of formula (I) may be formed, for example, by reacting a compound of formula (I) with a certain amount of acid or base (e.g., 1 equivalent) in a solvent (e.g., by precipitating the salt or by subsequent lyophilization of an aqueous solution).

[0158] Examples of acid addition salts include acetates (e.g., acetates prepared from acetic acid or trihaloacetic acids (e.g., trifluoroacetic acid)), adipates, alginates, ascorbates, aspartates, benzoates, benzenesulfonates, hydrogen sulfates, borates, butyrates, citrates, camphorates, camphorsulfonates, cyclopentanepropionates, digluconates, dodecyl sulfates, ethanesulfonates, fumarates, glucoheptanoates, glycerophosphates, hemisulfates, heptanoates, hexanoates, hydrochlorides (prepared from hydrochloric acid), hydrobromides (prepared from hydrogen bromide), and the like. salts such as those described herein, tartrates, thiocyanates, toluenesulfonates (e.g., tosylates), undecanoates, and the like.

[0159] The compound of formula (I) may be provided as an amorphous solid or a crystalline solid. The compound of formula (I) may be provided as a solid by lyophilization.

[0160] Additionally, solvates (e.g., hydrates) of the compound of formula (I) are also considered to be within the scope of the present invention. The term "solvate" refers to a physical association of the compound of formula (I) with one or more solvent molecules, whether organic or inorganic. This physical association includes hydrogen bonding. In some cases, it is possible to isolate the solvate, for example, when one or more solvate molecules are incorporated into the crystal lattice of a crystalline solid. "Solvate" includes both solution-phase and isolable solvates. Examples of solvates include hydrates, ethanolates, methanolates, isopropanolates, acetonitrile solvates, and ethyl acetate solvates. Methods of solvation are known in the art.

[0161] Various forms of prodrugs are well known in the art and are described in Rautio, J. et al., Nature Review Drug Discovery, 17, 559-587(2018).

[0162] Additionally, after the compound of formula (I) has been prepared, it can be isolated and purified to obtain a composition containing 99% or more by weight of the compound of formula (I) ("substantially pure"), which can then be used or formulated as described herein. Such "substantially pure" compounds of formula (I) are also considered herein to be part of the invention.

[0163] By "stable compound" and "stable structure" is intended a compound that is sufficiently robust that it will not decompose upon isolation to a useful degree of purity from a reaction mixture, nor upon formulation into an efficacious therapeutic agent. The present invention is intended to embody stable compounds.

[0164] The term "cyclin E1 degrading agent" refers to an agent that has the effect of reducing cyclin E1 protein levels by degrading, and / or inactivating, and / or inhibiting, and / or reducing the expression level of cyclin E1 protein, or a combination thereof.

[0165] As used herein, "cyclin E1" protein refers to the protein encoded by the CCNE1 gene. Cyclin E1 is also known as CCNE, cyclin E, E1-type cyclin, G1 / S-specific cyclin E1, or pCCNE1. "Cyclin E1" protein includes all human isoforms encoded by the CCNE1 gene, including the isoforms listed below. Isoform 1 (UniPort P24864-1)MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDRVYPNSTCKPRII APSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEE IYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA (SEQ ID NO: 1) Isoform 2 (UniProt P24864-2) MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA (SEQ ID NO: 2) Isoform 3 (UniProt P24864-3) MKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA (SEQ ID NO: 3) Isoform 4 (UniProt C9J2U0) MKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKLLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA (SEQ ID NO: 4) Isoform 5 (UniProt I3L413) DDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKLLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA (SEQ ID NO: 5) Isoform 6 (UniProt I3L1Q9) MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTD (SEQ ID NO: 6) Isoform 7 (UniProt I3L1Q9) MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKILNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTD (SEQ ID NO: 7) Isoform 8 (UniProt A0A0G3DHS8) MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKLLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA (SEQ ID NO: 8) Isoform 9 (UniProt V5W5X2) MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA (SEQ ID NO: 9)

[0166] As used herein, the term "contacting" refers to bringing a specified moiety into contact in vitro or in vivo. For example, "contacting" a cyclin E1 protein with a compound of formula (I) includes administering a compound of the present invention to an individual or patient (e.g., a human) having the cyclin E1 protein, thereby introducing the compound of formula (I) into, for example, a sample containing cells or a purified product containing the cyclin E1 protein.

[0167] As used herein, the terms "treating" and "treatment" refer to any intervention, method, or administration of an active agent performed on a subject for the purpose of ameliorating, alleviating, ameliorating, inhibiting, delaying, or preventing the progression, onset, or severity, or recurrence, complications, or biological manifestations of a disease. In contrast, "prophylaxis" or "prevention" refers to administration to a non-affected subject to prevent the onset of a disease. "Treating" and "treatment" do not include prophylaxis or prevention.

[0168] By "therapeutically effective amount" is meant to include an amount of a compound of the invention alone, or in combination with the claimed compounds, or in combination with other active ingredients, that is effective in reducing cyclin E1 protein levels in a cell or in treating a proliferative disorder (e.g., cancer).

[0169] As used herein, the term "cell" refers to in vitro, ex vivo, or in vivo cells. In some embodiments, ex vivo cells can be part of a tissue sample removed from an organism (e.g., a mammal). In some embodiments, in vitro cells can be cells in cell culture. In some embodiments, in vivo cells can be living cells in an organism (e.g., a mammal).

[0170] The term "patient" includes human subjects.

[0171] As used herein, the phrase "pharmaceutically acceptable carrier" refers to a pharmaceutically acceptable substance, composition, or vehicle, including, for example, a liquid or solid filler, diluent, excipient, processing aid (e.g., lubricant, magnesium talc, calcium or zinc stearate, or stearic acid), or solvent encapsulant, which is involved in the transport or delivery of a particular compound from one organ or part of the body to another. Each carrier must be "acceptable" in the sense of being compatible with the other ingredients in the formulation (i.e., adjuvants, excipients, or vehicles (e.g., diluents, preservatives, fillers, flow conditioners, disintegrants, wetting agents, emulsifiers, suspending agents, sweeteners, flavoring agents, perfumes, antibacterial agents, antifungal agents, lubricants, and dispensing agents), depending on the method of administration and the nature of the dosage form); and not deleterious to the patient.

[0172] The term "pharmaceutical composition" means a composition comprising a compound of the present invention in combination with at least one additional pharmaceutically acceptable carrier.

[0173] usefulness The compounds of formula (I) are useful in the treatment of cancer.

[0174] In certain embodiments, a method for treating cancer is provided, comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0175] In one embodiment, a method for treating a disease or disorder by reducing cyclin E1 protein levels is provided, i.e., a therapeutically effective amount of a drug is administered to a patient to reduce cyclin E1 protein levels. Suitable drugs include small molecules and heterobifunctional molecules (e.g., proteolysis-targeting chimeric molecules (PROTACs)). In one embodiment, the disease or disorder is cancer. In another embodiment, the drug is a small molecule compound with a molecular weight of 1000 or less. In yet another embodiment, the drug is a compound of formula (I), a stereoisomer thereof, a stereoisomer thereof, or a pharmaceutically acceptable salt thereof. In a further embodiment, the drug is a proteolysis-targeting chimeric molecule. An example of a small molecule is molecular glue (Sasso et al., Biochemistry 2023, 62, 601-623).

[0176] In one embodiment, a method for treating a disease or disorder is provided, comprising administering to a patient a therapeutically effective amount of an agent to reduce the level of cyclin E1 protein, the protein having an amino acid sequence encoded by SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, or 9. In one embodiment, the disease or disorder is cancer. In another embodiment, the agent is a small molecule compound having a molecular weight of 1000 or less. In yet another embodiment, the agent is a compound of formula (I), a stereoisomer thereof, a stereoisomer thereof, or a pharmaceutically acceptable salt thereof. In a further embodiment, the agent is a proteolysis-inducing chimeric molecule.

[0177] In embodiment 1, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 30%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0178] In embodiment 2, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 40%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0179] In embodiment 3, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 50%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0180] In embodiment 4, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 60%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0181] In embodiment 5, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 70%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0182] In embodiment 6, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 80%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0183] In embodiment 7, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 90%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0184] In embodiment 8, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 95%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0185] In embodiment 9, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 98%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0186] In embodiment 10, there is provided a method for treating a disease or disorder, comprising administering to a patient a therapeutically effective amount of an agent to reduce cyclin E1 protein levels, such that cyclin E1 protein levels are reduced by at least 99%. This embodiment includes methods where the disease or disorder is cancer. This embodiment also includes methods where the agent is a compound of Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0187] In embodiments 1 to 10, the reduction in cyclin E1 protein levels may be measured by the cyclin E1 cytolytic assay described herein below.

[0188] The types of cancer that may be treated with the compounds of formula (I) include, but are not limited to, brain cancer, skin cancer, bladder cancer, ovarian cancer, breast cancer, stomach cancer, pancreatic cancer, prostate cancer, colon cancer, blood cancer, lung cancer, and bone cancer. Examples of such cancer types include neuroblastoma, intestinal cancer (e.g., rectal cancer, colon cancer, anal cancer, familial adenomatous polyposis, and hereditary nonpolyposis colorectal cancer), esophageal cancer, nasopharyngeal cancer, lip cancer, laryngeal cancer, hypopharyngeal cancer, tongue cancer, salivary gland cancer, thymic cancer, esophagogastric cancer, gastric cancer, adenocarcinoma, medullary thyroid cancer, papillary thyroid cancer, kidney cancer, renal parenchymal cancer, ovarian cancer, cervical cancer, uterine cancer, endometrial cancer, choriocarcinoma, pancreatic cancer, prostate cancer, testicular cancer, breast cancer, urinary tract cancer, malignant melanoma, brain tumors (e.g., glioblastoma, astrocytoma, meningioma, medulloblastoma, and peripheral neuroectodermal tumors), Hodgkin's lymphoma, non-small cell lung cancer, and ovarian cancer. Hodgkin's lymphoma, Burkitt's lymphoma, acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), adult T-cell leukemia / lymphoma, diffuse large B-cell lymphoma (DLBCL), hepatocellular carcinoma, gallbladder carcinoma, bronchial carcinoma, small cell lung cancer, non-small cell lung cancer, mesothelioma, multiple myeloma, basal cell carcinoma, teratoma, retinoblastoma, choroidal melanoma, seminoma, rhabdomyosarcoma, craniopharyngioma, osteosarcoma, chondrosarcoma, myosarcoma, liposarcoma, fibrosarcoma, Ewing's sarcoma, and plasmacytoma.

[0189] In certain embodiments, a method is provided for treating a cancer having amplified, overexpressed, or detectable expression of the CCNE1 gene, comprising administering to a patient a therapeutically effective amount of a compound described in Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0190] In certain embodiments, there is provided a method for treating malignant melanoma, comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0191] In certain embodiments, provided is a method for treating lung cancer (e.g., small cell lung cancer (SCLC) and non-small cell lung cancer (NSCLC)), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0192] In certain embodiments, provided is a method for treating mesothelioma, comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0193] In certain embodiments, provided is a method for treating breast cancer (e.g., ductal carcinoma, invasive ductal carcinoma metastatic breast cancer, triple-negative breast cancer, human epidermal growth factor receptor 2 (HER2)-positive breast cancer, estrogen receptor (ER)-positive breast cancer, hormone receptor-positive breast cancer, and hormone receptor-negative breast cancer), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0194] In certain embodiments, provided is a method for treating prostate cancer (e.g., prostate cancer and castration-resistant prostate cancer), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0195] In certain embodiments, provided are methods for treating pancreatic cancer (e.g., pancreatic adenocarcinoma, exocrine pancreatic cancer, and neuroendocrine pancreatic cancer), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0196] In certain embodiments, provided are methods for treating kidney cancer (e.g., renal cell carcinoma, clear cell renal cell carcinoma, non-clear cell renal cell carcinoma, papillary renal cell carcinoma, Wilms' tumor, and renal sarcoma), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0197] In certain embodiments, provided herein are methods for treating gastric cancer (e.g., stomach cancer), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0198] In certain embodiments, there is provided a method for treating kidney cancer (e.g., renal carcinoma and renal parenchymal carcinoma), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0199] In certain embodiments, there is provided a method for treating liver cancer (e.g., hepatocellular renal carcinoma), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0200] In certain embodiments, provided herein are methods for treating ovarian cancer (e.g., ovarian cancer), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0201] In certain embodiments, provided is a method for treating lymphoma (e.g., Hodgkin's lymphoma, non-Hodgkin's lymphoma, Burkitt's lymphoma, acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), adult T-cell leukemia, and diffuse large B-cell lymphoma (DLBCL)), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0202] In certain embodiments, provided is a method for treating leukemia (e.g., acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), adult T-cell leukemia-lymphoma, and diffuse large B-cell lymphoma (DLBCL)), comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0203] In certain embodiments, there is provided a method for treating multiple myeloma, comprising administering to a patient a therapeutically effective amount of a compound according to Formula (I), a stereoisomer thereof, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

[0204] The compounds of Formula (I) and pharmaceutical compositions comprising at least one compound of Formula (I) are useful for treating or preventing any disease or condition associated with the activity of cyclin E1 protein. Any administration method can be used to administer the compounds or pharmaceutical compositions to a patient. In some embodiments, the compounds of Formula (I) and pharmaceutical compositions comprising at least one compound of Formula (I) are administered orally. In other embodiments, the compounds of Formula (I) and pharmaceutical compositions comprising at least one compound of Formula (I) are administered parenterally.

[0205] In one embodiment, the present invention provides a combination preparation of a compound of Formula (I) and / or a pharmaceutically acceptable salt thereof with another agent for simultaneous, separate, or sequential use in the treatment and / or prevention of diseases or disorders associated with the activity of cyclin E1 protein. The combination preparation can be used to reduce protein levels, reduce protein activity levels, and / or suppress the expression level of cyclin E1 protein.

[0206] In some embodiments, the compound of Formula (I) is administered sequentially before the administration of the immuno-oncology agent. In other embodiments, the compound of Formula (I) is administered simultaneously with the immuno-oncology agent. In yet other embodiments, the compound of Formula (I) is administered sequentially after the administration of the immuno-oncology agent.

[0207] In another embodiment, the compound of formula (I) may be formulated with an immuno-oncology agent.

[0208] Immuno-oncology agents include, for example, small molecule drugs, antibodies, or other biological or small molecule drugs. Examples of biological immuno-oncology agents include, but are not limited to, cancer vaccines, antibodies, and cytokines. In one embodiment, the antibody is a monoclonal antibody. In another embodiment, the monoclonal antibody is a humanized or human antibody.

[0209] In some embodiments, the immuno-oncology agent is either (i) an agonist of stimulatory (including costimulatory) receptors or (ii) an antagonist of inhibitory (including costimulatory) signals on T cells, both of which result in amplification of antigen-specific T cell responses (often referred to as immune checkpoint regulators).

[0210] Some stimulatory and inhibitory molecules belong to the immunoglobulin superfamily (IgSF). One important family of membrane-bound ligands that bind to costimulatory or costimulatory receptors is the B7 family, which includes B7-1, B7-2, B7-H1 (PD-L1), B7-DC (PD-L2), B7-H2 (ICOS-L), B7-H3, B7-H4, B7-H5 (VISTA), and B7-H6. Another family of membrane-bound ligands that bind to costimulatory or co-inhibitory receptors are the TNF family molecules that bind to the cognate TNF receptor family, including CD40 and CD40L, OX-40, OX-40L, CD70, CD27L, CD30, CD30L, 4-1BBL, CD137 (4-1BB), TRAIL / Apo2-L, TRAILR1 / DR4, TRAILR2 / DR5, TRAILR3, TRAILR4, OPG, and R ANK, RANKL, TWEAKR / Fn14, TWEAK, BAFFR, EDAR, XEDAR, TACI, APRIL, BCMA, LTβR, LIGHT, DcR3, HVEM, VEGI / TL1A, TRAMP / DR3, Includes EDAR, EDA1, XEDAR, EDA2, TNFR1, lymphotoxin α / TNFβ, TNFR2, TNFα, LTβR, lymphotoxin α1β2, FAS, FASL, RELT, DR6, TROY, and NGFR.

[0211] In certain embodiments, T cell responses can be stimulated by a combination of a compound of Formula (I) and one or more of the following: (i) antagonists of proteins that inhibit T cell activation (e.g., immune checkpoint inhibitors), such as CTLA-4, PD-1, PD-L1, PD-L2, LAG-3, TIM-3, Galectin 9, CEACAM-1, BTLA, CD69, Galectin-1, TIGIT, CD113, GPR56, VISTA, 2B4, CD48, GARP, PD1H, LAIR1, TIM-1, and TIM-4, and (ii) agonists of proteins that stimulate T cell activation, such as B7-1, B7-2, CD28, 4-1BB (CD137), 4-1BBL, ICOS, ICOS-L, OX40, OX40L, GITR, GITRL, CD70, CD27, CD40, DR3, and CD28H.

[0212] For cancer treatment, other drugs that can be combined with the compound of formula (I) include antagonists of inhibitory receptors on NK cells or agonists of stimulatory receptors on NK cells.For example, the compound of formula (I) can be combined with antagonists of KIR (for example, lirilumab).

[0213] Further agents for use in combination therapy include agents that inhibit or deplete macrophages or monocytes, including, but not limited to, CSF-1R antagonists, including CSF-1R antagonist antibodies (e.g., RG7155 (WO11 / 70024, WO11 / 107553, WO11 / 131407, WO13 / 87699, WO13 / 119716, WO13 / 132044) or FPA-008 (WO11 / 140249; WO13169264; WO14 / 036357)).

[0214] In another embodiment, compounds of Formula (I) may be used in conjunction with one or more agonistic agents that bind positive costimulatory receptors, blocking agents that attenuate signaling through inhibitory receptors, i.e., antagonists, and one or more agents that systemically increase the frequency of anti-tumor T cells, agents that overcome distinct immunosuppressive pathways within the tumor microenvironment (e.g., blocking inhibitory receptor engagement (e.g., PD-L1 / PD-1 interactions), depleting or inhibiting Treg cells (e.g., using anti-CD25 monoclonal antibodies (e.g., daclizumab) or by ex vivo anti-CD25 bead depletion), inhibiting metabolic enzymes such as IDO, or reversing / preventing T cell anergy or T cell exhaustion), and agents that cause innate immune activation and / or inflammation at the tumor site.

[0215] In some embodiments, the immuno-oncology agent is a CTLA-4 antagonist (e.g., an antagonistic CTLA-4 antibody). Suitable CTLA-4 antibodies include, for example, Yervoy (ipilimumab) or tremelimumab.

[0216] In some embodiments, the immuno-oncology agent is a PD-1 antagonist (e.g., an antagonistic PD-1 antibody). Suitable PD-1 antibodies include, for example, Opdivo (nivolumab), Keytruda (pembrolizumab), MEDI-0680 (AMP-514; WO2012 / 145493), Libtayo (cemiplimab), Gemperli (dostallimab), and ZYNYZ (retifanlimab). The immuno-oncology agent may also include pidilizumab (CT-011), although its specificity for PD-1 binding has been questioned. Another approach targeting the PD-1 receptor is a recombinant protein consisting of the extracellular domain of PD-L2 (B7-DC) fused to the Fc portion of IgG1, designated AMP-224.

[0217] In another embodiment, the immuno-oncology agent is a PD-L1 antagonist (e.g., an antagonistic PD-L1 antibody). Suitable PD-L1 antibodies include, for example, MPDL3280A (RG7446; WO2010 / 077634), durvalumab (MEDI4736), BMS-936559 (WO207 / 005874), and MSB0010718C (WO2013 / 79174), Tecentriq (atezolizumab), and Bavencio (avelumab).

[0218] In another embodiment, the immuno-oncology agent is a LAG-3 antagonist (e.g., an antagonistic LAG-3 antibody). Suitable LAG-3 antibodies include, for example, BMS-986016 (WO10 / 19570, WO14 / 08218), or IMP-731 or IMP-321 (WO08 / 132601, WO09 / 44273).

[0219] In another embodiment, the immuno-oncology agent is a CD137 (4-1BB) agonist (e.g., an agonistic CD137 antibody). Suitable CD137 antibodies include, for example, urelumab and PF-05082566 (WO12 / 32433).

[0220] In another embodiment, the immuno-oncology agent is a GITR agonist (e.g., an agonistic GITR antibody). Suitable GITR antibodies include, for example, BMS-986153, BMS-986156, TRX-518 (WO06 / 105021, WO09 / 009116), and MK-4166 (WO11 / 028683).

[0221] In another embodiment, the immuno-oncology agent is an IDO antagonist.Suitable IDO antagonists include, for example, INCB-024360 (WO206 / 122150, WO07 / 75598, WO08 / 36653, WO08 / 36642), indoximod or NLG-919 (WO09 / 73620, WO09 / 1156652, WO11 / 56652, WO12 / 142237).

[0222] In another embodiment, the immuno-oncology agent is an OX40 agonist (e.g., an agonistic OX40 antibody). Suitable OX40 antibodies include, for example, MEDI-6383 or MEDI-6469.

[0223] In another embodiment, the immuno-oncology agent is an OX40L antagonist (e.g., an antagonistic OX40 antibody). Suitable OX40L antagonists include, for example, RG-7888 (WO06 / 029879).

[0224] In another embodiment, the immuno-oncology agent is a CD40 agonist (e.g., an agonistic CD40 antibody). In yet another embodiment, the immuno-oncology agent is a CD40 antagonist (e.g., an antagonistic CD40 antibody). Suitable CD40 antibodies include, for example, lucatumumab or dacetuzumab.

[0225] In another embodiment, the immuno-oncology agent is a CD27 agonist (e.g., an antagonistic CD27 antibody). Suitable CD27 antibodies include, for example, varlilumab.

[0226] In another embodiment, the immuno-oncology agent is MGA271 (directed against B7H3) (WO11 / 109400).

[0227] In another embodiment, the immuno-oncology agent is an anti-TIGIT agent. Suitable anti-TIGIT agents include antibodies such as BMS-986207, tiragolumab, or MK-7684.

[0228] In another embodiment, the immuno-oncology agent is a KRAS G12C inhibitor. Suitable KRAS G12C inhibitors include, for example, Lumakelas (sotorasib) or KRAZATI (adagrasib).

[0229] Combination therapy is intended to include administration of these therapeutic agents in a sequential manner, i.e., each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents or at least two therapeutic agents in a substantially simultaneous manner. A substantially simultaneous manner can be achieved, for example, by administering to the patient a single, fixed-ratio dosage form of each therapeutic agent or multiple, single dosage forms of each therapeutic agent. The sequential or substantially simultaneous administration of each therapeutic agent can be carried out by any suitable route, including, but not limited to, oral, intravenous, intramuscular, and direct absorption through mucosal membranes. The therapeutic agents can be administered by the same or different routes. For example, a first therapeutic agent in a selected combination can be administered by intravenous injection, while another therapeutic agent in the combination can be administered orally. Alternatively, for example, all therapeutic agents can be administered orally, or all therapeutic agents can be administered intravenously. The administration of the above therapeutic agents can also be combined with additional biologically active ingredients and non-drug treatments (e.g., surgery or radiation therapy) to achieve combination therapy. When the combination therapy further includes a non-drug therapy, the non-drug therapy may be administered at any suitable time, so long as the beneficial effect resulting from the synergistic action of the combined therapeutic and non-drug therapy is achieved, e.g., in suitable cases, this beneficial effect is achieved even when the non-drug treatment is temporarily suspended, perhaps for days or weeks, from the administration of the therapeutic agent.

[0230] In treating diseases, disorders, or conditions associated with the cyclin E1 protein, one or more additional therapeutic agents or methods of treatment, such as, for example, chemotherapeutic agents or other anti-cancer agents, immunostimulators, immunosuppressants, radiation, anti-tumor vaccines, cytokine therapy (e.g., IL-2 and GM-CSF), and / or tyrosine kinase inhibitors, are optionally used in combination with the compounds of formula (I). The agents may be combined with the compound in a single dosage form, or the agents may be administered simultaneously or sequentially in different dosage forms.

[0231] Suitable chemotherapeutic or other anti-cancer agents include, for example, alkylating agents (including, but not limited to, nitrogen mustards, ethyleneimine derivatives, alkylsulfonic acids, nitrosoureas, and triazenes), including, for example, uracil mustard, chlormethine, cyclophosphamide (Cytoxan®), ifosfamide, melphalan, chlorambucil, pipobroman, triethylene-melamine, triethylenethiophosphoramine, busulfan, carmustine, lomustine, streptozocin, dacarbazine, and temozolomide.

[0232] Suitable chemotherapeutic or other anti-cancer agents include, for example, antimetabolites (e.g., but not limited to, folate antagonists, pyrimidine analogs, purine analogs, and adenosine deaminase inhibitors), including, for example, methotrexate, 5-fluorouracil, floxuridine, cytarabine, 6-mercaptopurine, 6-thioguanine, fludarabine phosphate, pentostatin, and gemcitabine.

[0233] Suitable chemotherapeutic or other anti-cancer agents further include, for example, certain natural products and their derivatives (e.g., vinca alkaloids, antitumor antibiotics, enzymes, lymphokines, and epipodophyllotoxins), including, for example, vinblastine, vincristine, vindesine, vinorelbine (Navelbine®), bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, cytarabine, paclitaxel (Taxol), mithramycin, deoxycoformycin, mitomycin C, L-asparaginase, interferons (especially IFNα), etoposide, and teniposide.

[0234] Suitable chemotherapeutic or other anti-cancer agents also include cytotoxic agents (e.g., epipodophyllotoxins); anti-tumor enzyme inhibitors; topoisomerase inhibitors (e.g., irinotecan (Campto®, CPT-11)); procarbazine; mitoxantrone; platinum coordination complexes (e.g., cisplatin and carboplatin); biological response modifiers; growth inhibitors; tegafur; capecitabine; and hematopoietic growth factors.

[0235] Other anti-cancer drugs include antihormonal or endocrine drugs.

[0236] Suitable endocrine therapeutic agents include, but are not limited to, aromatase inhibitors (e.g., letrozole, anastrozole, and exemeskin); selective estrogen receptor modulators (SERMs) (e.g., tamoxifen, raloxifene, and droloxifene); and selective estrogen receptor degraders (SERDs) (e.g., fulvestrant).

[0237] Other anti-cancer agents also include those that block immune cell migration, such as antagonists to chemokine receptors (eg, CCR2 and CCR4).

[0238] Other anti-cancer agents also include anti-cancer agents that enhance the immune system, for example, adjuvants or adoptive T cell transfer.

[0239] Anti-cancer vaccines include dendritic cell vaccines, synthetic peptide vaccines, DNA vaccines, and recombinant viral vaccines.

[0240] The pharmaceutical compositions of the present invention may optionally comprise at least one signal transduction modulator (STM). A "signal transduction modulator" is an agent that selectively modulates one or more critical steps in a signal transduction pathway in the normal function of cancer cells, thereby causing growth arrest and / or apoptosis. Suitable STMs include, but are not limited to: (i) bcr / abl kinase inhibitors (e.g., STI 571 (GLEEVEC®)); (ii) epidermal growth factor (EGF) receptor inhibitors (e.g., kinase inhibitors (IRESSA®, SSI-774) and antibodies (Imclone: ​​C225 [Goldstein et al., Clin. Cancer Res., 1:1311-1318 (1995)], and Abgenix: ABX-EGF)); (iii) her-2 / neu receptor inhibitors (e.g., trastuzumab (Herceptin®)) and farnesyltransferase inhibitors (FTIs) (e.g., L-744,832 (Kohl et al., Nat. Med., 1(8):792-797 (1995))); (iv) Akt family kinase or Akt pathway inhibitors (e.g., rapamycin (e.g., Sekulic et al., Cancer Res., 1:1311-1318 (1995))). Res., 60:3504-3513 (200)); (v) cell cycle kinase inhibitors (e.g., palbociclib (Ibrance®), riboxilib (Kisqali®), and abemaciclib (Verzenio®) (see, e.g., Jhaveri et al., Expert Rev. Anticancer Ther., 21(10):1105-1124(2021))); and (vi) phosphatidylinositol kinase inhibitors (e.g., LY294002 (see, e.g., Vlahos et al., J. Biol. Chem., 269:5241-5248 (1994))). Alternatively, at least one STM and at least one compound of formula (I) can be formulated in separate pharmaceutical compositions. In certain embodiments of the present invention, at least one compound of formula (I) and at least one STM can be administered to a patient simultaneously or sequentially.In other words, at least one compound of Formula (I) may be administered first, at least one STM may be administered first, or at least one compound of Formula (I) and at least one STM may be administered simultaneously. Furthermore, when more than one compound of Formula (I) and / or STM is used, the compounds may be administered in any order.

[0241] In certain embodiments of the present invention, at least one compound of formula (I) and at least one chemotherapeutic agent can be administered to patients simultaneously or sequentially.In other words, at least one compound of formula (I) can be administered first, or at least one chemotherapeutic agent can be administered first, or at least one compound of formula (I) and at least one STM can be administered simultaneously.In addition, when two or more compounds of formula (I) and / or chemotherapeutic agents are used, the compounds can be administered in any order.Similarly, any STM can be administered at any time compared to the administration of the compound of formula (I).

[0242] Combination therapy is intended to include administration of these therapeutic agents in a sequential manner, i.e., each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents or at least two therapeutic agents in a substantially simultaneous manner. A substantially simultaneous manner can be achieved, for example, by administering to the patient a single, fixed-ratio dosage form of each therapeutic agent or multiple, single dosage forms of each therapeutic agent. The sequential or substantially simultaneous administration of each therapeutic agent can be carried out by any suitable route, including, but not limited to, oral, intravenous, intramuscular, and direct absorption through mucosal membranes. The therapeutic agents can be administered by the same or different routes. For example, a first therapeutic agent in a selected combination can be administered by intravenous injection, while another therapeutic agent in the combination can be administered orally. Alternatively, for example, all therapeutic agents can be administered orally, or all therapeutic agents can be administered intravenously. The administration of the above therapeutic agents can also be combined with additional biologically active ingredients and non-drug treatments (e.g., surgery or radiation therapy) to achieve combination therapy. When the combination therapy further includes a non-drug therapy, the non-drug therapy may be administered at any suitable time, so long as the beneficial effect resulting from the synergistic action of the combined therapeutic and non-drug therapy is achieved, e.g., in suitable cases, this beneficial effect is achieved even when the non-drug treatment is temporarily suspended, perhaps for days or weeks, from the administration of the therapeutic agent.

[0243] Pharmaceutical Composition The present invention also provides pharmaceutical compositions comprising a therapeutically effective amount of one or more compounds of formula (I), formulated together with one or more pharmaceutically acceptable carriers (excipients), and / or diluents, and optionally one or more additional therapeutic agents as described above.

[0244] The compounds of formula (I) may be administered by any suitable route, desirably in the form of a pharmaceutical composition adapted for such a route, and in a dosage effective for the intended treatment. For any of the uses described herein, the compounds of formula (I) and compositions of compounds of formula (I) may be administered by any suitable method (e.g., oral administration (e.g., tablets, capsules (each including sustained-release or time-release formulations), pills, powders, granules, elixirs, tinctures, suspensions (including nanosuspensions, microsuspensions, spray-dried dispersions), syrups, and emulsions); sublingual administration; buccal administration; parenteral administration (e.g., subcutaneous, intravenous, intramuscular, or intrasternal injection, or infusion techniques (e.g., sterile injectable aqueous or non-aqueous solutions or suspensions)); nasal administration, including administration to the nasal membranes (e.g., inhalation spray); topical administration (e.g., in the form of a cream formulation or ointment); or rectal administration (e.g., in the form of a suppository). They may be administered alone, but will generally be administered with a pharmaceutical carrier selected on the basis of the chosen route of administration and standard pharmaceutical practice.

[0245] For oral administration, pharmaceutical compositions may be in the form of, for example, tablets, capsules, liquid capsules, suspensions, or liquids. Pharmaceutical compositions are preferably formulated in dosage unit forms containing a specific amount of active ingredient. For example, pharmaceutical compositions may be provided as tablets or capsules containing an amount of active ingredient ranging from about 0.1 to 1000 mg, preferably 0.25 to 250 mg, and more preferably about 0.5 to 100 mg. The appropriate daily dose for administration to humans or other mammals may vary widely depending on the patient's condition and other factors, but can be determined using routine methods.

[0246] Any pharmaceutical composition discussed herein can be orally administered, for example, via any acceptable and suitable oral formulation.Examples of oral formulations include, but are not limited to, tablets, troches, lozenges, aqueous and oily suspensions, dispersible powders or granules, emulsions, hard and soft capsules, liquid capsules, syrups, and elixirs.Pharmaceutical compositions for oral administration can be prepared according to any method known in the art for preparing pharmaceutical compositions for oral administration.In order to provide a pharmaceutical preparation that is easy to swallow, the pharmaceutical compositions described in the present invention can include at least one substance selected from sweeteners, flavoring agents, coloring agents, demulcents, antioxidants, and preservatives.

[0247] Tablets can be prepared, for example, by mixing at least one compound of formula (I) and / or at least one pharmaceutically acceptable salt thereof with at least one non-toxic, pharmaceutically acceptable additive suitable for tablet manufacture. Examples of additives include, but are not limited to, inert diluents (e.g., calcium carbonate, sodium carbonate, lactose, calcium phosphate, and sodium phosphate); granulating and disintegrating agents (e.g., microcrystalline cellulose, croscarmellose sodium, corn starch, and alginic acid); binders (e.g., starch, gelatin, polyvinylpyrrolidone, and gum arabic), and lubricants (e.g., magnesium stearate, stearic acid, and talc). Furthermore, tablets can be uncoated or coated by known techniques to mask the unpleasant taste of unpleasant drugs or delay the disintegration and absorption of active ingredients in the gastrointestinal tract, thereby prolonging the effect of the active ingredients. Examples of water-soluble taste-masking materials include, but are not limited to, hydroxypropylmethylcellulose and hydroxypropylcellulose. Examples of time delay materials include, but are not limited to, ethyl cellulose and cellulose acetate butyrate.

[0248] Hard gelatin capsules can be prepared, for example, by mixing at least one compound of formula (I) and / or at least one salt thereof with at least one inert solid diluent (e.g., calcium carbonate; calcium phosphate; and kaolin).

[0249] Soft gelatin capsules can be prepared, for example, by mixing at least one compound of formula (I) and / or at least one salt thereof with at least one water-soluble carrier (e.g., polyethylene glycol); and at least one oil medium (e.g., peanut oil, liquid paraffin, and olive oil).

[0250] Aqueous suspensions can be prepared, for example, by mixing at least one compound of formula (I) and / or at least one salt thereof with at least one additive suitable for preparing aqueous suspensions. Examples of additives suitable for preparing aqueous suspensions include, but are not limited to, suspending agents (e.g., sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose, sodium alginate, alginic acid, polyvinylpyrrolidone, tragacanth gum, and gum arabic), dispersing or wetting agents (e.g., naturally occurring phosphatides (e.g., lecithin)), condensation products of alkylene oxides and fatty acids (e.g., polyoxyethylene stearate), condensation products of ethylene oxide and long-chain aliphatic alcohols (e.g., heptadecaethyleneoxycetanol), condensation products of ethylene oxide and partial esters derived from fatty acids and hexitols (e.g., polyoxyethylene sorbitol monooleate), and condensation products of ethylene oxide and partial esters derived from fatty acids and hexitol anhydrides (e.g., polyethylene sorbitan monooleate). The aqueous suspension may also contain at least one preservative (e.g., ethyl p-hydroxybenzoate and n-propyl p-hydroxybenzoate); at least one coloring agent; at least one flavoring agent; and / or at least one sweetening agent (for example, but not limited to, sucrose, saccharin, and aspartame).

[0251] Oily suspensions can be prepared, for example, by suspending at least one compound of formula (I) and / or at least one pharmaceutically acceptable salt thereof in either vegetable oil (e.g., peanut oil; olive oil; sesame oil; and coconut oil) or mineral oil (e.g., liquid paraffin). Oily suspensions can also contain at least one thickening agent (e.g., beeswax; hard paraffin; and cetyl alcohol). To provide an oily suspension that is easy to drink, at least one sweetener and / or at least one flavoring agent as described above can be added to the oily suspension. Oily suspensions can further contain at least one preservative, including but not limited to, for example, an antioxidant (e.g., butylhydroxyanisole and α-tocopherol).

[0252] Dispersible powders and granules can be prepared, for example, by mixing at least one compound of formula (I) and / or at least one pharmaceutically acceptable salt thereof with at least one dispersant and / or wetting agent; at least one suspending agent; and / or at least one preservative. Suitable dispersants, wetting agents, and suspending agents have already been described above. Examples of preservatives include, but are not limited to, antioxidants (e.g., ascorbic acid). In addition, dispersible powders and granules can also contain at least one additive (e.g., but not limited to, sweeteners; flavoring agents; and coloring agents).

[0253] Emulsions of at least one compound of formula (I) and / or at least one pharmaceutically acceptable salt thereof can be prepared, for example, as oil-in-water emulsions. The oil phase of emulsions containing a compound of formula (I) can be composed of known ingredients in a known manner. The oil phase can be provided by, but is not limited to, vegetable oils (e.g., olive oil and peanut oil); mineral oils (e.g., liquid paraffin); and mixtures thereof. The oil phase can include only an emulsifier, or a mixture of at least one emulsifier and a fat or oil, or both a fat and an oil. Suitable emulsifiers include, but are not limited to, naturally occurring phosphatides (e.g., soybean lecithin); esters or partial esters derived from fatty acids and hexitol anhydrides (e.g., sorbitan monooleate); and condensation products of partial esters with ethylene oxide (e.g., polyoxyethylene sorbitan monooleate). Preferably, a hydrophilic emulsifier is included together with a lipophilic emulsifier, which acts as a stabilizer. It is also preferred to include both an oil and a fat. Together, the emulsifiers, with or without stabilizers, make up the so-called emulsifying wax, which, together with the oils and fats, forms the oily dispersed phase of the cream formulation, the so-called emulsifying ointment base. The emulsion may also include sweeteners, flavorings, preservatives, and / or antioxidants. Suitable emulsifiers and emulsion stabilizers for use in the formulations of the present invention include Tween 60, Span 80, cetostearyl alcohol, myristyl alcohol, glyceryl monostearate, sodium lauryl sulfate, glyceryl distearate, or other materials known in the art, either alone or in combination with waxes.

[0254] In addition, the compound of formula (I) and / or at least one pharmaceutically acceptable salt thereof can be delivered, for example, intravenously, subcutaneously, and / or intramuscularly via any pharmaceutically acceptable and suitable injection form. Examples of injection forms include, but are not limited to, sterile aqueous solutions containing acceptable vehicles and solvents (e.g., water, Ringer's solution, and isotonic sodium chloride solution); sterile oil-in-water microemulsions; and aqueous or oily suspensions.

[0255] Formulations for parenteral administration may be in the form of aqueous or non-aqueous isotonic sterile injection solutions or suspensions. These solutions and suspensions may be prepared from sterile powders or granules using one or more of the carriers or diluents described for use in formulations for oral administration, or other suitable dispersing or wetting agents and suspending agents. The compound may be dissolved in water, polyethylene glycol, propylene glycol, ethanol, corn oil, cottonseed oil, peanut oil, sesame oil, benzyl alcohol, sodium chloride solution, tragacanth gum, and / or various buffers. Other adjuvants and administration methods are well known and understood in the pharmaceutical arts. The active ingredient may also be administered by injection in a composition with a suitable carrier (e.g., saline, dextrose, or water), or a cyclodextrin (e.g., Captisol), a solubilizing cosolvent (e.g., propylene glycol), or a solubilizing micelle (e.g., Tween 80).

[0256] Alternatively, a sterile injectable preparation may be a sterile injectable solution or suspension in a non-toxic, parenterally acceptable diluent or solvent (for example, a solution in 1,3-butanediol). Acceptable vehicles and solvents that may be used include water, Ringer's solution, and isotonic sodium chloride solution. Additionally, sterile, fixed oils are conventionally used as solvents or suspending media. For this purpose, any sterile, fixed oil may be used, including synthetic monoglycerides or diglycerides. Additionally, fatty acids such as oleic acid are used in injectable preparations.

[0257] Sterile injectable oil-in-water microemulsions are formed, for example, by: 1) dissolving at least one compound of formula (I) in an oil phase (e.g., a mixture of soybean oil and lecithin); 2) combining the oil phase containing formula (I) with a mixture of water and glycerol; and 3) treating the combination to form a microemulsion.

[0258] Sterile aqueous suspensions or sterile oily suspensions can be prepared according to methods known to those skilled in the art. For example, sterile aqueous solutions or suspensions can be prepared using non-toxic, parenterally acceptable diluents or solvents (e.g., 1,3-butanediol); and sterile oily suspensions can be prepared using sterile, non-toxic, acceptable solvents or suspension media (e.g., sterile fixed oils (e.g., synthetic monoglycerides or diglycerides)); and fatty acids (e.g., oleic acid).

[0259] Pharmaceutically acceptable carriers are formulated according to many factors well within the expertise of those skilled in the art. These factors include, but are not limited to, the type and nature of the active agent being formulated; the patient to whom the composition containing the active agent will be administered; the intended route of administration of the composition; and the desired therapeutic index. Pharmaceutically acceptable carriers include both aqueous and non-aqueous liquid solvents, as well as various solid and semi-solid dosage forms. Such carriers can contain many different components and additives in addition to the active agent, and such additional components are included in the formulation for various reasons well known to those skilled in the art (e.g., stabilization of the active agent, binders, etc.). Descriptions of suitable pharmaceutically acceptable carriers and factors related to their selection can be found in various readily available sources (e.g., Allen, LV Jr. et al., Remington: The Science and Practice of Pharmacy (2 volumes), 22nd Edition (2012), Pharmaceutical Press).

[0260] Pharmaceutically acceptable carriers, adjuvants, and vehicles that may be used in the pharmaceutical compositions of the present invention include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug delivery systems (SEDDS) (e.g., d-α-tocopherol polyethylene glycol 1000 succinate), surfactants used in pharmaceutical dosage forms (e.g., Tween, polyethoxylated castor oil (e.g., CREMOPHOR surfactants (BASF), or other similar polymeric delivery matrices), serum proteins (e.g., human serum albumin), buffer substances (e.g., phosphate, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids), water, salts, or electrolytes (e.g., protamine sulfate, Examples of suitable carriers include cellulose acetate, cellulose acetate esters ...

[0261] The pharmaceutically active compounds of the present invention can be processed according to conventional methods of pharmacy to prepare medicaments for administration to patients (e.g., humans and other mammals). The pharmaceutical compositions may be subjected to conventional pharmaceutical operations (e.g., sterilization) and / or may contain conventional adjuvants (e.g., preservatives, stabilizers, wetting agents, emulsifiers, buffers, etc.). Tablets and pills may additionally be prepared with enteric coatings. Such compositions may also contain adjuvants (e.g., lubricants, sweeteners, flavoring agents, and fragrances).

[0262] For therapeutic purposes, the active compounds of the present invention are typically combined with one or more adjuvants appropriate for the intended route of administration. If administered orally, the compounds may be mixed with lactose, sucrose, starch powder, cellulose esters of alkanoic acids, cellulose alkyl esters, talc, stearic acid, magnesium stearate, magnesium oxide, sodium and calcium salts of phosphates and sulfates, gelatin, gum arabic, sodium alginate, polyvinylpyrrolidone, and / or polyvinyl alcohol, and then tableted or encapsulated for convenient administration. Such capsules or tablets may contain controlled-release formulations, such as may be provided by a dispersion of the active compound in hydroxypropylmethylcellulose.

[0263] The amount of compound and dosing regimen administered to treat a medical condition using the compounds and / or compositions of the present invention will depend on various factors, such as age, weight, sex, the patient's condition, the type of disease, the severity of the disease, the route and frequency of administration, and the particular compound used. Therefore, dosing regimens may vary widely but can be routinely determined using standard methods. A daily dose of about 0.001 to 100 mg / kg body weight, preferably about 0.0025 to 50 mg / kg body weight, and most preferably about 0.005 to 10 mg / kg body weight, may be appropriate. The daily dose may be administered one to four times daily. Other dosing regimens include weekly and biday cycles.

[0264] Pharmaceutical compositions of the present invention include at least a compound of formula (I) and / or at least one pharmaceutically acceptable salt thereof, and optionally an additive selected from any pharmaceutically acceptable carrier, adjuvant, and vehicle. Another composition of the present invention includes a compound of formula (I) as described herein, or a prodrug thereof, and a pharmaceutically acceptable carrier, adjuvant, or vehicle.

[0265] The present invention also includes pharmaceutical kits useful for treating or preventing, for example, diseases or disorders associated with cyclin E1 protein, and other diseases described herein, which include one or more containers containing a pharmaceutical composition comprising a therapeutically effective amount of a compound of Formula (I). Such kits can further include, as desired, one or more of a variety of conventional pharmaceutical kit components (e.g., containers containing one or more pharmaceutically acceptable carriers, additional containers, etc.), as will be readily apparent to those skilled in the art. Instructions indicating the amounts of components to be administered, directions for administration, and / or directions for mixing the components can also be included in the kit, either as a package insert or label.

[0266] Dosage guidelines for the compounds of the present invention will, of course, vary depending on known factors (e.g., the pharmacological properties and form of the particular drug, and the route of administration; the recipient's species, age, sex, health, medical condition, and weight; the nature and extent of the condition; type of concomitant treatment; frequency of treatment; route of administration, the patient's renal and hepatic function, and the desired effect).

[0267] As a general guideline, the daily oral dose of each active ingredient, when used to achieve the intended effect, ranges from about 0.001 to about 5000 mg / day, preferably from about 0.01 to about 1000 mg / day, and most preferably from about 0.1 to about 250 mg / day. For intravenous administration, the most preferred dose is about 0.01 to about 10 mg / kg / min via constant rate infusion. The compounds of formula (I) may be administered in a single daily dose, or in divided doses with the total daily dose being given two, three, or four times a day.

[0268] The compounds are typically administered in admixture with a suitable pharmaceutical diluent, excipient, or carrier (collectively referred to herein as pharmaceutical carrier) appropriately selected for the intended form of administration (e.g., oral tablets, capsules, elixirs, and syrups) and consistent with conventional pharmaceutical practice.

[0269] Dosage forms (pharmaceutical compositions) suitable for administration may contain about 1 to about 200 mg of the active ingredient per dosage unit. In these pharmaceutical compositions, the active ingredient is usually present in an amount of about 0.1 to 95% by weight of the total weight of the composition.

[0270] A typical capsule for oral administration contains at least 250 mg of a compound of Formula (I), 75 mg of lactose, and 15 mg of magnesium stearate, which mixture is passed through a 60 mesh sieve and filled into a No. 1 gelatin capsule.

[0271] A typical injectable formulation is prepared by aseptically adding at least one compound of formula (I) (250 mg) to a vial, aseptically lyophilizing and sealing the vial, and then mixing the contents of the vial with 2 mL of saline to produce the injectable formulation.

[0272] The present invention encompasses pharmaceutical compositions comprising, as an active ingredient, a therapeutically effective amount of at least one compound of formula (I), alone or in combination with a pharmaceutical carrier. Compounds of formula (I) may be used alone, in combination with other compounds of formula (I), or in combination with one or more other agents (e.g., anti-cancer agents or other pharmaceutically active substances), as appropriate.

[0273] Regardless of the route of administration selected, the compounds of formula (I), which may be used in a suitable hydrated form, and / or pharmaceutical compositions of the present invention are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those skilled in the art.

[0274] Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied to contain an amount of the active ingredient that is non-toxic to the patient and effective to produce a therapeutic effect for a particular patient, composition, or mode of administration.

[0275] The selected dosage level will depend on a variety of factors, including the activity of the compound of formula (I) or its ester, salt, or amide employed, the route of administration, the time of administration, the rate of excretion or metabolism of the particular compound employed, the rate and extent of absorption, the duration of treatment, other drugs, compounds, and / or substances used in combination with the particular compound employed, the age, sex, weight, medical condition, health status, and medical history of the patient being treated, and factors well known in the medical arts.

[0276] A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian can start the dosage of the compound of formula (I) used in the pharmaceutical composition at a level lower than that required to achieve a therapeutic effect, and gradually increase the dosage until an effect is achieved.

[0277] Generally, a suitable daily dose of a compound of formula (I) is the lowest effective dose of the compound to achieve a therapeutic effect. Such an effective dose generally depends on the factors described above. Generally, the oral, intravenous, intracerebroventricular, and subcutaneous dose of a compound of formula (I) to a patient ranges from about 0.01 to about 50 mg / kg of body weight per day.

[0278] If desired, the effective daily dose of the active compound may be administered in two, three, four, five, six or more divided doses at appropriate intervals throughout the day, conveniently in unit dosage forms. In some embodiments of the invention, dosing is once daily.

[0279] While it is possible for a compound of formula (I) to be administered alone, it is preferable to administer the compound as a pharmaceutical formulation (composition).

[0280] When used in combination with a compound of Formula (I), the other therapeutic agents described above may be used in amounts as described, for example, in the Physicians' Desk Reference (PDR) or as determined by one of ordinary skill in the art. In the methods of the invention, such other therapeutic agents may be administered before, simultaneously with, or after the administration of a compound of the invention.

[0281] Manufacturing method The compounds of the present invention can be prepared by many methods known to those skilled in the art of organic synthesis. The compounds of the present invention can be synthesized using the following methods in combination with synthetic techniques known in the field of organic chemical synthesis or analogous synthetic methods appreciated by those skilled in the art. Preferred methods include, but are not limited to, the following methods. All documents cited herein are incorporated by reference in their entirety.

[0282] The compounds of the present invention can be prepared using the reactions and techniques described in this section. The reactions are carried out in solvents appropriate to the reagents and materials used and suitable for the transformations being effected. It is also understood that in the description of the synthetic methods that follows, all proposed reaction conditions (including solvent selection, reaction atmosphere, reaction temperature, experimental time, and workup procedures) have been selected to be standard conditions for the reactions, as would be readily recognized by one of ordinary skill in the art. Those skilled in the art of organic synthesis will understand that functional groups present on the various molecular moieties must be compatible with the proposed reagents and reactions. Such limitations on substituents compatible with the reaction conditions will be readily apparent to those skilled in the art, and alternative methods must be used. In some cases, the reactions may necessitate judgment to alter the order of synthetic steps or select a different course of action for certain reactions in order to obtain the desired compounds of the present invention. It is also recognized that another important consideration in planning any synthetic route in this field is the selection of appropriate protecting groups to protect reactive functional groups present in the compounds described in this invention. An authoritative reference that provides the skilled experimenter with many protecting group alternatives is Protective Groups In Organic Synthesis, 4th Edition, by TW Greene and PG Wuts (Wiley-Interscience: Hoboken, NJ, 2007). [Example]

[0283] The following examples illustrate specific embodiments of the present invention and are not intended to limit the scope of the invention. Chemical and scientific abbreviations and symbols have their common and accustomed meanings unless otherwise specified. Additional abbreviations used in the examples and elsewhere in this specification are defined above. Common intermediates are generally useful in the preparation of more than one example. Example compounds are identified by the example and step by which they are prepared (e.g., "1-A" refers to Step A of Example 1), or by the example only if that compound is the title compound of the example (e.g., "1" refers to the title compound of Example 1). In some cases, alternative methods for preparing intermediates or examples are described. Chemists skilled in the synthetic arts will frequently devise desirable alternative preparation methods based on one or more considerations (e.g., shorter reaction times, less expensive starting materials, ease of manipulation or purification, higher yields, ease of catalyst, avoidance of toxic reagents, access to specialized machinery, and reduced number of steps). The intent in describing alternative preparation methods is to make the examples of the present invention more amenable to preparation. In some cases, some functional groups in the outlined examples and claims may be substituted with bioisosteric substitutions well known to those skilled in the art (e.g., replacing a carboxylic acid group with a tetrazole or phosphate moiety).

[0284] Abbreviation [Table 1]

[0285] HPLC conditions Method A: Column: Acquity UPLC BEH C18, 3.0 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: acetonitrile / water (2:98) containing 5 mM ammonium formate (pH 3.3); Mobile phase B: acetonitrile / water (98:2) containing 5 mM ammonium formate (pH 3.3); Temperature: 25 °C; Gradient: 5–98% B (0.0–1.5 min), 98% B (1.5–2.0 min); Flow rate: 0.7 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI + APCI).

[0286] Method B: Column: Acquity UPLC BEH C18, 2.1 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: water (containing 0.1% TFA); Mobile phase B: acetonitrile (containing 0.1% TFA); Temperature: 25 °C; Gradient: 5% B (0.0–0.5 min), 5–98% B (0.5–2.5 min), 98% B (2.5–3.0 min); Flow rate: 0.7 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0287] Method C: Column: XBridge C18, 2.1 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate; Mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; Temperature: 50 °C; Gradient: 0–100% B (0.0–3.0 min), 100% B (3.0–3.5 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (ESI + )

[0288] Method D: Column: XBridge C18, 2.1 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: acetonitrile / water (5:95) containing 0.05% TFA; Mobile phase B: acetonitrile / water (95:5) containing 0.05% TFA; Temperature: 50 °C; Gradient: 0–100% B (0.0–3.0 min), 100% B (3.0–3.5 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (ESI + )

[0289] Method E: Column: Acquity UPLC BEH C18, 2.1 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: acetonitrile / water (5:95) with 0.05% TFA; Mobile phase B: acetonitrile / water (95:5) with 0.05% TFA; Temperature: 50 °C; Gradient: 0–100% B (0.0–1.0 min), 100% B (1.0–1.5 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0290] Method F: Column: Acquity UPLC BEH C18, 2.1 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate; Mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; Temperature: 50 °C; Gradient: 0–100% B (0.0–1.0 min), 100% B (1.0–1.5 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0291] Method G: Column: CHIRALPAK AS, 0.46 cm x 25 cm, particle size: 5 μm; mobile phase: carbon dioxide / MeOH (70:30); temperature: 40 °C; BPR pressure: 140 bar; flow rate: 3.0 mL / min; detection: UV (200–400 nm)

[0292] Method H: Column: Acquity UPLC BEH C18, 2.1 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: Water (containing 0.1% TFA); Mobile phase B: Acetonitrile (containing 0.1% TFA); Temperature: 25 °C; Gradient: 20–98% B (0.0–1.5 min), 98% B (1.5–2.0 min); Flow rate: 0.7 mL / min; Detection: UV (254 nm) and MS (DUIS-ESI+APCI).

[0293] Method I: Column: Acquity UPLC BEH C18, 2.1 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: water (containing 0.1% TFA); Mobile phase B: acetonitrile (containing 0.1% TFA); Temperature: 25 °C; Gradient: 60–98% B (0.0–1.0 min), 98% B (1.0–2.0 min); Flow rate: 0.7 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0294] Method J: Column: Kinetex XB-C18, 3 mm x 75 mm, particle size: 2.6 μm; Mobile phase A: water (containing 0.1% TFA); Mobile phase B: acetonitrile (containing 0.1% TFA); Temperature: 25 °C; Gradient: 5–95% B (0.0–2.5 min), 98% B (2.5–4.0 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0295] Method K: Kinetex XB-C18, 3 mm x 75 mm, particle size: 2.6 μm; Mobile phase A: acetonitrile / water (2:98) containing 5 mM ammonium formate; Mobile phase B: acetonitrile / water (98:2) containing 5 mM ammonium formate; Temperature: 25 °C; Gradient: 20–100% B (0.0–4.0 min), 100% B (4.0–4.6 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0296] Method L: Column: Acquity UPLC BEH C18, 3.0 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: Water (containing 0.1% TFA); Mobile phase B: Acetonitrile (containing 0.1% TFA); Temperature: 25 °C; Gradient: 20–98% B (0.0–1.5 min), 98% B (1.5–2.0 min); Flow rate: 0.7 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0297] Method M: Column: Acquity UPLC BEH C18, 3.0 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: acetonitrile / water (2:98) containing 5 mM ammonium formate (pH 3.3); Mobile phase B: acetonitrile / water (98:2) containing 5 mM ammonium formate (pH 3.3); Temperature: 25 °C; Gradient: 20–98% B (0.0–1.5 min), 98% B (1.5–2.0 min); Flow rate: 0.7 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0298] Method N: Column: Acquity UPLC BEH C18, 2.1 mm x 50 mm, particle size: 1.7 μm; Mobile phase A: Water (containing 0.1% TFA); Mobile phase B: Acetonitrile (containing 0.1% TFA); Temperature: 25 °C; Gradient: 5–98% B (0.0–1.5 min), 98% B (1.5–2.0 min); Flow rate: 0.7 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0299] Method O: Column: Cellulose-4, 0.46 cm x 25 cm, particle size: 5 μm; Mobile phase: Carbon dioxide / MeOH (50:50); Temperature: 40 °C; BPR pressure: 140 bar; Flow rate: 3.0 mL / min; Detection: UV (200–400 nm)

[0300] Method P: Kinetex XB-C18, 3 mm x 75 mm, particle size: 2.6 μm; Mobile phase A: acetonitrile / water (2:98) containing 5 mM ammonium formate; Mobile phase B: acetonitrile / water (98:2) containing 5 mM ammonium formate; Temperature: 25 °C; Gradient: 40–100% B (0.0–3.5 min), 100% B (3.5–4.5 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0301] Method Q: Kinetex XB-C18, 3 mm x 75 mm, particle size: 2.6 μm; Mobile phase A: acetonitrile / water (2:98) containing 5 mM ammonium formate; Mobile phase B: acetonitrile / water (98:2) containing 5 mM ammonium formate; Temperature: 25 °C; Gradient: 20–100% B (0.0–4.0 min), 100% B (4.0–4.06 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0302] Method R: Kinetex XB-C18, 3 mm x 75 mm, particle size: 2.6 μm; Mobile phase A: acetonitrile / water (2:98) containing 5 mM ammonium formate; Mobile phase B: acetonitrile / water (98:2) containing 5 mM ammonium formate; Temperature: 25 °C; Gradient: 80–100% B (0.0–4.0 min), 100% B (4.0–4.06 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0303] Method S: Column: Kinetex XB-C18, 3 mm x 75 mm, particle size: 2.6 μm; Mobile phase A: water (containing 0.1% TFA); Mobile phase B: acetonitrile (containing 0.1% TFA); Temperature: 25 °C; Gradient: 5–95% B (0.0–2.5 min), 95% B (2.5–4.5 min); Flow rate: 1.0 mL / min; Detection: UV (220 nm) and MS (DUIS-ESI+APCI).

[0304] Method T: Column: (R,R) Whelk-O 1, 0.46 cm x 25 cm, particle size: 5 μm; Mobile phase A: carbon dioxide; Mobile phase B: methanol (with 0.1% ammonium hydroxide); Temperature: 40 °C; BPR pressure: 140 bar; Gradient: 35–70% B (0.0–6.0 min), 70% B (6.0–9.0 min); Flow rate: 3.0 mL / min; Detection: UV (200 nm).

[0305] Example 1 [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (1) [ka] Intermediate 1A: Methyl 3-bromo-2-methoxy-6-methylbenzoate [ka] To a solution of 3-bromo-2-methoxybenzoic acid (13 g, 56.3 mmol) in HFIP (250 mL, 56.3 mmol), potassium carbonate (15.55 g, 113 mmol), silver carbonate (31.0 g, 113 mmol), pentamethylcyclopentadienyl iridium(III) chloride dimer (4.48 g, 5.63 mmol), and potassium methyltrifluoroborate (13.72 g, 113 mmol) were added at room temperature. The resulting mixture was stirred at 100 °C for 4 h. The reaction mixture was then filtered through a sintered funnel, and the filtrate was concentrated under reduced pressure. The crude residue was diluted with ethyl acetate (100 mL) and HCl solution (1.5 N). The layers were separated and the organic phase was washed with brine (90 mL), dried (Na2SO4), filtered and concentrated to give crude 3-bromo-2-methoxy-6-methylbenzoic acid (12 g).

[0306] To a solution of crude 3-bromo-2-methoxy-6-methylbenzoic acid (12 g) in DMF (70 mL) was added cesium carbonate (15.95 g, 49.0 mmol) and methyl iodide (3.06 mL, 49.0 mmol) under a nitrogen atmosphere. The resulting mixture was stirred at room temperature for 12 hours. The reaction was then quenched with cold water (100 mL). The reaction mixture was extracted with ethyl acetate (3 x 90 mL). The organic layer was washed with brine (100 mL), dried (NaSO), filtered, and concentrated. The crude material was purified by flash chromatography (SiO, 10% ethyl acetate / petroleum ether) to give methyl 3-bromo-2-methoxy-6-methylbenzoate (12 g, 82% yield over two steps). 1 H NMR(400 MHz, CDCl3):δ 7.49(d, J=8.0 Hz, 1H), 6.88(d, J=8.2 Hz, 1H), 3.96(s, 3H), 3.90(s, 3H), 2.29(s, 3H)

[0307] Intermediate 1B: 3-(6-bromo-7-methoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione [ka] To a solution of methyl 3-bromo-2-methoxy-6-methylbenzoate (12 g, 46.3 mmol) in DCE (100 mL) was added NBS (9.89 g, 55.6 mmol) and AIBN (0.761 g, 4.63 mmol) under a nitrogen atmosphere. The resulting mixture was stirred at 80 °C for 90 minutes. The reaction mixture was then concentrated. The resulting residue was dissolved in petroleum ether, filtered, and concentrated to give crude methyl 3-bromo-6-(bromomethyl)-2-methoxybenzoate (15 g).

[0308] To a solution of crude methyl 3-bromo-6-(bromomethyl)-2-methoxybenzoate (15 g) and 3-aminopiperidine-2,6-dione hydrochloride (10.23 g, 62.1 mmol) in DMF (100 mL) was added DIEA (16.28 mL, 93 mmol) under a nitrogen atmosphere. The resulting mixture was stirred at 100 °C for 2 hours. The reaction mixture was then concentrated under reduced pressure to remove excess solvent. Cold water (200 mL) was added, and a precipitate formed. The mixture was filtered through a Buchner funnel and dried under vacuum to give 3-(6-bromo-7-methoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (10 g). LCMS (Method A): Retention time 1.12 min, [M+H] + 353.0, 355.0

[0309] Intermediate 1C: 3-(6-(hydroxymethyl)-7-methoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione [ka] A solution of 3-(6-bromo-7-methoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (2.0 g, 5.66 mmol) in 1,4-dioxane (20 mL) and DMA (5 mL) was purged with nitrogen for 5 minutes, and then Pd(PPh3)4 (0.654 g, 0.566 mmol) and (tributylstannyl)methanol (3.64 g, 11.3 mmol) were added. The resulting mixture was stirred at 120 °C for 12 hours. The reaction mixture was then concentrated, after which ethyl acetate was added, resulting in the formation of a precipitate. The solid was filtered and dried under vacuum. The resulting crude material was purified by reverse phase chromatography (30% acetonitrile / water with 0.1% TFA) to give 3-(6-(hydroxymethyl)-7-methoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (1.0 g, 58% yield). LCMS (Method B): Retention time 1.21 min, [M+H] + 305.0

[0310] Example 1 A mixture of 3-(6-(hydroxymethyl)-7-methoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (25 mg, 0.082 mmol), 4-(3,4-difluorophenoxy)benzoic acid (26.7 mg, 0.107 mmol), diphenylphosphoryl azide (29.4 mg, 0.107 mmol), and TEA (0.029 mL, 0.205 mmol) in 1,4-dioxane (1 mL) was heated at 110 °C for 5 h. The reaction mixture was cooled to room temperature and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate; mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 46–66% B (0.0–20.0 min), 66–100% B (20.0–20.1 min), 100% B (20.1–24.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (15.5 mg, 34% yield). LCMS (Method C): Retention time 2.00 min, [M+H] + 552.1; 1H NMR(500 MHz, DMSO-d6) δ 10.97(br s, 1H), 9.76(br s, 1H), 7.66(d, J=7.8 Hz, 1H), 7.48(br d, J=8.9 Hz, 2H), 7.44-7.36(m, 1H), 7.33(d, J=7.7 Hz, 1H), 7.11-7.04(m, 1H), 7.01(d, J=8.9 Hz, 2H), 6.80-6.73(m, 1H), 5.21(s, 2H), 5.06(dd, J=13.3, 5.1 Hz, 1H), 4.43(d, J=17.3 Hz, 1H), 4.30(d, J=17.6 Hz, 1H), 4.03(s, 3H), 2.97-2.81(m, 1H), 2.67-2.56(m, 1H), 2.45-2.31(m, 1H), 2.08-1.93(m, 1H)

[0311] Intermediate I-1 4-(4,5-ジフルオロ-2-メトキシフェノキシ)-2-メチルbenzoic acid

change

[0312] Intermediate I-2 2-Fluoro-4-(3-fluorobenzyl)benzoic acid [ka] To a mixture of methyl 4-bromo-2-fluorobenzoate (100 mg, 0.429 mmol), trifluoro(3-fluorobenzyl)borate (114 mg, 0.644 mmol), and aqueous potassium phosphate trihydrate (2.0 M, 429 μL, 0.858 mmol) in 1,4-dioxane (2 mL) was added Pd(dppf)Cl·CHCl complex (17.5 mg, 0.021 mmol). The resulting mixture was purged with nitrogen and heated at 110 °C for 6 h. The reaction mixture was then filtered through Celite, rinsed with EtOAc, washed with diluted brine, dried (MgSO), filtered, and concentrated. The residue was dissolved in a mixture of THF (1 mL), MeOH (1 mL), and water (0.5 mL), followed by the addition of lithium hydroxide (103 mg, 4.29 mmol). The mixture was stirred at room temperature for 2 h. The reaction mixture was then diluted with water and washed with EtOAc (2x). The aqueous layer was separated, acidified with 1N HCl, and extracted with EtOAc. The organic layer was separated, dried (Na2SO4), filtered, and concentrated to give 2-fluoro-4-(3-fluorobenzyl)benzoic acid (94 mg) as a tan powder. LCMS (Method F): Retention time 0.75 min, [MH]- 246.9

[0313] Intermediate I-3 4-((3-fluorophenyl)(methyl)amino)benzoic acid [ka] To a solution of tert-butyl 4-bromobenzoate (370 mg, 1.44 mmol) and 3-fluoro-N-methylaniline (150 mg, 1.20 mmol) in 1,4-dioxane (5 mL) was added cesium carbonate (781 mg, 2.40 mmol) and XPhos Pd G2 (56.6 mg, 0.072 mmol) at room temperature. The reaction vessel was purged with nitrogen and heated at 95 °C overnight. The reaction mixture was then filtered through Celite and rinsed with EtOAc. The filtrate was concentrated, and the residue was purified by silica gel column flash chromatography to give tert-butyl 4-((3-fluorophenyl)(methyl)amino)benzoate. This ester was then dissolved in 1:1 DCM / TFA (3 mL) and stirred at room temperature for 1 hour. The volatiles were then removed under a nitrogen atmosphere. The crude material was dissolved in 1:1 DCM / TEA (2 mL) and purified by flash chromatography (SiO, 0-10% MeOH / DCM) to give 4-((3-fluorophenyl)(methyl)amino)benzoic acid (217 mg, 74% yield) as a white solid. LCMS (Method E): Retention time 0.94 min, [M+H] + 245.9

[0314] Intermediate I-4 4-(1-phenylcyclopropyl)benzoic acid [ka] To a mixture of potassium trifluoro(1-phenylcyclopropyl)borate (125 mg, 0.558 mmol) and methyl 4-bromobenzoate (240 mg, 1.116 mmol) in toluene (12 mL) and water (1.6 mL) was added cesium carbonate (545 mg, 1.67 mmol) and cataCXium® A Pd G3 (24.4 mg, 0.033 mmol). The resulting mixture was degassed by bubbling nitrogen through it for 10 minutes and stirred at 95 °C overnight. The reaction mixture was then cooled to room temperature, filtered through Celite, and rinsed with EtOAc. The filtrate was concentrated, and the residue was purified by silica gel column flash chromatography to give methyl 4-(1-phenylcyclopropyl)benzoate as a colorless oil. To the oil was added a mixture of MeOH (1 mL), THF (3 mL), and water (1 mL), followed by lithium hydroxide monohydrate (134 mg, 5.58 mmol). The resulting mixture was stirred at 60 °C for 1 h. The reaction mixture was then cooled to room temperature, acidified with 1 N HCl, and extracted with EtOAc (3x). The combined organic layers were dried (Na2SO4), filtered, and concentrated. The resulting solid was dried under vacuum to give 4-(1-phenylcyclopropyl)benzoic acid (105 mg, 77% yield) as a light brown solid. LCMS (Method E): Retention time 1.04 min, [M+H] + 239.0

[0315] Intermediate I-5 4-(Difluoro(phenyl)methyl)benzoic acid [ka] Methyl 4-benzoylbenzoate (200 mg, 0.832 mmol) and boron trifluoride-acetic acid complex (876 μL, 2.08 mmol) were combined in dry DCM under a nitrogen atmosphere. Ethane-1,2-dithiol (140 μL, 1.67 mmol) was added via syringe, and the resulting mixture was stirred overnight at room temperature. The reaction mixture was partitioned between DCM and water. The organic layer was concentrated and purified by silica gel column flash chromatography to give methyl 4-(2-phenyl-1,3-dithiolan-2-yl)benzoate as a clear oil. In a plastic vial, this oil was dissolved in DCM (3 mL), followed by the addition of hydrogen fluoride-pyridine (70% HF, 1 mL) and Selectfluor (369 mg, 1.04 mmol). The resulting mixture was stirred at room temperature for 1 hour. The reaction mixture was then diluted with DCM and washed with water, saturated aqueous sodium bicarbonate, and brine. The organic layer was dried (Na2SO4), filtered, and concentrated. The residue was dissolved in a mixture of MeOH (1 mL) and THF (2 mL) and treated with lithium hydroxide monohydrate (100 mg, 4.16 mmol) in water (1 mL). The resulting mixture was stirred overnight at room temperature. The reaction mixture was then diluted with water and washed with EtOAc. The aqueous layer was acidified by adding excess 1N HCl and extracted with EtOAc (3x). The combined organic extracts were washed with brine, dried (Na2SO4), filtered, and concentrated to give 4-(difluoro(phenyl)methyl)benzoic acid (115 mg, 56% yield) as a tan solid. LCMS (Method F): Retention time 0.82 min, [MH]- 247.2

[0316] Intermediate I-6 2-Methoxy-4-(2,4,5-trifluorophenoxy)benzoic acid [ka] To a solution of tert-butyl 4-bromo-2-methoxybenzoate (129 mg, 0.450 mmol) and 2,4,5-trifluorophenol (80 mg, 0.540 mmol) in 1,4-dioxane (3 mL) was added cesium carbonate (293 mg, 0.900 mmol), N,N-dimethylglycine (13.9 mg, 0.135 mmol), and copper(I) bromide (12.9 mg, 0.090 mmol). The resulting mixture was stirred for 12 hours at 110 °C under a nitrogen atmosphere. The reaction mixture was filtered, and the solvent was removed from the filtrate under a stream of air. The residue was dissolved in DCM (1 mL) and treated with TFA (4 mL). The reaction mixture was stirred at room temperature for 2 hours, then diluted with water and extracted with EtOAc. The organic layer was collected and concentrated to give 2-methoxy-4-(2,4,5-trifluorophenoxy)benzoic acid. LCMS (Method E): Retention time 0.96 min, [M+H] + 298.8

[0317] Examples 2 to 34 The compounds in Table 1 were prepared following the general method described for Example 1, substituting the appropriate acid (either commercially available, synthesized as described for intermediates I-1, I-2, I-3, I-4, I-5, or I-6, or synthesized in a similar manner) for 4-(3,4-difluorophenoxy)benzoic acid: [ka] [Table 2] [Table 3] [Table 4] [Table 5]

[0318] Examples 35 and 36 {2-[(3S)-2,6-dioxopiperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] {2-[(3R)-2,6-dioxopiperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] A racemic mixture of [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (700 mg) was dissolved in MeOH / DCM (1:1) and subjected to chiral separation by SFC (column: Cellulose-4, 3 x 25 cm, particle size: 5 μm; mobile phase: carbon dioxide / MeOH (48:52); temperature: 35°C; BPR pressure: 100 bar; flow rate: 200 mL / min).

[0319] Fractions containing the first peak were combined and lyophilized to dryness to give {2-[(3S)-2,6-dioxopiperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (270 mg). The absolute configuration was assigned as (S) by comparing the experimental VCD spectrum with the predicted VCD spectra of the (R) and (S) isomers. SFC (Method G): Retention time: 5.50 min (>99% ee); LCMS (Method E): Retention time: 1.05 min, [M+H] + 552.2; 1H NMR(400 MHz, methanol-d4) δ 7.71(d, J=7.7 Hz, 1H), 7.47(br d, J=8.8 Hz, 1H), 7.31(d, J=7.7 Hz, 1H), 7.27-7.15(m, 1H), 7.01-6.92(m, 2H), 6.86(ddd, J=11.8, 6.7, 2.9 Hz, 1H), 6.77-6.69(m, 1H), 5.30(s, 2H), 5.12(dd, J=13.3, 5.2 Hz, 1H), 4.52-4.39(m, 2H), 4.10(s, 3H), 2.98-2.85(m, 1H), 2.84-2.72(m, 1H), 2.48(qd, J=13.2, 4.6 Hz, 1H), 2.23-2.11(m, 1H)

[0320] Fractions containing the second peak were combined and lyophilized to dryness to give {2-[(3R)-2,6-dioxopiperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (260 mg). The absolute configuration was assigned as (R) by comparing the experimental VCD spectrum with the predicted VCD spectra of the (R) and (S) isomers. SFC (Method G): retention time 4.19 min (>99% ee); LCMS (Method E): retention time 1.05 min, [M+H] + 552.2; 1H NMR(400 MHz, methanol-d4) δ 7.70(d, J=7.7 Hz, 1H), 7.46(br d, J=8.7 Hz, 2H), 7.30(d, J=7.7 Hz, 1H), 7.26-7.14(m, 1H), 7.01-6.93(m, 2H), 6.86(ddd, J=11.7, 6.7, 2.9 Hz, 1H), 6.78-6.68(m, 1H), 5.29(s, 2H), 5.12(dd, J=13.4, 5.2 Hz, 1H), 4.53-4.37(m, 2H), 4.10(s, 3H), 2.98-2.84(m, 1H), 2.83-2.72(m, 1H), 2.48(qd, J=13.2, 4.7 Hz, 1H), 2.24-2.10(m, 1H)

[0321] Example 37 [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)-2-methoxyphenyl]carbamate [ka] To a solution of 4-nitrophenyl chloroformate (42.8 mg, 0.212 mmol) in THF (5 mL) was added 4-(4-fluorophenoxy)-2-methoxyaniline (45 mg, 0.193 mmol). The resulting mixture was stirred for 5 minutes, and then pyridine (46.8 μL, 0.579 mmol) was added dropwise. The reaction mixture was stirred at room temperature for 3 hours. The solvent was removed from the filtrate under airflow, and the residue was redissolved in DMF (2 mL), followed by the addition of 3-(6-(hydroxymethyl)-7-methoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (41.1 mg, 0.135 mmol) and triethylamine (81 μL, 0.579 mmol). The resulting mixture was stirred at 80 °C for 3 hours. The reaction mixture was then diluted with water and extracted with EtOAc. The organic layer was collected and concentrated. The crude material was purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 30–70% B (0.0–20.0 min), 70–100% B (20.0–20.1 min), 100% B (20.1–24.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)-2-methoxyphenyl]carbamate (10.6 mg, 28% yield) as an off-white solid. LCMS (Method D): Retention time 1.88 min, [M+H] + 563.9; 1H NMR(500 MHz, DMSO-d6) δ 10.98(s, 1H), 8.59(s, 1H), 7.67(br d, J=8.1 Hz, 1H), 7.56-7.44(m, 1H), 7.33(d, J=7.8 Hz, 1H), 7.25-7.15(m, 2H), 7.08-6.99(m, 2H), 6.74(d, J=2.6 Hz, 1H), 6.47(dd, J=8.7, 2.5 Hz, 1H), 5.18(s, 2H), 5.07(dd, J=13.4, 5.2 Hz, 1H), 4.43(d, J=17.4 Hz, 1H), 4.30(d, J=17.5 Hz, 1H), 4.01(s, 3H), 3.74(s, 3H), 2.97-2.82(m, 1H), 2.66-2.57(m, 1H), 2.46-2.31(m, 1H), 2.07-1.94(m, 1H)

[0322] Examples 38 to 51 The compounds in Table 2 were prepared following the general method described for Example 37, substituting the appropriate aniline for 4-(4-fluorophenoxy)-2-methoxyaniline: [ka] [Table 6] [Table 7]

[0323] Example 52 [2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate [ka] Intermediate 52A: Methyl 3-bromo-2-ethoxy-6-methylbenzoate [ka] A mixture of methyl 3-bromo-2-hydroxy-6-methylbenzoate (800 mg, 3.26 mmol), iodoethane (611 mg, 3.92 mmol), and potassium carbonate (1.12 g, 8.16 mmol) in acetone (6 mL) was stirred at 60 °C for 2 h. The reaction mixture was cooled to room temperature, filtered through Celite, and rinsed with DCM (10 mL). The filtrate was concentrated, and the resulting residue was purified by flash chromatography (SiO2, 0–20% EtOAc / Hex) to give methyl 3-bromo-2-ethoxy-6-methylbenzoate (700 mg, 79% yield). LCMS (Method E): Retention time 1.05 min, [M+H] + 272.9, 274.8; 1 H NMR (400 MHz, chloroform-d) δ 7.47 (d, J = 8.2 Hz, 1H), 6.84 (dd, J = 8.2, 0.7 Hz, 1H), 4.14-4.05 (m, 2H), 3.93 (s, 3H), 2.26 (s, 3H), 1.39 (t, J = 7.0 Hz, 3H).

[0324] Intermediate 52B: methyl 3-bromo-6-(bromomethyl)-2-ethoxybenzoate [ka] A mixture of methyl 3-bromo-2-ethoxy-6-methylbenzoate (700 mg, 2.56 mmol), NBS (547 mg, 3.08 mmol), and AIBN (21.0 mg, 0.128 mmol) in 1,2-dichloroethane (8 mL) was stirred at 60 °C for 4 h. The reaction mixture was cooled to room temperature and concentrated. The residue was purified by flash chromatography (SiO2, 0–10% EtOAc / Hex) to give methyl 3-bromo-6-(bromomethyl)-2-ethoxybenzoate (550 mg, 61% yield). LCMS (Method E): Retention time 1.06 min, [M+H] + 350.7, 352.7, 354.7; 1H NMR (400 MHz, chloroform-d) δ 7.58 (d, J = 8.2 Hz, 1H), 7.06 (d, J = 8.3 Hz, 1H), 4.47 (s, 2H), 4.12 (q, J = 7.0 Hz, 2H), 3.98 (s, 3H), 1.40 (t, J = 7.0 Hz, 3H).

[0325] Intermediate 52C: 3-(6-bromo-7-ethoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione [ka] A mixture of methyl 3-bromo-6-(bromomethyl)-2-ethoxybenzoate (400 mg, 1.14 mmol), 3-aminopiperidine-2,6-dione hydrochloride (206 mg, 1.25 mmol), and DIEA (0.50 mL, 2.84 mmol) in acetonitrile (8 mL) was stirred at 80 °C for 15 h. The reaction mixture was cooled to room temperature and concentrated. The residue was purified by flash chromatography (SiO, 0–100% EtOAc / Hex) to give 3-(6-bromo-7-ethoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (350 mg, 84% yield). LCMS (Method E): Retention time 0.82 min, [M+H] + 366.9, 368.8; 1 H NMR(400 MHz, DMSO-d6) δ 10.99(s, 1H), 7.85(d, J=8.0 Hz, 1H), 7.27(d, J=8.0 Hz, 1H), 5.06(dd, J=13.3, 5.1 Hz, 1H), 4.57-4.29(m, 2H), 4.28-4.18(m, 2H), 3.57(s, 2H), 2.84(s, 1H), 2.67-2.56(m, 1H), 2.43-2.29(m, 1H), 2.06-1.92(m, 1H), 1.35(t, J=7.0 Hz, 3H)

[0326] Intermediate 52D: 3-(7-ethoxy-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)piperidine-2,6-dione [ka] A mixture of 3-(6-bromo-7-ethoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (280 mg, 0.763 mmol), (tributylstannyl)methanol (294 mg, 0.915 mmol), and Pd(PPh3)4 (44.1 mg, 0.038 mmol) in 1,4-dioxane (2 mL) was stirred at 100 °C in a sealed tube under a nitrogen atmosphere for 15 h. The reaction mixture was cooled to room temperature and concentrated. The residue was purified by flash chromatography (SiO2, 0–10% MeOH / DCM) to give 3-(7-ethoxy-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)piperidine-2,6-dione (100 mg, 41% yield). LCMS (Method E): Retention time 0.73 min, [M+H] + 319.0; 1 H NMR(400 MHz, DMSO-d6) δ 10.97(s, 1H), 7.65(d, J=7.7 Hz, 1H), 7.28(d, J=7.7 Hz, 1H), 5.14(t, J=5.6 Hz, 1H), 5.05(dd, J=13.3, 5.2 Hz, 1H), 4.59(d, J=5.6 Hz, 2H), 4.47-4.27(m, 2H), 4.28-4.11(m, 2H), 2.96-2.83(m, 1H), 2.62(br d, J=2.4 Hz, 1H), 2.42-2.30(m, 1H), 2.02-1.89(m, 1H), 1.30(t, J=7.0 Hz, 3H)

[0327] Example 52: A mixture of 3-(7-ethoxy-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)piperidine-2,6-dione (25 mg, 0.079 mmol), 4-phenoxybenzoic acid (25.2 mg, 0.118 mmol), diphenylphosphoric acid azide (32.4 mg, 0.118 mmol), and TEA (0.033 mL, 0.236 mmol) in 1,4-dioxane (1 mL) was heated at 105 °C for 15 h. The reaction mixture was cooled to room temperature and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 42–62% B (0.0–30.0 min), 62–100% B (30.0–30.1 min), 100% B (30.1–34.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (3.4 mg, 8% yield). LCMS (Method C): Retention time 2.01 min, [M+1] + 530.1; 1 H NMR(500 MHz, DMSO-d6) δ 9.70(br s, 1H), 7.66(d, J=7.6 Hz, 1H), 7.46(br d, J=8.6 Hz, 2H), 7.40-7.29(m, 3H), 7.08(t, J=7.3 Hz, 1H), 6.95(br dd, J=17.8, 8.3 Hz, 4H), 5.21(s, 2H), 5.03(dd, J=13.4, 5.0 Hz, 1H), 4.56-4.15(m, 4H), 2.92-2.77(m, 1H), 2.62(br s, 1H), 2.43-2.31(m, 1H), 2.06-1.96(m, 1H), 1.32(t, J=7.0Hz, 3H)

[0328] Examples 53 to 55 The compounds in Table 3 were prepared following the general method described for Example 51, substituting the appropriate acid for 4-phenoxybenzoic acid: [ka] [Table 8]

[0329] Intermediate I-7 4-Nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate [ka] To a cooled (0 °C) and well-stirred solution of 4-(3,4-difluorophenoxy)aniline (5 g, 22.6 mmol) in 1,4-dioxane (40 mL) was added pyridine (3.66 mL, 45.2 mmol), followed by 4-nitrophenyl chloroformate (5.01 g, 24.9 mmol). The resulting mixture was stirred at room temperature for 2 hours. The reaction mixture was then quenched with water (50 mL) and extracted with EtOAc (2 x 200 mL). The combined organic layers were dried (Na2SO4), filtered, and concentrated. The residue was triturated with diethyl ether (3 x 20 mL) to give crude 4-nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate (10.5 g) as a pale white solid, which was used in the subsequent step without further purification. 1 H NMR(400 MHz, DMSO-d6) δ 10.51(s, 1H), 8.31-8.38(m, 2H), 7.56-8.14(m, 4H), 7.43-7.54(m, 2H), 7.11-7.14(m, 1H), 7.08-7.10(m, 1H), 6.80-6.83(m, 1H)

[0330] Example 56 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 56A: Ethyl 3-bromo-2-hydroxy-6-methylbenzoate [ka] To a cooled (0 °C) and stirred solution of ethyl 2-hydroxy-6-methylbenzoate (15 g, 83 mmol) and diisopropylamine (1.19 mL, 8.32 mmol) in DCM (250 mL) was added a solution of NBS (14.8 g, 83 mmol) in DCM (750 mL) over 1 h. The resulting mixture was stirred at ambient temperature for 2 h. The reaction mixture was diluted with water (500 mL) and extracted with DCM (2 x 500 mL). The combined organic layers were washed with brine (500 mL), dried (Na2SO4), filtered, and concentrated. The crude product was purified by reverse-phase chromatography to give ethyl 3-bromo-2-hydroxy-6-methylbenzoate (18 g, 63.0 mmol, 76% yield) as a light brown solid. LCMS (Method H): Retention time 1.61 min, [M+H] + 259.0, 261.0

[0331] Intermediate 56B: Ethyl 3-bromo-2-isopropoxy-6-methylbenzoate [ka] To a stirred solution of ethyl 3-bromo-2-hydroxy-6-methylbenzoate (5 g, 19.3 mmol) and cesium carbonate (12.58 g, 38.6 mmol) in DMF (50 mL) was added 2-iodopropane (4.92 g, 28.9 mmol). The resulting mixture was stirred at 100 °C for 16 h. The reaction mixture was diluted with water (200 mL) and extracted with DCM (2 x 200 mL). The combined organic layers were washed with water (200 mL), brine (200 mL), dried (NaSO), filtered, and concentrated. The crude product was purified by flash chromatography (SiO, 0–10% EtOAc / petroleum ether) to afford ethyl 3-bromo-2-isopropoxy-6-methylbenzoate (4 g, 12.4 mmol, 64% yield) as a colorless liquid. LCMS (Method I): Retention time 1.05 min, [M+H] + 301.0, 303.2

[0332] Intermediate 56C: tert-butyl 5-amino-4-(6-bromo-7-isopropoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] To a stirred solution of ethyl 3-bromo-2-isopropoxy-6-methylbenzoate (7 g, 23.2 mmol) in 1,2-dichloroethane (50 mL) was added NBS (4.55 g, 25.6 mmol) and AIBN (1.145 g, 6.97 mmol). The resulting mixture was stirred at 80 °C for 6 h. The reaction mixture was diluted with water and extracted with DCM (2 × 150 mL). The combined organic layers were dried (NaSO), filtered, and concentrated. The residue was purified by flash chromatography (SiO, 10% EtOAc / petroleum ether) to afford ethyl 3-bromo-6-(bromomethyl)-2-isopropoxybenzoate (7.5 g, ∼58% purity as determined by HPLC) as a light brown solid.

[0333] To a stirred solution of ethyl 3-bromo-6-(bromomethyl)-2-isopropoxybenzoate in DMF (70 mL) was added DIEA (9.0 mL, 51.3 mmol) and (S)-tert-butyl 4,5-diamino-5-oxopentanoate (4.15 g, 20.5 mmol). The resulting mixture was stirred at 80 °C for 16 hours. The reaction was quenched by the addition of water. The reaction mixture was extracted with EtOAc (3 x 100 mL). The combined organic layers were dried (Na2SO4), filtered, and concentrated. The crude product was purified by flash chromatography (SiO2, 0-70% EtOAc / petroleum ether) to afford tert-butyl 5-amino-4-(6-bromo-7-isopropoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (7.1 g, HPLC purity: ∼60%) as a light brown sticky solid. The enantiomeric excess of this material and subsequent intermediates was not determined. LCMS (Method H): Retention time 1.44 min; [M+H] + 455.2, 457.2

[0334] Intermediate 56D: 3-(6-bromo-7-isopropoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione [ka] To a solution of tert-butyl 5-amino-4-(6-bromo-7-isopropoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (3 g) in acetonitrile (15 mL) was added TFA (2.54 mL, 32.9 mmol). The resulting mixture was heated at 120 °C for 1 h using a microwave synthesizer. The reaction mixture was then concentrated. The reaction was quenched by the addition of saturated aqueous sodium bicarbonate. The mixture was diluted with water and extracted with EtOAc (2 x 100 mL). The combined organic layers were dried (Na2SO4), filtered, and concentrated. The crude product was purified by flash chromatography (SiO2, 60% EtOAc / petroleum ether) to afford 3-(6-bromo-7-isopropoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (1.4 g, ∼81% purity as determined by HPLC) as an off-white solid. LCMS (Method H): Retention time 1.27 min; [M+H] + 381.0, 383.0

[0335] Intermediate 56E: 3-(6-(hydroxymethyl)-7-isopropoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione [ka] A solution of 3-(6-bromo-7-isopropoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (1.2 g, 3.15 mmol) and (tributylstannyl)methanol (1.01 g, 3.15 mmol) in 1,4-dioxane (10 mL) was purged with nitrogen for 5 minutes, and then Pd(PPh3)4 (0.364 g, 0.315 mmol) was added. The resulting mixture was purged with nitrogen for an additional 2 minutes and then stirred at 100 °C for 16 hours. The reaction was quenched by the addition of water. The reaction mixture was extracted with EtOAc. The combined organic layers were dried (Na2SO4), filtered, and concentrated. The crude product was purified by flash chromatography (SiO, 70-80% EtOAc / petroleum ether) to give 3-(6-(hydroxymethyl)-7-isopropoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (0.43 g, 40% yield) as an off-white solid. LCMS (Method J): Retention time 1.64 min, [M+H] + 333.1; 1 H NMR(400 MHz, DMSO-d6):δ 7.67(d, J=7.6 Hz, 1H), 7.26(d, J=7.6 Hz, 1H), 5.08-5.03(m, 2H), 4.83-4.87(m, 1H), 4.57(d, J=6.4 Hz, 2H), 4.39(d, J=17.2 Hz, 1H), 4.27(d, J=17.2 Hz, 1H), 2.89-2.84(m, 1H), 2.68-2.59(m, 1H), 2.41-2.36(m, 1H), 2.02-2.00(m, 1H), 1.25-1.20(m, 6H)

[0336] Example 56: A mixture of 3-(6-(hydroxymethyl)-7-isopropoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (50 mg, 0.150 mmol) and DIEA (0.079 mL, 0.451 mmol) in DMF (2 mL) was stirred for 10 min at room temperature under a nitrogen atmosphere. 4-Nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate (87 mg, 0.226 mmol) was then added, and the resulting mixture was stirred at room temperature for 6 h. The reaction mixture was concentrated and purified by preparative HPLC (XBridge C18, 19 mm x 200 mm, 5 μm particle size; mobile phase A: water (containing 5 mM ammonium formate); mobile phase B: acetonitrile; temperature: 25 °C; gradient: 40–60% B (0.0–20.0 min); flow rate: 25 mL / min). The product-containing fractions were combined and lyophilized to dryness to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (12 mg, 14% yield) as an off-white solid. LCMS (Method K): Retention time 3.03 min, [MH]- 578.0; 1 H NMR(400 MHz, DMSO-d6):δ 9.77(s, 1H), 8.36(s, 1H), 7.66(d, J=7.6 Hz, 1H), 7.50(d, J=8.8 Hz, 1H), 7.42(q, J=8.0 Hz, 1H), 7.39(d, J=9.2 Hz, 1H), 7.12-7.09(m, 1H), 7.07-7.02(m, 2H), 6.78-6.76(m, 1H), 5.23(s, 2H), 5.09-5.05(m, 1H), 4.96-4.93(m, 1H), 4.43(d, J=17.6 Hz, 1H), 4.31(d, J=17.6 Hz, 1H), 2.89-2.87(m, 1H), 2.61-2.56(m, 1H), 2.49-2.40(m, 1H), 2.08-2.04(m, 1H), 1.29-1.24(m, 6H)

[0337] Examples 57 to 59 The compounds in Table 4 were prepared following the general method described for Example 56, substituting the appropriate 4-nitrophenyl carbamate (prepared by a method similar to intermediate I-7) for 4-nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate: [ka] [Table 9]

[0338] Example 60 [4-(Difluoromethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate [ka] Intermediate 60A: Ethyl 3-bromo-2-(difluoromethoxy)-6-methylbenzoate [ka] To a cooled (-20 °C) and well-stirred solution of ethyl 3-bromo-2-hydroxy-6-methylbenzoate (5 g, 19.3 mmol) in acetonitrile (50 mL) was added chilled aqueous potassium hydroxide (10.83 g, 193 mmol) (30 mL), followed by dropwise addition of diethyl (bromodifluoromethyl)phosphonate (10.3 mL, 57.9 mmol), maintaining the temperature below -20 °C. At the end of the addition, the reaction mixture was heated to room temperature and stirred for 16 h. The reaction mixture was extracted with EtOAc (2 x 100 mL), and the combined organic layers were washed with brine (100 mL), dried (NaSO), and concentrated. The crude product was purified by reverse-phase chromatography to give ethyl 3-bromo-2-(difluoromethoxy)-6-methylbenzoate (3 g, purity determined by GC: ~76%). GCMS: retention time 5.89 min, [M] +308.0, 310.0

[0339] Intermediate 60B: 3-(6-bromo-7-(difluoromethoxy)-1-oxoisoindolin-2-yl)piperidine-2,6-dione [ka] To a well-stirred solution of ethyl 3-bromo-2-(difluoromethoxy)-6-methylbenzoate (3.4 g, 7.37 mmol) in DCE (30 mL) was added AIBN (0.363 g, 2.21 mmol) and NBS (1.71 g, 9.58 mmol). The resulting mixture was stirred at 90 °C for 3 h. The reaction mixture was cooled to room temperature, filtered through a pad of silica gel, and rinsed with 20% EtOAc / petroleum ether. The filtrate was concentrated, and the crude residue was purified by flash chromatography (SiO2, 100 g column, 0–100% EtOAc / petroleum ether) to afford ethyl 3-bromo-6-(bromomethyl)-2-(difluoromethoxy)benzoate as a pale yellow oil. GCMS: Retention time 6.73 min, [M] + 387.9

[0340] To a well-stirred solution of ethyl 3-bromo-6-(bromomethyl)-2-(difluoromethoxy)benzoate (4.85 g, 8.58 mmol) in DMF (25 mL) was added 3-aminopiperidine-2,6-dione (2.20 g, 17.2 mmol), followed by the slow addition of DIEA (4.50 mL, 25.7 mmol). The resulting mixture was stirred at 90 °C for 16 h. The solvent was then removed and the crude product was purified by reverse phase chromatography to give 3-(6-bromo-7-(difluoromethoxy)-1-oxoisoindolin-2-yl)piperidine-2,6-dione (2.09 g, 60.0% yield) as a dark brown solid. LCMS (Method L): Retention time 1.06 min, [M+H] + 389.0, 391.0

[0341] Example 60: To a well-stirred solution of 3-(7-(difluoromethoxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)piperidine-2,6-dione (117 mg, 0.325 mmol) in DMF (2 mL) was added 4-nitrophenyl (4-phenoxyphenyl)carbamate (228 mg, 0.649 mmol) and DIEA (0.284 mL, 1.62 mmol). After 6 h, the reaction mixture was concentrated. The crude material was purified by reverse-phase preparative HPLC to give [4-(difluoromethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (34 mg, 16% yield) as a white solid. LCMS (Method K): Retention time 2.84 min, [M+NH4] + 569.0. 1 H NMR(400 MHz, DMSO-d6) δ 10.01(s, 1H), 9.80(s, 1H), 7.81(d, J=8.0 Hz, 1H), 7.59(d, J=8.0 Hz, 1H), 7.48(d, J=8.8 Hz, 2H), 7.37-7.33(m, 3H), 7.11-7.06(m, 1H), 6.98-6.93(m, 4H), 5.28(s, 2H), 5.13-5.08(m, 1H), 4.51(d, J=18.0 Hz, 1H), 4.40(d, J=18.0 Hz, 1H), 2.90(m, 1H), 2.67-2.63(m, 1H)

[0342] Example 61 [4-(Difluoromethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] To a well-stirred solution of 3-(7-(difluoromethoxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)piperidine-2,6-dione (117 mg, 0.325 mmol) and DIEA (0.284 mL, 1.624 mmol) in DMF (2 mL) was added 4-nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate (251 mg, 0.649 mmol) in DMF dropwise over 3 minutes. The resulting mixture was stirred at room temperature for 16 hours. The reaction mixture was concentrated, and the crude product was purified by preparative HPLC (SunFire C18, 19 mm x 150 mm, 5 μm particle size column; mobile phase A: water (containing 5 mM ammonium formate), mobile phase B: acetonitrile; temperature: 25 °C; gradient: 60–90% B (0.0–12.0 min); flow rate: 12 mL / min). The product-containing fractions were combined and lyophilized to dryness to give [4-(difluoromethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (20 mg, 10% yield) as a white solid. LCMS (Method K): Retention time 2.96 min, [M+H] + 588.0; 1 H NMR(400 MHz, DMSO-d6) δ 11.01(s, 1H), 9.84(s, 1H), 7.81(d, J=8.0 Hz, 1H), 7.59(d, J=7.6 Hz, 1H), 7.50(d, J=8.8 Hz, 2H), 7.44(d, J=9.2 Hz, 1H), 7.36(t, J=75.2 Hz, 1H), 7.13-7.07(m, 1H), 7.02(d, J=2.0 Hz, 2H), 6.80-6.76(m, 1H), 5.28(s, 2H), 5.13-5.08(m, 1H), 4.51(d, J=18.0 Hz, 1H), 4.40(d, J=17.6 Hz, 1H), 2.90(m, 1H), 2.61(m, 1H), 2.41(m, 1H), 2.08(m, 1H)

[0343] Example 62 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate [ka] Intermediate 62A: Methyl 3-bromo-2-fluorobenzoate [ka] To a cooled (0 °C) solution of 3-bromo-2-fluorobenzoic acid (25 g, 114 mmol) in DMF (80 mL) was added cesium carbonate (74.4 g, 228 mmol) and iodomethane (24.30 g, 171 mmol). The resulting mixture was stirred at room temperature for 12 h. The reaction was quenched by the addition of cold water (100 mL). The reaction mixture was extracted with ethyl acetate (3 × 90 mL). The combined organic layers were washed with brine (90 mL), dried (NaSO), filtered, and concentrated. The residue was purified by flash chromatography (SiO, 10% EtOAc / petroleum ether) to afford methyl 3-bromo-2-fluorobenzoate (25 g, 94% yield) as a colorless oil. 1 H NMR(400 MHz, CDCl3) δ 7.92-7.88(m, 1H), 7.84-7.78(m, 1H), 7.14-7.10(m, 1H), 3.97(s, 3H)

[0344] Intermediate 62B: methyl 3-bromo-2-phenoxybenzoate [ka] To a solution of methyl 3-bromo-2-fluorobenzoate (25 g, 107 mmol) in NMP (100 mL) was added phenol (12.12 g, 129 mmol) and potassium carbonate (26.7 g, 193 mmol) under a nitrogen atmosphere. The resulting mixture was stirred at 130 °C for 12 h. The reaction was quenched by the addition of cold water (150 mL). The reaction mixture was extracted with ethyl acetate (3 × 90 mL). The combined organic layers were washed with brine (90 mL), dried (NaSO), filtered, and concentrated. The crude product was purified by flash chromatography (SiO, 3% EtOAc / petroleum ether) to afford methyl 3-bromo-2-phenoxybenzoate (16 g, 49% yield) as a yellow oil. 1 H NMR(400 MHz, CDCl3) δ 7.93-7.90(m, 1H), 7.86-7.84(m, 1H), 7.32-7.28(m, 2H), 7.24-7.20(m, 1H), 7.06-7.02(m, 1H), 6.83-6.79(m, 2H), 3.71(s, 3H)

[0345] Intermediate 62C: Methyl 3-bromo-6-methyl-2-phenoxybenzoate [ka] To a solution of methyl 3-bromo-2-phenoxybenzoate (15 g, 48.8 mmol) in MeOH (50 mL) and THF (50 mL) was added lithium hydroxide (3.51 g, 147 mmol) in water (50 mL). The resulting mixture was stirred at 80 °C for 5 h. The reaction mixture was concentrated, diluted with water (100 mL), and washed with EtOAc (1 x 150 mL). The aqueous layer was acidified with excess 1.5 N HCl (60 mL) and extracted with ethyl acetate (3 x 100 mL). The combined organic layers were washed with brine (100 mL), dried (NaSO), filtered, and concentrated to give 3-bromo-2-phenoxybenzoic acid. LCMS (Method M): Retention time 1.26 min, [MH]- 291.0, 293.0

[0346] To a solution of 3-bromo-2-phenoxybenzoic acid (5 g, 17.1 mmol) in HFIP (50 mL) was added potassium carbonate (4.72 g, 34.1 mmol), silver carbonate (9.41 g, 34.1 mmol), potassium methyltrifluoroborate (4.16 g, 34.1 mmol), and pentamethylcyclopentadienyl iridium(III) chloride dimer (1.36 g, 1.71 mmol). The resulting mixture was stirred at 100 °C for 12 h. The reaction mixture was then filtered through a sintered funnel, and the filtrate was concentrated. The residue was diluted with EtOAc (150 mL) and acidified with 1.5 N HCl. The organic layer was washed with brine (50 mL), dried (NaSO), filtered, and concentrated to give 3-bromo-6-methyl-2-phenoxybenzoic acid.

[0347] To a cooled (0 °C) solution of 3-bromo-6-methyl-2-phenoxybenzoic acid (9 g, 29.3 mmol) in DMF (50 mL) was added potassium carbonate (4.05 g, 29.3 mmol) and methyl iodide (1.83 mL, 29.3 mmol) under a nitrogen atmosphere. The resulting mixture was stirred at room temperature for 12 h. The reaction was quenched by the addition of cold water (100 mL). The reaction mixture was extracted with EtOAc (3 x 100 mL). The combined organic layers were washed with brine (70 mL), dried (Na2SO4), filtered, and concentrated. The crude product was purified by flash chromatography (SiO2, 10% EtOAc / petroleum ether) to give methyl 3-bromo-6-methyl-2-phenoxybenzoate (9.0 g, 80% yield) as a colorless oil. LCMS (Method K): Retention time 3.23 min, [M] + 320.0, 322.0; 1 H NMR(400 MHz, CDCl3) δ 7.56(d, J=8.4 Hz, 1H), 7.30-7.24(m, 2H), 7.04-6.98(m, 2H), 6.79-6.83(m, 2H), 3.68(s, 3H), 2.33(s, 3H)

[0348] Intermediate 62D: tert-butyl 5-amino-4-(6-bromo-1-oxo-7-phenoxyisoindolin-2-yl)-5-oxopentanoate [ka] To a solution of methyl 3-bromo-6-methyl-2-phenoxybenzoate (8 g, 24.9 mmol) in DCE (70 mL) was added NBS (5.32 g, 29.9 mmol) and AIBN (0.409 g, 2.491 mmol) under a nitrogen atmosphere. The resulting mixture was stirred at 85 °C for 2 h. The reaction mixture was then filtered through a sintered funnel, rinsed with petroleum ether (100 mL), and the filtrate was concentrated to give methyl 3-bromo-6-(bromomethyl)-2-phenoxybenzoate.

[0349] To a solution of (S)-tert-butyl 4,5-diamino-5-oxopentanoate hydrochloride (7.61 g, 31.9 mmol) in DMF (50 mL) was added DIEA (11.1 mL, 63.7 mmol) and methyl 3-bromo-6-(bromomethyl)-2-phenoxybenzoate (8.5 g, 21.3 mmol) under a nitrogen atmosphere. The resulting mixture was stirred at 90 °C for 12 h. The reaction was quenched by the addition of cold water (100 mL). The reaction mixture was extracted with ethyl acetate (3 x 100 mL). The combined organic layers were washed with brine (100 mL), dried (Na2SO4), filtered, and concentrated. The crude product was purified by flash chromatography (SiO2, 70% EtOAc / petroleum ether) to give tert-butyl 5-amino-4-(6-bromo-1-oxo-7-phenoxyisoindolin-2-yl)-5-oxopentanoate (4.0 g, 27% yield) as a light brown solid. The enantiomeric excess of this material and subsequent intermediates was not determined. LCMS (Method M): Retention time 1.41 min, [M+Na] + 511.0, 513.0

[0350] Intermediate 62E: tert-butyl 5-amino-5-oxo-4-(1-oxo-7-phenoxy-6-vinylisoindolin-2-yl)pentanoate [ka] To a solution of tert-butyl 5-amino-4-(6-bromo-1-oxo-7-phenoxyisoindolin-2-yl)-5-oxopentanoate (4.0 g, 8.17 mmol) in 1,4-dioxane (50 mL) was added tributyl(vinyl)tin (3.89 g, 12.26 mmol) and PdCl(dppf) (0.598 g, 0.817 mmol) under a nitrogen atmosphere. The resulting mixture was purged with nitrogen for 10 minutes and stirred at 100 °C for 12 hours. The reaction mixture was then filtered through Celite and rinsed with EtOAc (100 mL). The filtrate was concentrated and the crude product was purified by flash chromatography (SiO, 70% EtOAc / petroleum ether) to give tert-butyl 5-amino-5-oxo-4-(1-oxo-7-phenoxy-6-vinylisoindolin-2-yl)pentanoate (3.0 g, 61% yield) as a light brown solid. LCMS (Method N): Retention time 1.48 min, [M+H] + 437.2

[0351] Intermediate 62F: tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-phenoxyisoindolin-2-yl)-5-oxopentanoate [ka] A cooled (-78 °C) solution of tert-butyl 5-amino-5-oxo-4-(1-oxo-7-phenoxy-6-vinylisoindolin-2-yl)pentanoate (3 g, 6.87 mmol) in DCM (20 mL) and tert-butanol (2 mL) was purged with ozone for 40 minutes with stirring. The reaction was quenched by the addition of dimethyl sulfide (0.508 mL, 6.87 mmol) at the same temperature. The resulting mixture was heated to room temperature and distilled to give tert-butyl 5-amino-4-(6-formyl-1-oxo-7-phenoxyisoindolin-2-yl)-5-oxopentanoate.

[0352] To a cooled (0 °C) solution of tert-butyl 5-amino-4-(6-formyl-1-oxo-7-phenoxyisoindolin-2-yl)-5-oxopentanoate (5.0 g, 5.93 mmol) in THF (60 mL) was added sodium triacetoxyborohydride (2.51 g, 11.9 mmol). The resulting mixture was stirred at room temperature for 12 h. The reaction was quenched by the addition of cold water (50 mL). The reaction mixture was extracted with EtOAc (3 x 100 mL). The combined organic layers were washed with brine (100 mL), dried (NaSO), filtered, and concentrated. The crude product was purified by reverse-phase chromatography (80 g RediSep Silver column, 40% acetonitrile / water (containing 0.1% ammonium formate)). The fractions were dried by lyophilization to give tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-phenoxyisoindolin-2-yl)-5-oxopentanoate (1.2 g, 44% yield) as an off-white solid. LCMS (Method M): Retention time 1.07 min, [M+H] + 441.2

[0353] Intermediate 62G: 3-(6-(hydroxymethyl)-1-oxo-7-phenoxyisoindolin-2-yl)piperidine-2,6-dione [ka] To a solution of tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-phenoxyisoindolin-2-yl)-5-oxopentanoate (1.1 g, 2.50 mmol) in 1,4-dioxane (10 mL) was added methanesulfonic acid (0.480 g, 4.99 mmol) under a nitrogen atmosphere. The resulting mixture was stirred at 85 °C for 4 hours. The reaction mixture was concentrated, and the crude product was purified by reverse-phase chromatography (column: 40 g RediSep Gold, 40% acetonitrile / water (containing 0.1% TFA)). The fractions were dried by lyophilization to give 3-(6-(hydroxymethyl)-1-oxo-7-phenoxyisoindolin-2-yl)piperidine-2,6-dione (0.2 g, 16% yield) as a light yellow solid. LCMS (Method N): Retention time 0.93 min, [M+H] + 367.2

[0354] Example 62: To a solution of 3-(6-(hydroxymethyl)-1-oxo-7-phenoxyisoindolin-2-yl)piperidine-2,6-dione (80 mg, 0.159 mmol) in THF (5 mL) was added potassium carbonate (66.1 mg, 0.478 mmol). The resulting mixture was stirred for 10 minutes, and then 4-nitrophenyl (4-(phenoxy)phenyl)carbamate (123 mg, 0.319 mmol) in THF (5 mL) was added dropwise over 15 minutes. The reaction mixture was stirred at room temperature for 12 hours. The mixture was then concentrated and purified by reverse-phase chromatography (80 g RediSep column, 75% acetonitrile / water (containing 0.1% TFA)). The product-containing fractions were combined and lyophilized to dryness to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (35 mg, 32% yield). LCMS (Method K): Retention time 2.94 min, [M+H] + 578.2; 1H NMR(400 MHz, DMSO-d6):δ 10.95(s, 1H), 9.73(s, 1H), 7.84(d, J=7.6 Hz, 1H), 7.57(d, J=7.6 Hz, 1H), 7.41(d, J=8.6 Hz, 2H), 7.29-7.25(m, 2H), 7.09(t, J=7.2 Hz, 1H), 6.98-6.92(m, 5H), 6.79(d, J=0.8 Hz, 2H), 4.95(dd, J=4.8, 13.2 Hz, 1H), 4.48(d, J=17.6 Hz, 1H), 4.48(d, J=17.6 Hz, 1H), 2.83-2.67(m, 1H), 2.51-2.50(m, 1H), 2.36-2.30(m, 1H), 1.96-1.93(m, 1H)

[0355] Example 63 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] To a solution of 3-(6-(hydroxymethyl)-1-oxo-7-phenoxyisoindolin-2-yl)piperidine-2,6-dione (80 mg, 0.159 mmol) in THF (5 mL) was added potassium carbonate (66.1 mg, 0.478 mmol). The resulting mixture was stirred for 10 minutes, and then 4-nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate (123 mg, 0.319 mmol) in THF (5 mL) was added dropwise over 15 minutes. The reaction mixture was stirred at room temperature for 12 hours. The mixture was then concentrated and purified by reverse-phase chromatography (80 g RediSep column, 75% acetonitrile / water (containing 0.1% TFA)). The product was further purified by preparative HPLC (Column: SunFire C8, 19 mm x 250 mm, particle size: 5 μm; Mobile phase A: water, Mobile phase B: acetonitrile; Temperature: 25 °C; Eluent: 95% B (0.0-13.0 min); Flow rate: 15 mL / min). The product-containing fractions were combined and lyophilized to dryness to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (36 mg, 31% yield) as an off-white solid. LCMS (Method K): Retention time 3.16 min, [M+H] + 614.2; 1 H NMR(400 MHz, DMSO-d6):δ 10.96(s, 1H), 9.76(s, 1H), 7.85(d, J=7.6 Hz, 1H), 7.57(d, J=7.6 Hz, 1H), 7.47-7.40(m, 3H), 7.29-7.25(m, 2H), 7.10(m, 1H), 7.02-6.99(m, 3H), 6.80-6.78(m, 3H), 5.13(s, 2H), 4.95(dd, J=5.2, 13.4 Hz, 1H), 4.49(d, J=17.6 Hz, 1H), 4.36(d, J=17.6 Hz, 1H), 2.87-2.79(m, 1H), 2.59-2.50(m, 1H), 2.50-2.32(m, 1H), 1.98-1.93(m, 1H)

[0356] Example 64 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate [ka] A mixture of 3-(6-(hydroxymethyl)-1-oxo-7-phenoxyisoindolin-2-yl)piperidine-2,6-dione (30 mg, 0.082 mmol), 4-(3-fluorophenoxy)benzoic acid (15.95 mg, 0.069 mmol), diphenylphosphoryl azide (25.8 mg, 0.094 mmol), and DIEA (0.027 mL, 0.156 mmol) in 1,4-dioxane (1 mL) was heated at 105 °C for 15 h. The reaction mixture was cooled to room temperature and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) (10 mM ammonium acetate), mobile phase B: acetonitrile / water (95:5) (10 mM ammonium acetate); temperature: 25 °C; gradient: 41–71% B (0.0–20.0 min), 71–100% B (20.0–20.1 min), 100% B (20.1–24.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (22 mg, 57% yield). LCMS (Method C): Retention time 2.07 min, [M+H] + 596.1; 1H NMR(500 MHz, DMSO-d6) δ 9.75(br s, 1H), 7.84(d, J=7.9 Hz, 1H), 7.57(br d, J=7.7 Hz, 1H), 7.45(br d, J=7.6 Hz, 2H), 7.37(q, J=7.9 Hz, 1H), 7.30-7.22(m, 2H), 7.07-6.96(m, 3H), 6.92-6.83(m, 1H), 6.80-6.68(m, 4H), 5.12(s, 2H), 4.93(dd, J=13.3, 5.0 Hz, 1H), 4.58-4.29(m, 2H), 2.84-2.74(m, 1H), 2.59(br d, J=1.8 Hz, 1H), 2.39-2.26(m, 1H), 2.01-1.92(m, 1H)

[0357] Examples 65-66 The compounds in Table 5 were prepared following the general method described for Example 64, substituting the appropriate acid for 4-(3-fluorophenoxy)benzoic acid: [ka] [Table 10]

[0358] Example 67 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate [ka] Phosgene (15% in toluene, 64.8 mg, 0.098 mmol) was added to 3-(6-(hydroxymethyl)-1-oxo-7-phenoxyisoindolin-2-yl)piperidine-2,6-dione (30 mg, 0.082 mmol) in THF (1 mL) and DCM (1 mL). The resulting mixture was stirred at room temperature for 1 hour and then concentrated in vacuo. The residue was dissolved in THF (1 mL), and then 4-(2,4-difluorophenoxy)aniline (18.1 mg, 0.082 mmol) was added, followed by TEA (0.029 mL, 0.205 mmol). The reaction mixture was stirred at room temperature for 1 h and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) (10 mM ammonium acetate), mobile phase B: acetonitrile / water (95:5) (10 mM ammonium acetate); temperature: 25 °C; gradient: 50–80% B (0.0–20.0 min), 80–100% B (20.0–20.1 min), 100% B (20.1–24.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (2.5 mg, 5% yield). LCMS (Method D): Retention time 2.02 min, [M+H] + 614.1; 1H NMR(500 MHz, DMSO-d6) δ 9.69(br s, 1H), 7.82(d, J=7.8 Hz, 1H), 7.56(d, J=7.8 Hz, 1H), 7.45-7.33(m, 3H), 7.26(t, J=8.0 Hz, 2H), 7.21-7.14(m, 1H), 7.10-7.03(m, 1H), 7.01-6.96(m, 1H), 6.90(d, J=9.0 Hz, 2H), 6.77(d, J=7.9 Hz, 2H), 5.10(s, 2H), 4.92(dd, J=13.3, 5.1 Hz, 1H), 4.54-4.29(m, 2H), 2.86-2.75(m, 1H), 2.65-2.55(m, 1H), 2.38-2.24(m, 1H), 2.01-1.91(m, 1H)

[0359] Examples 68 to 70 The compounds in Table 6 were prepared following the general method described for Example 67, substituting the appropriate aniline for 4-(2,4-difluorophenoxy)aniline: [ka] [Table 11]

[0360] Examples 71 to 92 The compounds in Table 7 were prepared following the general method described for Example 1, substituting the appropriate acid (either commercially available, synthesized as described for intermediates I-1, I-2, I-3, I-4, I-5, or I-6, or synthesized in a similar manner) for 4-(3,4-difluorophenoxy)benzoic acid: [ka] [Table 12] [Table 13] [Table 14]

[0361] Examples 93 to 112 The compounds in Table 8 were prepared following the general method described for Example 37, substituting the appropriate aniline for 4-(4-fluorophenoxy)-2-methoxyaniline: [ka] [Table 15] [Table 16] [Table 17]

[0362] Intermediate I-8 4-(Naphthalen-1-yloxy)aniline [ka] Intermediate I-8A: 1-(4-nitrophenoxy)naphthalene [ka] To a 20 mL vial containing a well-stirred solution of naphthalen-1-ol (1.0 g, 6.94 mmol) and 1-fluoro-4-nitrobenzene (1.077 g, 7.63 mmol) in N,N-dimethylformamide (10 mL) was added cesium carbonate (5.65 g, 17.34 mmol) under nitrogen. The reaction mixture was stirred at 120 °C for 12 h. The reaction mixture was filtered through Celite and rinsed with EtOAc (300 mL). The combined filtrate was concentrated under reduced pressure. The resulting residue was partitioned between water (50 mL) and EtOAc. The aqueous layer was extracted with EtOAc (2 × 100 mL). The combined organic layers were dried over NaSO, filtered, and concentrated. The resulting residue was purified by silica gel column (100-230 mesh) chromatography using petroleum ether / EtOAc to give 1-(4-nitrophenoxy)naphthalene (1.2 g, 65% yield) as a brown solid. LCMS (Method K): Retention time 0.75 min, [M+H] + 265.0

[0363] Intermediate I-8B: To a 100 mL round-bottom flask containing a well-stirred solution of 1-(4-nitrophenoxy)naphthalene (500 mg, 1.885 mmol) in anhydrous DMF (10 mL) was added tetrahydroxydiborane (676 mg, 7.54 mmol) and 4,4'-bipyridine (118 mg, 0.754 mmol) at ambient temperature under nitrogen. The reaction mixture was stirred at ambient temperature for 1 h. The reaction mixture was quenched with ice-water (100 mL), filtered through Celite, and rinsed with EtOAc (200 mL). The combined filtrate was concentrated under reduced pressure and purified by flash chromatography on a silica gel column (230-400 mesh) using 0-100% petroleum ether / EtOAc to give 4-(naphthalen-1-yloxy)aniline (240 mg, 52% yield) as a dark brown liquid. LCMS (Method K): Retention time 2.93 min, [M+H] + 236.0; 1H NMR(400 MHz, DMSO-d6) δ 8.23(dd, J=2.0, 8.2 Hz, 1H), 7.94(dd, J=2.8, 6.8 Hz, 1H), 7.53-7.58(m, 3H), 7.38(t, J=8.0 Hz, 1H), 6.82-6.85(m, 2H), 6.68(dd, J=0.4, 7.6 Hz, 1H), 6.64(d, J=3.6 Hz, 2H), 5.00(s, 2H)

[0364] Example 113 [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(naphthalen-1-yloxy)phenyl]carbamate [ka] A suspension of 3-(6-(hydroxymethyl)-7-methoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (15 mg, 0.049 mmol) in THF (1 mL) was heated to 50° C. and stirred vigorously for 15 minutes to give a cloudy mixture. The mixture was cooled to room temperature and treated with phosgene (20% in toluene; 0.039 mL, 0.074 mmol). After 15 minutes, the reaction mixture was heated to 45° C. and stirred vigorously at the same temperature for 90 minutes. The reaction mixture was concentrated. The resulting residue was suspended in THF (1 mL) and treated with 4-(naphthalen-1-yloxy)aniline (11.60 mg, 0.049 mmol) followed by DIEA (0.019 mL, 0.108 mmol). The reaction mixture was stirred at room temperature for 10 minutes, heated to 45° C., stirred for 15 minutes, and then cooled to room temperature. The reaction mixture was concentrated, dissolved in DMF, treated with acetic acid (0.014 mL, 0.246 mmol), filtered, and purified by preparative HPLC (XBridge C18, 19 mm x 200 mm, 5 μm particle size column; mobile phase A: acetonitrile / water (5:95) containing 0.05% TFA, mobile phase B: acetonitrile / water (95:5) containing 0.05% TFA; temperature: 25 °C; gradient: 35–75% B (0.0–20.0 min), 75–100% B (20.0–20.1 min), 100% B (20.1–24.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(naphthalen-1-yloxy)phenyl]carbamate (7.2 mg, 26% yield). LCMS (Method C): Retention time 2.14 min, [M+H] + 566.2; 1H NMR(500 MHz, DMSO-d6) δ 10.99(s, 1H), 9.74(br s, 1H), 8.13(br d, J=8.0 Hz, 1H), 7.97(br d, J=8.1 Hz, 1H), 7.68(br d, J=7.8 Hz, 2H), 7.61-7.52(m, 2H), 7.49(br d, J=7.7 Hz, 2H), 7.44(br t, J=7.9 Hz, 1H), 7.34(br d, J=7.6 Hz, 1H), 7.05-7.00(m, 2H), 6.87(d, J=7.6 Hz, 1H), 5.22(s, 2H), 5.07(br dd, J=13.2, 5.1 Hz, 1H), 4.47-4.38(m, 1H), 4.35-4.26(m, 1H), 4.04(s, 3H), 2.95-2.85(m, 1H), 2.62(br d, J=17.9 Hz, 1H), 2.45-2.32(m, 1H), 2.08-1.94(m, 1H)

[0365] Intermediate I-9 4-(2,3-ジクロロフェノキシ)-2-フルオロアニリン

change

[0366] Examples 114 to 118 The compounds in Table 9 were prepared following the general method described for Example 113, substituting the appropriate aniline (synthesized as described for intermediates I-8 or I-9, or synthesized in a similar manner) for 4-(naphthalen-1-yloxy)aniline: [ka] [Table 18]

[0367] Example 119 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate [ka] Phosgene (15% in toluene, 71.4 mg, 0.108 mmol) was added to 3-(6-(hydroxymethyl)-7-isopropoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (30 mg, 0.090 mmol) in THF (1 mL) and DCM (1 mL). The resulting mixture was stirred at room temperature for 1 hour and then concentrated in vacuo. The residue was dissolved in THF (1 mL), and then 4-(3,4-difluorophenoxy)-2-fluoroaniline (21.59 mg, 0.090 mmol) was added, followed by TEA (0.031 mL, 0.226 mmol). The reaction mixture was stirred at room temperature for 1 h and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 34–74% B (0.0–20.0 min), 74–100% B (20.0–20.1 min), 100% B (20.1–24.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (4.1 mg, 8% yield). LCMS (Method D): Retention time 2.20 min, [M+H] + 598.2; 1H NMR(500 MHz, DMSO-d6) δ 9.37(br s, 1H), 7.65(br d, J=7.6 Hz, 1H), 7.61-7.52(m, 1H), 7.52-7.38(m, 1H), 7.33-7.17(m, 2H), 7.01(dd, J=11.4, 2.5 Hz, 1H), 6.94-6.79(m, 2H), 5.21(s, 2H), 5.05(br dd, J=13.0, 4.9 Hz, 1H), 4.93(quin, J=6.0 Hz, 1H), 4.50-4.21(m, 2H), 2.97-2.83(m, 1H), 2.65-2.58(m, 1H), 2.41-2.30(m, 1H), 2.09-1.93(m, 1H), 1.24(br dd, J=17.3, 6.0 Hz, 6H)

[0368] Examples 120 to 124 The compounds in Table 10 were prepared following the general method described for Example 119, substituting the appropriate aniline for 4-(3,4-difluorophenoxy)-2-fluoroaniline: [ka] [Table 19]

[0369] Example 125 {2-[(3S)-2,6-dioxopiperidin-3-yl]-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Phosgene (20% in toluene, 446 mg, 0.903 mmol) was added to 3-(6-(hydroxymethyl)-7-isopropoxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione (200 mg, 0.602 mmol) (Intermediate 56E, derived from the (S)-4,5-diamino-5-oxopentanoate tert-butyl skeleton) in THF (6 mL). The resulting mixture was stirred at room temperature for 1 hour and then concentrated in vacuo. The residue was dissolved in THF (6 mL), and then 4-(3,4-difluorophenoxy)aniline (146 mg, 0.662 mmol) was added, followed by DIEA (0.231 mL, 1.324 mmol). The reaction mixture was stirred at room temperature for 1 hour and purified by silica gel flash chromatography to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate as a mixture of (S)-:(R)-enantiomers in a ratio of ∼82:18 (determined by SFC). The material was dissolved in MeOH / DCM (1:1) and subjected to chiral separation by SFC (column: Cellulose-4, 5 x 25 cm, particle size: 5 μm; mobile phase: carbon dioxide / MeOH (40:60); temperature: 35 °C; BPR pressure: 120 bar; flow rate: 250 mL / min). Fractions containing the major peak (Peak 1) were combined and lyophilized to dryness to give {2-[(3S)-2,6-dioxopiperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (160 mg, 45% yield). SFC (Method O): Retention time: 4.31 min (>99% ee); LCMS (Method E): Retention time 1.05 min, [M+H] + 580.1; 1H NMR(400 MHz, methanol-d4) δ 7.69(d, J=7.7 Hz, 1H), 7.46(br d, J=8.7 Hz, 2H), 7.32-7.14(m, 2H), 7.01-6.92(m, 2H), 6.86(ddd, J=11.8, 6.6, 2.9 Hz, 1H), 6.72(dtd, J=9.0, 3.3, 1.8 Hz, 1H), 5.30(s, 2H), 5.12-4.95(m, 2H), 4.54-4.35(m, 2H), 2.96-2.73(m, 2H), 2.47(dd, J=13.0, 4.9 Hz, 1H), 2.15(dtd, J=12.8, 5.3, 2.4 Hz, 1H), 1.32(d, J=6.1 Hz, 6H)

[0370] Examples 126 to 131 The compounds in Table 11 were prepared following the general method described for Example 52, substituting the appropriate alkyl halide for iodoethane in the first step and the appropriate benzoic acid for 4-phenoxybenzoic acid in the last step: [ka] [Table 20]

[0371] Example 132 [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate [ka] Intermediate 132A: 3-(6-(hydroxymethyl)-1-oxo-7-((tetrahydro-2H-pyran-4-yl)oxy)isoindolin-2-yl)piperidine-2,6-dione [ka] Prepared according to the general method described for Example 52, Intermediate 52D, substituting 4-iodotetrahydro-2H-pyran for iodoethane in the first step. LCMS (Method E): Retention time 0.75 min, [M+H] + 375.1; 1 H NMR(400 MHz, methanol-d4) δ 7.72(d, J=7.7 Hz, 1H), 7.28(d, J=7.7 Hz, 1H), 5.09(dd, J=13.3, 5.2 Hz, 1H), 4.82-4.77(m, 1H), 4.74(s, 2H), 4.51-4.34(m, 2H), 3.97(dt, J=11.8, 4.0 Hz, 2H), 3.51-3.39(m, 2H), 2.96-2.86(m, 1H), 2.82-2.71(m, 1H), 2.48(qd, J=13.2, 4.8 Hz, 1H), 2.21-2.10(m, 1H), 2.02(br dd, J=11.4, 1.4 Hz, 2H), 1.85-1.70(m, 2H)

[0372] Example 132: Phosgene (15% in toluene, 19.8 mg, 0.040 mmol) was added to 3-(6-(hydroxymethyl)-1-oxo-7-((tetrahydro-2H-pyran-4-yl)oxy)isoindolin-2-yl)piperidine-2,6-dione (10 mg, 0.027 mmol) in THF (1 mL). The resulting mixture was stirred at room temperature for 1 hour and then concentrated in vacuo. The residue was dissolved in THF (1 mL), and then 4-(3,4-difluorophenoxy)-2-fluoroaniline (7.0 mg, 0.029 mmol) was added, followed by DIEA (10 μL, 0.059 mmol). The reaction mixture was stirred at room temperature for 1 h and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 0.05% TFA, mobile phase B: acetonitrile / water (95:5) containing 0.05% TFA; temperature: 25 °C; gradient: 35–65% B (0.0–20.0 min), 65–100% B (20.0–20.1 min), 100% B (20.1–24.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (4.6 mg, 26% yield). LCMS (Method C): Retention time 2.00 min, [M+H] + 640.1; 1H NMR(500 MHz, DMSO-d6) δ 10.97(s, 1H), 9.54-9.21(m, 1H), 7.66(br d, J=7.4 Hz, 1H), 7.59-7.50(m, 1H), 7.49-7.39(m, 1H), 7.31(d, J=7.6 Hz, 1H), 7.24-7.18(m, 1H), 7.00(dd, J=11.4, 2.6 Hz, 1H), 6.92-6.80(m, 2H), 5.21(s, 2H), 5.07(dd, J=13.3, 5.0 Hz, 1H), 4.84-4.72(m, 1H), 4.47-4.36(m, 1H), 4.34-4.22(m, 1H), 3.89-3.80(m, 2H), 3.36-3.25(m, 2H), 2.93-2.80(m, 1H), 2.61(br d, J=17.4 Hz, 1H), 2.36(qd, J=13.2, 4.7 Hz, 1H), 2.04-1.84(m, 3H), 1.76-1.58(m, 2H)

[0373] Examples 133 to 136 The compounds in Table 12 were prepared following the general method described for Example 132, substituting the appropriate aniline for 4-(3,4-difluorophenoxy)-2-fluoroaniline: [ka] [Table 21]

[0374] Example 137 [4-(Cyclohexyloxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 137A: Ethyl 3-bromo-2-(cyclohexyloxy)-6-methylbenzoate [ka] To a cooled (0 °C) solution of ethyl 3-bromo-2-hydroxy-6-methylbenzoate (10 g, 38.6 mmol), cyclohexanol (5.80 g, 57.9 mmol), and triphenylphosphine (20.25 g, 77 mmol) in THF (20 mL) was added diisopropyl azodicarboxylate (22.5 mL, 116 mmol) dropwise. The resulting mixture was stirred at 25 °C for 16 h and concentrated. The crude material was purified by flash chromatography (SiO, 0–10% ethyl acetate / petroleum ether) to give ethyl 3-bromo-2-(cyclohexyloxy)-6-methylbenzoate (11 g, 84% yield). 1 H NMR(400 MHz, DMSO-d6) δ 7.58(d, J=8.3 Hz, 1 H), 6.96(dd, J=8.2, 0.7 Hz, 1 H), 4.31(q, J=7.1 Hz, 2 H), 4.11(tt, J=9.7, 3.9 Hz, 1 H), 2.19(s, 3H), 1.92-1.80(m, 2H), 1.71(m, 2H), 1.55-1.38(m, 3H), 1.30(t, 3H), 1.26-1.14(m, 3H)

[0375] Intermediate 137B: tert-butyl 5-amino-4-(6-bromo-7-(cyclohexyloxy)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] To a solution of ethyl 3-bromo-2-(cyclohexyloxy)-6-methylbenzoate (4 g, 11.72 mmol) and ozone (7.21 g, 11.72 mmol) in DCM (500 mL) and water (8.45 mL, 469 mmol) was added KBr (1.395 g, 11.72 mmol). The resulting mixture was stirred at 25 °C for 16 h under LED illumination. The reaction was quenched with water and then extracted with DCM (2 x 50 mL). The combined organic layers were washed with brine, dried (NaSO), filtered, and concentrated to give crude ethyl 3-bromo-6-(bromomethyl)-2-(cyclohexyloxy)benzoate (4.5 g).

[0376] To a solution of ethyl 3-bromo-6-(bromomethyl)-2-(cyclohexyloxy)benzoate (4.5 g) in DMF (10 mL) was added DIEA (5.6 mL, 32.1 mmol) and tert-butyl (S)-4,5-diamino-5-oxopentanoate (3.25 g, 16.07 mmol). The resulting mixture was stirred at 90 °C for 4 h. The reaction was quenched with water and extracted with ethyl acetate (2x). The combined organic layers were washed with brine, dried (Na2SO4), filtered, and concentrated. The crude material was purified by flash chromatography (SiO2, 5–100% ethyl acetate / petroleum ether) to give tert-butyl 5-amino-4-(6-bromo-7-(cyclohexyloxy)-1-oxoisoindolin-2-yl)-5-oxopentanoate (4.4 g, 68% yield over two steps). The enantiomeric excess of this material and subsequent intermediates has not been determined. LCMS (Method L): Retention time 1.32 min, [M+H] + 497.2

[0377] Intermediate 137C: tert-butyl 5-amino-4-(7-(cyclohexyloxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] A solution of tert-butyl 5-amino-4-(6-bromo-7-(cyclohexyloxy)-1-oxoisoindolin-2-yl)-5-oxopentanoate (4.4 g, 8.88 mmol) and 1-(tributylstannyl)methanol (5.70 g, 17.76 mmol) in 1,4-dioxane (20 mL) was purged with nitrogen for 5 minutes. Tetrakis(triphenylphosphine)palladium (0.888 mg, 8.88 mmol) was added, and the resulting mixture was stirred at 90 °C for 16 hours. The reaction was quenched with water. The reaction mixture was extracted with ethyl acetate (2x). The combined organic layers were washed with brine, dried (Na2SO4), filtered, and concentrated. The crude material was purified by flash chromatography (SiO, 5-100% ethyl acetate / petroleum ether) to give tert-butyl 5-amino-4-(7-(cyclohexyloxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (2.4 g, 4.92 mmol, 55% yield). LCMS (Method K): Retention time 2.45 min, [M+H] + 447.2

[0378] Intermediate 137D: tert-butyl 5-amino-4-(7-(cyclohexyloxy)-6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] To a solution of tert-butyl 5-amino-4-(7-(cyclohexyloxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (250 mg, 0.560 mmol) in DMF (1 mL) was added DIEA (0.293 mL, 1.680 mmol), followed by 4-nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate (433 mg, 1.120 mmol) in DMF (1 mL). The resulting mixture was stirred at 25 °C for 3 h. The reaction was quenched with water. The reaction mixture was extracted with ethyl acetate (2x). The combined organic layers were washed with brine, dried (Na2SO4), filtered, and concentrated. The crude material was purified by flash chromatography (SiO, 5-100% ethyl acetate / petroleum ether) to give tert-butyl 5-amino-4-(7-(cyclohexyloxy)-6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (300 mg, 61% yield). LCMS (Method M): Retention time 1.83 min, [M+H] + 694.2

[0379] Example 137: To a solution of tert-butyl 5-amino-4-(7-(cyclohexyloxy)-6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (200 mg, 0.288 mmol) in 1,4-dioxane (0.5 mL) was added methanesulfonic acid (0.112 mL, 1.730 mmol). The resulting mixture was stirred at 70° C. for 1 hour. The reaction mixture was then filtered and concentrated. The crude material was purified by preparative HPLC (Column: XBridge C18, 19 mm x 250 mm, particle size: 5 μm; Mobile phase A: 5 mM ammonium formate, Mobile phase B: acetonitrile; Temperature: 25 °C; Gradient: 60-90% B (0.0-7.0 min), 90% B (7.0-10.0 min); Flow rate: 15 mL / min). Product-containing fractions were combined and concentrated to give (4-(cyclohexyloxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxoisoindolin-5-yl)methyl (4-(3,4-difluorophenoxy)phenyl)carbamate (40 mg, 21% yield). LCMS (Method P): Retention time 2.71 min, [MH]- 618.2; 1H NMR(400 MHz, DMSO-d6) δ 10.97(br s, 1H), 9.76(br s, 1H), 7.65(d, J=7.8 Hz, 1H), 7.47-7.53(m, 2H), 7.37-7.46(m, 1H), 7.29(d, J=7.8 Hz, 1H), 7.09(ddd, J=12.0, 6.8, 3.0 Hz, 1H), 7.02(d, J=9.1 Hz, 2H), 6.77(dtd, J=9.0, 3.3, 3.3, 1.8 Hz, 1H), 5.17-5.28(m, 2H), 5.10(dd, J=13.3, 5.1 Hz, 1H), 4.57-4.67(m, 1H), 4.40-4.44(m, 1H), 4.25-4.46(m, 1H), 2.82-2.96(m, 1H), 2.57-2.69(m, 1H), 2.31-2.41(m, 1H), 1.91-2.06(m, 3H), 1.65-1.78(m, 2H), 1.40-1.55(m, 3H), 1.13-1.27(m, 3H)

[0380] Examples 138 to 140 The compounds in Table 13 were prepared following the general method described for Example 137, substituting the appropriate alcohol for cyclohexanol in the first step, and the appropriate 4-nitrophenyl carbamate (prepared in a similar manner as intermediate I-7) for 4-nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate in the penultimate step: [ka] [Table 22]

[0381] Example 141 [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 141A: (R)-3-bromo-6-methyl-2-((tetrahydro-2H-pyran-3-yl)oxy)benzoate methyl [ka] To a cooled (0 °C) mixture of methyl 3-bromo-2-hydroxy-6-methylbenzoate (2.44 g, 9.96 mmol) and (S)-tetrahydro-2H-pyran-3-ol (1.02 g, 9.96 mmol) in THF (30 mL) was added diethyl azodicarboxylate (40% in toluene, 4.7 mL, 12.0 mmol). The resulting mixture was stirred at room temperature for 2 h. The reaction mixture was diluted with ethyl acetate, washed with water and brine, dried (MgSO4), and concentrated. The residue was purified by silica gel column chromatography (eluting solvent: 0-10% ethyl acetate / hexane) to give methyl (R)-3-bromo-6-methyl-2-((tetrahydro-2H-pyran-3-yl)oxy)benzoate (900 mg, 27% yield). LCMS (Method E): Retention time 1.03 min, [M+H] + 329.0; 1 H NMR(400 MHz, chloroform-d) δ 7.47(d, J=8.2 Hz, 1H), 6.84(dd, J=8.2, 0.7 Hz, 1H), 4.43-4.20(m, 1H), 3.96(dd, J=3.7, 1.7 Hz, 1H), 3.93(s, 3H), 3.74(dt, J=11.1, 4.5 Hz, 1H), 3.56-3.41(m, 2H), 2.26(s, 3H), 2.14-2.01(m, 1H), 1.92-1.76(m, 2H), 1.59-1.53(m, 1H)

[0382] Intermediate 141B: (R)-3-bromo-6-(bromomethyl)-2-((tetrahydro-2H-pyran-3-yl)oxy)benzoate methyl [ka] To a mixture of (R)-3-bromo-6-methyl-2-((tetrahydro-2H-pyran-3-yl)oxy)methyl benzoate (450 mg, 1.37 mmol), potassium bromide (211 mg, 1.78 mmol), and ozone (1.09 g, 1.78 mmol) in DCM (4 mL) was added water (1.0 mL). The resulting mixture was stirred in a sealed tube under irradiation with an LED light at a distance of 5 cm for 2 h. The reaction was quenched with aqueous Na2SO3. The reaction mixture was diluted with ethyl acetate, washed with water and brine, dried (MgSO4), and concentrated. The residue was purified by silica gel column chromatography (eluting solvent: 0–10% ethyl acetate / hexane) to give (R)-3-bromo-6-(bromomethyl)-2-((tetrahydro-2H-pyran-3-yl)oxy)methyl benzoate (400 mg, 72% yield). LCMS (Method E): Retention time 1.05 min, [M+H] + 408.8; 1 H NMR(400 MHz, chloroform-d) δ 7.56(d, J=8.3 Hz, 1H), 7.04(d, J=8.3 Hz, 1H), 4.55-4.31(m, 2H), 4.27-4.16(m, 1H), 3.95(s, 3H), 3.91-3.85(m, 1H), 3.74-3.64(m, 1H), 3.55-3.39(m, 2H), 2.11-1.95(m, 1H), 1.87-1.72(m, 2H), 1.62-1.47(m, 1H)

[0383] Intermediate 141C: 3-(6-bromo-1-oxo-7-(((R)-tetrahydro-2H-pyran-3-yl)oxy)isoindolin-2-yl)piperidine-2,6-dione [ka] A mixture of (R)-3-bromo-6-(bromomethyl)-2-((tetrahydro-2H-pyran-3-yl)oxy)ethyl benzoate (400 mg, 0.948 mmol), 3-aminopiperidine-2,6-dione HCl salt (234 mg, 1.42 mmol), and DIEA (0.497 mL, 2.84 mmol) in acetonitrile (2 mL) was stirred at 70 °C for 15 h. The reaction mixture was cooled to room temperature and concentrated. The residue was purified by silica gel column chromatography (eluent: 0-10% MeOH / DCM) to give 3-(6-bromo-1-oxo-7-(((R)-tetrahydro-2H-pyran-3-yl)oxy)isoindolin-2-yl)piperidine-2,6-dione (350 mg, 84% yield). LCMS (Method E): Retention time 0.87 min, [M+H] + 423.9; 1 H NMR(400 MHz, methanol-d4) δ 7.82(d, J=8.0 Hz, 1H), 7.21(d, J=8.0 Hz, 1H), 5.08(dd, J=13.3, 4.9 Hz, 1H), 4.64(dt, J=7.7, 3.9 Hz, 1H), 4.51-4.30(m, 2H), 4.10(q, J=7.1 Hz, 1H), 4.00-3.89(m, 1H), 3.82-3.68(m, 2H), 3.63-3.51(m, 1H), 3.00-2.85(m, 1H), 2.83-2.72(m, 1H), 2.47(ddd, J=13.0, 4.7, 2.0 Hz, 1H), 2.23-2.06(m, 2H), 1.92-1.84(m, 1H), 1.61-1.51(m, 1H)

[0384] Intermediate 141D: 3-(6-(hydroxymethyl)-1-oxo-7-(((R)-tetrahydro-2H-pyran-3-yl)oxy)isoindolin-2-yl)piperidine-2,6-dione [ka] A mixture of 3-(6-bromo-1-oxo-7-(((R)-tetrahydro-2H-pyran-3-yl)oxy)isoindolin-2-yl)piperidine-2,6-dione (280 mg, 0.662 mmol), (tributylstannyl)methanol (255 mg, 0.794 mmol), and Pd(PPh3)4 (76 mg, 0.066 mmol) in 1,4-dioxane (4 mL) was stirred at 100 °C under nitrogen in a sealed tube for 15 h. The reaction mixture was cooled to room temperature and purified by silica gel column chromatography (eluent: 0-10% MeOH / DCM) to give 3-(6-(hydroxymethyl)-1-oxo-7-(((R)-tetrahydro-2H-pyran-3-yl)oxy)isoindolin-2-yl)piperidine-2,6-dione (190 mg, 77% yield). LCMS (Method E): Retention time 0.70 min, [M+H] + 375.0; 1 H NMR(400 MHz, methanol-d4) δ 7.70(d, J=7.7 Hz, 1H), 7.28(d, J=7.7 Hz, 1H), 5.08(dd, J=13.3, 5.2 Hz, 1H), 4.82-4.77(m, 1H), 4.74-4.65(m, 1H), 4.48-4.37(m, 2H), 3.86-3.57(m, 4H), 2.98-2.71(m, 2H), 2.55-2.37(m, 1H), 2.22-2.11(m, 1H), 2.01(m, 4H), 1.61-1.47(m, 1H)

[0385] Example 141: Phosgene (20% in toluene, 49.5 mg, 0.100 mmol) was added to 3-(6-(hydroxymethyl)-1-oxo-7-(((R)-tetrahydro-2H-pyran-3-yl)oxy)isoindolin-2-yl)piperidine-2,6-dione (25 mg, 0.067 mmol) in THF (1 mL). The resulting mixture was stirred at room temperature for 1 hour and then concentrated in vacuo. The residue was dissolved in THF (1 mL), and then 4-(3,4-difluorophenoxy)aniline (16.3 mg, 0.073 mmol) was added, followed by DIEA (0.026 mL, 0.147 mmol). The reaction mixture was stirred at room temperature for 1 h and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 42–62% B (0.0–30.0 min), 62–100% B (30.0–30.1 min), 100% B (30.1–34.0 min); flow rate: 20 mL / min). The product-containing fractions were combined, dried on a centrifugal evaporator, and purified to give [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl methyl ester. N-[4-(3,4-difluorophenoxy)phenyl]carbamate (25.8 mg, 61% yield) was obtained. LCMS (Method C): Retention time 2.08 min, [M+H] + 622.3; 1H NMR(500 MHz, DMSO-d6) δ 10.98(s, 1H), 9.77(br s, 1H), 7.66(d, J=7.8 Hz, 1H), 7.49(br d, J=8.6 Hz, 2H), 7.44-7.35(m, 1H), 7.32(d, J=7.7 Hz, 1H), 7.08(ddd, J=11.9, 6.8, 2.9 Hz, 1H), 7.01(d, J=8.9 Hz, 2H), 6.88-6.60(m, 1H), 5.50-5.21(m, 2H), 5.13-5.02(m, 1H), 4.78-4.58(m, 1H), 4.49-4.28(m, 2H), 3.82-3.66(m, 1H), 3.64-3.30(m, 2H), 2.93-2.79(m, 1H), 2.69-2.58(m, 2H), 2.44-2.27(m, 1H), 2.09-1.70(m, 4H), 1.52-1.32(m, 1H)

[0386] Examples 142 to 150 The compounds in Table 14 were prepared following the general method described for Example 141, substituting the appropriate aniline for 4-(3,4-difluorophenoxy)aniline: [ka] [Table 23]

[0387] Example 151 [4-(Cyclopentyloxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 151A: 3-(7-(cyclopentyloxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)piperidine-2,6-dione [ka] Prepared according to the general method described for Example 141, Intermediate 141D, substituting cyclopentanol for (S)-tetrahydro-2H-pyran-3-ol in the first step. LCMS (Method E): Retention time 0.75 min, [M+H] + 359.0; 1 H NMR(400 MHz, methanol-d4) δ 7.70(d, J=7.7 Hz, 1H), 7.24(d, J=7.7 Hz, 1H), 5.35(tt, J=5.1, 2.5 Hz, 1H), 5.08(dd, J=13.3, 5.1 Hz, 1H), 4.70(s, 2H), 4.48-4.30(m, 2H), 2.97-2.71(m, 2H), 2.47(qd, J=13.2, 4.8 Hz, 1H), 2.20-2.11(m, 1H), 1.96-1.81(m, 4H), 1.79-1.68(m, 2H), 1.68-1.55(m, 2H)

[0388] Example 151: A mixture of 3-(7-(cyclopentyloxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)piperidine-2,6-dione (20 mg, 0.056 mmol), 4-(3,4-difluorophenoxy)benzoic acid (15.4 mg, 0.061 mmol), DIEA (0.013 mL, 0.073 mmol), and diphenylphosphoryl azide (18.4 mg, 0.067 mmol) in 1,4-dioxane (1 mL) was heated at 105 °C for 15 h. The reaction mixture was cooled to room temperature and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 42–62% B (0.0–30.0 min), 62–100% B (30.0–30.1 min), 100% B (30.1–34.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [4-(cyclopentyloxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (11.2 mg, 33% yield). LCMS (Method C): Retention time 2.27 min, [M+H] + 606.0; 1H NMR(500 MHz, DMSO-d6) δ 9.75(br s, 1H), 7.65(d, J=7.7 Hz, 1H), 7.48(br d, J=8.4 Hz, 2H), 7.42-7.33(m, 1H), 7.29(d, J=7.7 Hz, 1H), 7.17-7.05(m, 1H), 7.00(s, 1H), 6.82-6.66(m, 1H), 5.40(br s, 1H), 5.17(s, 2H), 5.04(dd, J=13.2, 5.0 Hz, 1H), 4.46-4.20(m, 2H), 2.98-2.80(m, 1H), 2.69-2.59(m, 1H), 2.42-2.29(m, 1H), 2.07-1.95(m, 1H), 1.88-1.46(m, 8H)

[0389] Example 152 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3S)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Prepared according to the general method described for Example 151, substituting (R)-tetrahydrofuran-3-ol for cyclopentanol in the first step. LCMS (Method C): Retention time 2.02 min, [M+H] + 608.2; 1H NMR(500 MHz, DMSO-d6) δ 10.99(s, 1H), 9.77(br s, 1H), 7.68(d, J=7.7 Hz, 1H), 7.49(br d, J=8.8 Hz, 2H), 7.44-7.39(m, 1H), 7.37-7.30(m, 1H), 7.26-7.18(m, 1H), 7.01(d, J=8.9 Hz, 2H), 6.82-6.70(m, 1H), 5.81-5.50(m, 1H), 5.31-5.15(m, 2H), 5.06(dd, J=13.3, 5.0Hz, 1H), 4.48-4.27(m, 2H), 4.02-3.65(m, 4H), 2.92-2.80(m, 1H), 2.61(br d, J=19.1 Hz, 1H), 2.42-2.27(m, 1H), 2.15-1.93(m, 3H)

[0390] Example 153 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Prepared according to the general method described for Example 151, substituting (S)-tetrahydrofuran-3-ol for cyclopentanol in the first step. LCMS (Method D): Retention time 1.95 min, [M+H] + 608.3; 1 H NMR (500 MHz, DMSO-d6) 1H NMR(500 MHz, DMSO-d6) δ 9.76(br s, 1H), 7.67(d, J=7.8 Hz, 1H), 7.48(br d, J=8.7 Hz, 2H), 7.44-7.35(m, 1H), 7.34(d, J=7.7 Hz, 1H), 7.07(ddd, J=11.9, 6.8, 3.0 Hz, 1H), 7.01(d, J=9.0 Hz, 2H), 6.80-6.73(m, 1H), 5.60-5.51(m, 1H), 5.26-5.12(m, 2H), 5.05(dd, J=13.2, 5.1 Hz, 1H), 4.50-4.39(m, 1H), 4.36-4.27(m, 1H), 4.01-3.63(m, 4H), 2.93-2.81(m, 1H), 2.66-2.57(m, 1H), 2.45-2.31(m, 1H), 2.17-1.94(m, 3H)

[0391] Examples 154 to 158 The compounds in Table 15 were prepared following the general method described for Example 141, substituting (S)-tetrahydro-2H-pyran-3-ol with (S)-tetrahydrofuran-3-ol in the first step and substituting the appropriate aniline for 4-(3,4-difluorophenoxy)aniline in the last step: [ka] [Table 24]

[0392] Example 159 [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 159A: 3-bromo-2-(2-hydroxy-2-methylpropoxy)-6-methylbenzoate ethyl ester [ka] A mixture of ethyl 3-bromo-2-hydroxy-6-methylbenzoate (2.00 g, 7.72 mmol), 2,2-dimethyloxirane (0.612 g, 8.49 mmol), and potassium carbonate (2.67 g, 19.3 mmol) in DMF (10 mL) was stirred at 100 °C for 15 h. The reaction mixture was cooled to room temperature, diluted with ethyl acetate, washed with water and brine, dried (MgSO), and concentrated. The residue was purified by silica gel column chromatography (eluting solvent: 0-20% ethyl acetate / hexane) to give ethyl 3-bromo-2-(2-hydroxy-2-methylpropoxy)-6-methylbenzoate (1.60 g, 63% yield). LCMS (Method E): Retention time 1.02 min, [M+H] + 331.8;333.9; 1 H NMR (400 MHz, chloroform-d) δ 7.47 (d, J = 8.3 Hz, 1H), 6.93-6.80 (m, 1H), 4.49-4.35 (m, 2H), 3.92 (s, 2H), 2.28 (s, 3H), 1.40 (t, J = 7.2 Hz, 3H), 1.32 (s, 6H).

[0393] Example 159: This was prepared according to the general method described for Example 141, substituting ethyl 3-bromo-2-(2-hydroxy-2-methylpropoxy)-6-methylbenzoate (Intermediate 159A) for methyl (R)-3-bromo-6-methyl-2-((tetrahydro-2H-pyran-3-yl)oxy)benzoate (Intermediate 141A) in the second step. LCMS (Method D): Retention time 2.05 min, [M+H] + 610.2; 1H NMR(500 MHz, DMSO-d6) δ 9.75(br s, 1H), 7.65(br d, J=7.7 Hz, 1H), 7.47(br d, J=8.2 Hz, 2H), 7.44-7.38(m, 1H), 7.36-7.28(m, 1H), 7.11-7.05(m, 1H), 7.00(br d, J=8.9 Hz, 2H), 6.76(br d, J=9.1 Hz, 1H), 5.28(s, 2H), 5.05(br dd, J=13.1, 4.6 Hz, 1H), 4.81(s, 1H), 4.50-4.23(m, 2H), 4.16-3.95(m, 2H), 2.91-2.78(m, 1H), 2.64-2.58(m, 1H), 2.45-2.27(m, 1H), 2.00(br dd, J=10.6, 4.9 Hz, 1H), 1.21(s, 6H)

[0394] Examples 160 to 165 The compounds in Table 16 were prepared following the general method described for Example 159, substituting the appropriate aniline for 4-(3,4-difluorophenoxy)aniline: [ka] [Table 25]

[0395] Intermediate I-10 (1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexan-1-ol [ka] To a solution of (1S,4S)-cyclohexane-1,4-diol (500 mg, 4.30 mmol) in DMF (5 mL) was added imidazole (293 mg, 4.30 mmol). The resulting mixture was cooled to 0 °C, and then tert-butyldimethylsilyl chloride (649 mg, 4.30 mmol) was added in portions. The reaction mixture was stirred at 0 °C for 6 h. The reaction mixture was poured into ice-cold water (20 mL) and extracted with EtOAc (2 × 30 mL). The combined organic layers were washed with brine (20 mL), dried (NaSO), filtered, and concentrated. The crude material was purified by flash chromatography (SiO, 25–50% ethyl acetate / petroleum ether) to afford (1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexane-1-ol (410 mg, 41% yield) as a white semisolid. 1 H NMR(DMSO-d6, 400 MHz) δ 4.36(br s, 1H), 3.77-3.73(m, 1H), 3.47(br s, 1H), 1.4-1.7(m, 8H), 0.87(s, 9H), 0.03(s, 6H)

[0396] Intermediate I-11 (1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexan-1-ol [ka] To a solution of (1R,4R)-cyclohexane-1,4-diol (500 mg, 4.30 mmol) in DMF (5 mL) was added imidazole (293 mg, 4.30 mmol). The resulting mixture was cooled to 0 °C, and then tert-butyldimethylsilyl chloride (649 mg, 4.30 mmol) was added in portions. The reaction mixture was stirred at 0 °C for 6 h. The reaction mixture was poured into ice-cold water (20 mL) and extracted with EtOAc (2 × 30 mL). The combined organic layers were washed with brine (20 mL), dried (NaSO), filtered, and concentrated. The crude material was purified by flash chromatography (SiO, 25–50% ethyl acetate / petroleum ether) to afford (1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexane-1-ol (400 mg, 40% yield) as a white semisolid. 1 H NMR(400 MHz, DMSO-d6) δ 4.43(d, J=4.1 Hz, 1H), 3.67-3.51(m, 1H), 3.47-3.35(m, 1H), 1.74(td, J=3.6, 8.9 Hz, 4H), 1.30-1.11(m, 4H), 0.84(s, 9H), 0.02(s, 6H)

[0397] Example 166 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-{[(1R,4R)-4-hydroxycyclohexyl]oxy}-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 166A: ethyl 3-bromo-6-methyl-2-(((trifluoromethyl)sulfonyl)oxy)benzoate [ka] To a solution of ethyl 3-bromo-2-hydroxy-6-methylbenzoate (15 g, 57.9 mmol) in DCM (20 mL) was added DIEA (30.3 mL, 174 mmol). The mixture was cooled to −78° C., and then trifluoromethanesulfonic anhydride (14.7 mL, 87.0 mmol) was added. The reaction mixture was stirred at −78° C. overnight. The mixture was then diluted with dichloromethane, washed with 1 N HCl (100 mL), 10% NaOH (100 mL), dried (MgSO), and concentrated to give ethyl 3-bromo-6-methyl-2-(((trifluoromethyl)sulfonyl)oxy)benzoate (21 g, 93% yield) as a dark yellow liquid. 1 H NMR(400 MHz, DMSO-d6) δ 7.94(d, J=8.3 Hz, 1H), 7.43(dd, J=0.7, 8.3 Hz, 1H), 4.34(q, J=7.1 Hz, 2H), 2.36(s, 3H), 1.31(t, J=7.1 Hz, 3H);19F NMR(400 MHz, DMSO-d6) δ -72.95

[0398] Intermediate 166B: tert-butyl 5-amino-4-(6-bromo-1-oxo-7-(((trifluoromethyl)sulfonyl)oxy)isoindolin-2-yl)-5-oxopentanoate [ka] To a vial containing a colorless mixture of ethyl 3-bromo-6-methyl-2-(((trifluoromethyl)sulfonyl)oxy)benzoate (2.00 g, 5.11 mmol), potassium bromide (0.608 g, 5.11 mmol), and ozone (3.14 g, 5.11 mmol) in DCM (10 mL) was added water (3.68 mL), resulting in a dull orange color. The vial was immediately sealed with a Teflon liner cap, and the reaction mixture was vigorously stirred at room temperature under irradiation with a 23 W CFL lamp. After 18 h, the reaction mixture was quenched with solid sodium sulfite. Water was then added, and the mixture was extracted with DCM (3x). The combined organic layers were dried (Na2SO4), filtered, and concentrated in vacuo. A total of 10 runs were combined to give 23 g of crude ethyl 3-bromo-6-(bromomethyl)-2-(((trifluoromethyl)sulfonyl)oxy)benzoate, which was used in the next step without further purification.

[0399] To a solution of crude ethyl 3-bromo-6-(bromomethyl)-2-(((trifluoromethyl)sulfonyl)oxy)benzoate (23.7 g) in DMF (150 mL) was added tert-butyl (S)-4,5-diamino-5-oxopentanoate (10.20 g, 50.4 mmol) and DIEA (44.0 mL, 252 mmol). The resulting mixture was stirred at 85 °C for 3 h. The reaction mixture was diluted with ice-cold water (100 mL) and EtOAc (100 mL). The layers were then separated and the organic compound was extracted from the aqueous layer with EtOAc (100 mL). The combined organic layers were dried (Na2SO4) and concentrated. The crude material was purified by reverse phase chromatography to give tert-butyl 5-amino-4-(6-bromo-1-oxo-7-(((trifluoromethyl)sulfonyl)oxy)isoindolin-2-yl)-5-oxopentanoate (12.9 g, 45% yield over two steps) as a light brown solid. The enantiomeric excess of this material and subsequent intermediates was not determined. LCMS (Method K): Retention time 2.97 min, [M+Na] + 567.0, 569.0

[0400] Intermediate 166C: tert-butyl 5-amino-4-(6-bromo-7-hydroxy-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] To a solution of 5-amino-4-(6-bromo-1-oxo-7-(((trifluoromethyl)sulfonyl)oxy)isoindolin-2-yl)-5-oxopentanoic acid (1.5 g, 2.75 mmol) in THF (5 mL) was added tetramethylammonium fluoride (0.769 g, 8.25 mmol). The resulting mixture was stirred at room temperature for 16 hours. The reaction mixture was concentrated, and the crude product was purified by reverse-phase chromatography (150 g RediSep C18 column, 30% acetonitrile / 70% 5 mM aqueous ammonium formate, 60 mL / min). The product-containing fractions were combined and concentrated to give tert-butyl 5-amino-4-(6-bromo-7-hydroxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (800 mg, 63% yield) as a pale yellow solid. LCMS (Method Q): Retention time 2.25 minutes, [M+H] + 413.1, 415.1

[0401] Intermediate 166D: tert-butyl 5-amino-4-(6-bromo-7-(((1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] Diisopropyl azodicarboxylate (0.565 mL, 2.90 mmol) was added dropwise to a cooled (0 °C) suspension of tert-butyl 5-amino-4-(6-bromo-7-hydroxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (400 mg, 0.968 mmol), (1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexan-1-ol (268 mg, 1.161 mmol), and triphenylphosphine (508 mg, 1.936 mmol) in THF (15 mL). The resulting mixture was stirred at 25 °C for 16 hours. The reaction mixture was then evaporated to dryness under reduced pressure. The crude material was purified by flash chromatography (SiO, 30-50% ethyl acetate / petroleum ether) to afford tert-butyl 5-amino-4-(6-bromo-7-(((1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-1-oxoisoindolin-2-yl)-5-oxopentanoate (330 mg, 50% yield) as a white solid. LCMS (Method R): Retention time 2.17 min, [M+H] + 625.2, 627.1

[0402] Intermediate 166E: tert-butyl 5-amino-4-(7-(((1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] A solution of tert-butyl 5-amino-4-(6-bromo-7-(((1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-1-oxoisoindolin-2-yl)-5-oxopentanoate (200 mg, 0.320 mmol) and tetrakis(triphenylphosphine)palladium (44.3 mg, 0.038 mmol) in 1,4-dioxane (6 mL) was purged with nitrogen for 5 minutes. 1-(Tributylstannyl)methanol (308 mg, 0.959 mmol) was added, and the resulting mixture was stirred at 100 °C for 16 hours. The reaction mixture was then dried under reduced pressure using an evaporator. The crude material was purified by flash chromatography (SiO2, 50-80% ethyl acetate / petroleum ether) to afford tert-butyl 5-amino-4-(7-(((1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (70 mg, purity determined by HPLC: ∼76%) as a pale yellow solid. LCMS (Method Q): Retention time 3.49 min, [M+H] + 577.2

[0403] Intermediate 166F: tert-butyl 5-amino-4-(7-(((1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] To a solution of tert-butyl 5-amino-4-(7-(((1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (70 mg, HPLC purity: ∼76%) in DMF (1 mL) was added DIEA (0.064 mL, 0.364 mmol). The resulting mixture was stirred at room temperature for 10 minutes, and then a solution of 4-nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate (70.3 mg, 0.182 mmol) in DMF (0.5 mL) was added. The reaction mixture was stirred at room temperature for 3 hours. The mixture was then dried under reduced pressure using an evaporator. The crude material was purified by flash chromatography (SiO, 50-80% ethyl acetate / petroleum ether) to afford tert-butyl 5-amino-4-(7-(((1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate as a pale yellow gum. LCMS (Method K): Retention time 4.59 min, [MH]- 822.2

[0404] Example 166: To a solution of tert-butyl 5-amino-4-(7-(((1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (40 mg, purity determined by HPLC: ∼83%) in 1,4-dioxane (1 mL) was added methanesulfonic acid (0.032 mL, 0.485 mmol). The reaction mixture was stirred at 80 °C for 2 hours. The mixture was then purified by preparative HPLC (XBridge C18, 19 mm x 150 mm, 5 μm particle size; mobile phase A: water (containing 5 mM ammonium formate), mobile phase B: acetonitrile; temperature: 25 °C; gradient: 20-60% B (0.0-15.0 min); flow rate: 15 mL / min). The product-containing fractions were combined and lyophilized to dryness to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-{[(1R,4R)-4-hydroxycyclohexyl]oxy}-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (2.0 mg, 6% yield) as an off-white solid. LCMS (Method K): retention time 2.72 min, [MH]- 634.2; 1H NMR(400 MHz, DMSO-d6) δ 10.98(s, 1H), 9.77(s, 1H), 7.66(d, J=7.6 Hz, 1H), 7.50(d, J=9.2 Hz, 2H), 7.38-7.46(m, 1H), 7.30(d, J=7.6 Hz, 1H), 7.10-7.13(m, 1H), 7.03(dd, J=2.0, 6.8 Hz, 2H), 6.77-6.80(m, 1H), 5.22(s, 2H), 5.12(dd, J=5.2, 13.4 Hz, 1H), 4.61(m, 1H), 4.50(d, J=4.4Hz, 1H), 4.43(d, J=17.6 Hz, 1H), 4.30(d, J=17.6 Hz, 1H), 3.46-3.47(m, 1H), 2.86-2.89(m, 1H), 2.59-2.63(m, 1H), 2.36-2.41(m, 1H), 1.99-2.03(m, 3H), 1.82-1.79(m, 1H), 1.47-1.54(m, 2H), 1.43-1.48(m, 2H), 1.24(s, 1H)

[0405] Example 167 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-{[(1S,4S)-4-hydroxycyclohexyl]oxy}-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 167A: tert-butyl 5-amino-4-(6-bromo-7-(((1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] Diisopropyl azodicarboxylate (0.847 mL, 4.36 mmol) was added dropwise to a cooled (0 °C) suspension of tert-butyl 5-amino-4-(6-bromo-7-hydroxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (600 mg, 1.45 mmol), (1R,4R)-4-((tert-butyldimethylsilyl)oxy)cyclohexan-1-ol (401 mg, 1.742 mmol), and triphenylphosphine (762 mg, 2.90 mmol) in THF (15 mL). The resulting mixture was stirred at 25 °C for 16 hours. The reaction mixture was then evaporated to dryness under reduced pressure. The crude material was purified by flash chromatography (SiO2, 30-50% ethyl acetate / petroleum ether) to afford tert-butyl 5-amino-4-(6-bromo-7-(((1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-1-oxoisoindolin-2-yl)-5-oxopentanoate (410 mg, purity determined by HPLC: ∼61%) as a white solid. LCMS (Method Q): Retention time 4.40 min, [M+H] + 625.3, 627.2

[0406] Intermediate 167B: tert-butyl 5-amino-4-(7-(((1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] A solution of tert-butyl 5-amino-4-(6-bromo-7-(((1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-1-oxoisoindolin-2-yl)-5-oxopentanoate (410 mg, 0.655 mmol) and tetrakis(triphenylphosphine)palladium (91 mg, 0.079 mmol) in 1,4-dioxane (6 mL) was purged with nitrogen for 5 minutes. 1-(Tributylstannyl)methanol (631 mg, 1.966 mmol) was added, and the resulting mixture was stirred at 100 °C for 16 hours. The reaction mixture was then dried under reduced pressure using an evaporator. The crude material was purified by flash chromatography (SiO2, 50-80% ethyl acetate / petroleum ether) to afford tert-butyl 5-amino-4-(7-(((1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (200 mg, purity determined by HPLC: ∼65%) as a pale yellow solid. LCMS (Method K): Retention time 3.90 min, [M+H] + 577.2

[0407] Intermediate 167C: tert-butyl 5-amino-4-(7-(((1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] To a solution of tert-butyl 5-amino-4-(7-(((1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (200 mg, HPLC purity: ∼65%) in DMF (2 mL) was added DIEA (0.182 mL, 1.040 mmol). The resulting mixture was stirred at room temperature for 10 min, and then a solution of 4-nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate (201 mg, 0.520 mmol) in DMF (0.5 mL) was added. The reaction mixture was stirred at room temperature for 3 h. The mixture was then evaporated to dryness under reduced pressure. The crude material was purified by flash chromatography (SiO2, 50–80% ethyl acetate / petroleum ether). The product was further purified by reverse phase chromatography (Column: 30 g RediSep, 100% acetonitrile, 30 mL / min) to give tert-butyl 5-amino-4-(7-(((1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (80 mg, 26% yield) as a pale yellow gum. LCMS (Method R): Retention time 2.56 min, [MH]- 822.4

[0408] Example 167: To a solution of tert-butyl 5-amino-4-(7-(((1S,4S)-4-((tert-butyldimethylsilyl)oxy)cyclohexyl)oxy)-6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (80 mg, 0.097 mmol) in 1,4-dioxane (2 mL) was added methanesulfonic acid (0.063 mL, 0.971 mmol). The reaction mixture was stirred at 80° C. for 2 hours. The mixture was then purified by preparative HPLC (XBridge C18, 19 mm x 150 mm, 5 μm particle size; mobile phase A: water (containing 5 mM ammonium formate), mobile phase B: acetonitrile; temperature: 25 °C; gradient: 20–60% B (0.0–15.0 min); flow rate: 15 mL / min). The product-containing fractions were combined and lyophilized to dryness to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-{[(1S,4S)-4-hydroxycyclohexyl]oxy}-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (3.8 mg, 6% yield) as an off-white solid. LCMS (Method K): retention time 2.71 min, [MH]- 634.2; 1H NMR(400 MHz, DMSO-d6) δ 10.98(s, 1H), 9.77(s, 1H), 7.66(d, J=7.6 Hz, 1H), 7.50(d, J=9.2 Hz, 2H), 7.38-7.46(m, 1H), 7.30(d, J=7.6 Hz, 1H), 7.10-7.13(m, 1H), 7.03(dd, J=2.0, 6.8 Hz, 2H), 6.77-6.80(m, 1H), 5.22(s, 2H), 5.12(dd, J=5.2, 13.4 Hz, 1H), 4.61(m, 1H), 4.50(d, J=4.4Hz, 1H), 4.43(d, J=17.6 Hz, 1H), 4.30(d, J=17.6 Hz, 1H), 3.46-3.47(m, 1H), 2.86-2.89(m, 1H), 2.59-2.63(m, 1H), 2.36-2.41(m, 1H), 1.99-2.03(m, 3H), 1.82-1.79(m, 1H), 1.47-1.54(m, 2H), 1.43-1.48(m, 2H), 1.24(s, 1H)

[0409] Example 168: [2-(2,6-dioxopiperidin-3-yl)-4-(2-methoxyethoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 168A: Ethyl 3-bromo-2-(2-methoxyethoxy)-6-methylbenzoate [ka] A mixture of ethyl 3-bromo-2-hydroxy-6-methylbenzoate (1.30 g, 5.02 mmol), 1-bromo-2-methoxyethane (0.767 g, 5.52 mmol), and potassium carbonate (1.73 g, 12.5 mmol) in acetone (10 mL) was stirred at 80 °C for 2 h. The reaction mixture was cooled to room temperature, diluted with ethyl acetate, washed with water and brine, dried (MgSO), and concentrated. The residue was purified by silica gel column chromatography (eluting solvent: 0-20% ethyl acetate / hexane) to give ethyl 3-bromo-2-(2-methoxyethoxy)-6-methylbenzoate (1.15 g, 72% yield). LCMS (Method E): Retention time 1.02 min, [M+H] + 316.8;318.9; 1 H NMR (400 MHz, chloroform-d) δ 7.46 (d, J = 8.2 Hz, 1H), 6.86 (d, J = 8.2 Hz, 1H), 4.50-4.33 (m, 2H), 4.26-4.11 (m, 2H), 3.80-3.69 (m, 2H), 3.45 (s, 3H), 2.28 (s, 3H), 1.42-1.35 (m, 3H).

[0410] Intermediate 168B: 3-(6-(hydroxymethyl)-7-(2-methoxyethoxy)-1-oxoisoindolin-2-yl)piperidine-2,6-dione [ka] This was prepared by following the general method described for Example 141, Intermediate 141D, substituting ethyl 3-bromo-2-(2-methoxyethoxy)-6-methylbenzoate (Intermediate 168A) for methyl (R)-3-bromo-6-methyl-2-((tetrahydro-2H-pyran-3-yl)oxy)benzoate (Intermediate 141A) in the second step. LCMS (Method E): Retention time 0.67 min, [M+H] + 349.0; 1H NMR(400 MHz, methanol-d4) δ 7.66(d, J=7.7 Hz, 1H), 7.26(d, J=7.6 Hz, 1H), 5.13-5.01(m, 1H), 4.74(s, 2H), 4.52-4.44(m, 2H), 4.43(d, J=6.9 Hz, 2H), 3.75-3.69(m, 2H), 3.41(s, 3H), 2.97-2.87(m, 1H), 2.80-2.71(m, 1H), 2.51-2.38(m, 1H), 2.18-2.08(m, 1H)

[0411] Example 168: A mixture of 3-(6-(hydroxymethyl)-7-(2-methoxyethoxy)-1-oxoisoindolin-2-yl)piperidine-2,6-dione (20 mg, 0.057 mmol), 4-(3,4-difluorophenoxy)benzoic acid (15.8 mg, 0.063 mmol), DIEA (0.013 mL, 0.075 mmol), and diphenylphosphoryl azide (19.0 mg, 0.069 mmol) in 1,4-dioxane (1 mL) was heated at 105 °C for 15 h. The reaction mixture was cooled to room temperature and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 42–62% B (0.0–30.0 min), 62–100% B (30.0–30.1 min), 100% B (30.1–34.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-4-(2-methoxyethoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (20 mg, 56% yield). LCMS (Method D): Retention time 1.98 min, [M+H] + 596.2; 1H NMR(500 MHz, DMSO-d6) δ 10.98(s, 1H), 9.76(br s, 1H), 7.65(d, J=7.8 Hz, 1H), 7.49(br s, 1H), 7.42-7.31(m, 2H), 7.27-7.15(m, 2H), 7.07(ddd, J=12.0, 6.8, 2.9 Hz, 1H), 7.02-6.93(m, 2H), 6.82-6.70(m, 1H), 5.25(s, 2H), 5.04(br dd, J=13.1, 4.9 Hz, 1H), 4.57-4.27(m, 4H), 3.92(d, J=11.6 Hz, 1H), 3.61(br t, J=4.5 Hz, 1H), 3.27(s, 3H), 2.97-2.83(m, 1H), 2.61(br d, J=16.0 Hz, 1H), 2.41-2.31(m, 1H), 2.06-1.94(m, 1H)

[0412] Example 169 [2-(2,6-dioxopiperidin-3-yl)-4-(2-methoxyethoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate [ka] Prepared according to the general method described for Example 168, substituting 4-(3,4-difluorophenoxy)-2-fluorobenzoic acid for 4-(3,4-difluorophenoxy)benzoic acid. LCMS (Method D): Retention time 2.01 min, [M+H] + 613.9; 1H NMR(500 MHz, DMSO-d6) δ 10.98(s, 1H), 9.38(br d, J=1.1 Hz, 1H), 7.65(br d, J=7.6 Hz, 1H), 7.61-7.54(m, 1H), 7.49-7.42(m, 1H), 7.32(d, J=7.7 Hz, 1H), 7.24(ddd, J=11.7, 6.9, 2.9 Hz, 1H), 7.01(dd, J=11.5, 2.6 Hz, 1H), 6.94-6.80(m, 2H), 5.25(s, 2H), 5.05(dd, J=13.3, 5.0Hz, 1H), 4.59-4.24(m, 4H), 3.61(t, J=4.6 Hz, 1H), 3.27(s, 3H), 3.00-2.82(m, 2H), 2.60(br d, J=18.2 Hz, 1H), 2.43-2.32(m, 1H), 2.07-1.94(m, 1H)

[0413] Example 170 [2-(2,6-dioxopiperidin-3-yl)-4-(oxepan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Prepared according to the general method described for Example 141, substituting (S)-tetrahydro-2H-pyran-3-ol for the racemic mixture of xepan-4-ol. LCMS (Method D): Retention time 2.14 min, [M+H] + 636.2; 1H NMR(500 MHz, DMSO-d6) δ 10.96(s, 1H), 9.73(br s, 1H), 7.65(d, J=7.6 Hz, 1H), 7.47(br d, J=8.2 Hz, 2H), 7.41-7.33(m, 1H), 7.30(br d, J=7.9 Hz, 1H), 7.12-6.93(m, 3H), 6.80-6.64(m, 1H), 5.20(s, 2H), 5.05(dd, J=13.3, 4.9 Hz, 1H), 4.92-4.79(m, 1H), 4.47-4.21(m, 2H), 3.73-3.40(m, 3H), 2.90-2.80(m, 1H), 2.69-2.59(m, 1H), 2.42-2.28(m, 1H), 2.22-2.10(m, 1H), 2.07-1.68(m, 6H), 1.57-1.38(m, 1H)

[0414] Example 171 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(pyridin-3-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate [ka] Intermediate 171A: 3-Bromo-2-fluoro-6-methylbenzoic acid [ka] To a solution of 3-bromo-2-fluorobenzoic acid (7.0 g, 32.0 mmol) in HFIP (350 mL) was added potassium carbonate (14 g, 101 mmol), silver carbonate (14 g, 50.8 mmol), pentamethylcyclopentadienyl iridium(III) chloride dimer (2.1 g, 3.94 mmol), and potassium methyltrifluoroborate (14 g, 115 mmol) at room temperature. The resulting mixture was stirred at 100 °C for 12 hours. The reaction mixture was diluted with methanol, filtered, and the filtrate was concentrated under reduced pressure to give crude 3-bromo-2-fluoro-6-methylbenzoic acid (7.0 g).

[0415] To a cooled (0 °C) solution of crude 3-bromo-2-fluoro-6-methylbenzoic acid (7.0 g) in DMF (50 mL) was added potassium carbonate (4.15 g, 30.0 mmol) and iodomethane (1.9 mL, 30.0 mmol). The resulting mixture was stirred at room temperature for 12 h. The reaction was quenched with cold water (100 mL). The reaction mixture was extracted with ethyl acetate (3 × 90 mL). The organic layer was washed with brine (90 mL), dried (NaSO), filtered, and concentrated. The crude material was purified by flash chromatography (SiO, 10% ethyl acetate / petroleum ether) to give methyl 3-bromo-2-fluoro-6-methylbenzoate (6.0 g, 76% yield over two steps). 1 H NMR(400 MHz, CDCl3) δ 7.50(dd, J=7.0, 8.0 Hz, 1 H), 6.90(d, J=8.0 Hz, 1 H), 3.96(s, 3 H), 2.35(s, 3 H)

[0416] Intermediate 171B: tert-butyl 5-amino-4-(6-bromo-7-fluoro-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] To a solution of methyl 3-bromo-2-fluoro-6-methylbenzoate (5.0 g, 20.24 mmol) in DCE (50 mL) was added NBS (4.32 g, 24.29 mmol) and AIBN (0.332 g, 2.024 mmol). The resulting mixture was stirred at 85 °C for 2 hours. The reaction mixture was then concentrated. The residue was treated with water (50 mL) and extracted with dichloromethane (2 × 30 mL). The combined organic layers were washed with brine (50 mL), dried (NaSO), filtered, and concentrated to give crude methyl 3-bromo-6-(bromomethyl)-2-fluorobenzoate (6.0 g).

[0417] To a solution of crude methyl 3-bromo-6-(bromomethyl)-2-fluorobenzoate (6.0 g) in DMF (150 mL) was added (S)-tert-butyl 4,5-diamino-5-oxopentanoate hydrochloride (4.22 g, 17.67 mmol) and DIEA (6.2 mL, 35.3 mmol). The resulting mixture was stirred at 100 °C for 12 h. The reaction was quenched with cold water (100 mL). The reaction mixture was extracted with ethyl acetate (3 x 100 mL). The organic layer was washed with brine (100 mL), dried (NaSO), filtered, and concentrated. The crude product was purified by flash chromatography (SiO, 0–50% EtOAc / petroleum ether) to give tert-butyl 5-amino-4-(6-bromo-7-fluoro-1-oxoisoindolin-2-yl)-5-oxopentanoate (4.0 g, 43% yield over two steps). The enantiomeric excess of this material and subsequent intermediates was not determined. 1 H NMR(400 MHz, DMSO-d6) δ 7.91(dd, J=8.3, 6.3 Hz, 1 H), 7.58(bs, 1 H), 7.41(d, J=8.0 Hz, 1 H), 7.21(bs, 1 H), 4.70-4.67(m, 1 H), 4.61-4.11(m, 2 H), 2.21-2.10(m, 3 H), 2.03-1.90(m, 1 H), 1.33(s, 9 H)

[0418] Intermediate 171C: tert-butyl 5-amino-4-(6-bromo-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate [ka] To a solution of tert-butyl 5-amino-4-(6-bromo-7-fluoro-1-oxoisoindolin-2-yl)-5-oxopentanoate (2.0 g, 4.33 mmol) in acetonitrile (5 mL) was added potassium carbonate (1.198 g, 8.67 mmol) and pyridin-3-ol (1.237 g, 13.00 mmol). The resulting mixture was stirred at 100 °C for 12 h. The reaction mixture was filtered through Celite, washed with ethyl acetate (150 mL), and the filtrate was concentrated. The crude product was purified by flash chromatography (SiO, 0–100% EtOAc / petroleum ether) to give tert-butyl 5-amino-4-(6-bromo-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate (1.0 g, 45% yield). LCMS (Method M): Retention time 1.24 min, [M+H] + 490.2, 492.0

[0419] Intermediate 171D: tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate [ka] To a solution of tert-butyl 5-amino-4-(6-bromo-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate (1.0 g, 1.958 mmol) in 1,4-dioxane (10 mL) was added Pd(PPh3)4 (0.113 g, 0.098 mmol) and 1-(tributylstannyl)methanol (0.629 g, 1.958 mmol). The resulting mixture was purged with nitrogen for 5 minutes and then stirred at 100 °C for 12 hours. The reaction mixture was then concentrated. The crude material was purified by reverse-phase chromatography (Column: 150 g RediSep C18, 45% acetonitrile / 5 mM aqueous ammonium formate, 40 mL / min) to give tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate (350 mg, 38% yield). LCMS (Method S): Retention time 1.69 min, [M+H] + 442.2; 1 H NMR(400 MHz, DMSO-d6) δ 8.20-8.21(m, 2H), 7.81(d, J=7.6 Hz, 1H), 7.51-7.55(m, 2H), 7.26-7.30(m, 1H), 7.10-7.14(m, 2H), 5.27-5.29(m, 1H), 4.44-4.62(m, 5H), 2.07-2.14(m, 3H), 1.91-1.96(m, 1H), 1.32(s, 9H)

[0420] Example 171: To a solution of tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate (100 mg, 0.227 mmol) in tetrahydrofuran (10 mL) was added potassium carbonate (62.6 mg, 0.453 mmol) and 4-nitrophenyl (4-phenoxyphenyl)carbamate (238 mg, 0.680 mmol). The resulting mixture was stirred at room temperature for 12 hours. The reaction mixture was filtered through Celite, washed with methanol, and concentrated. The crude material was purified by reverse-phase chromatography to give tert-butyl 5-amino-5-oxo-4-(1-oxo-6-((((4-phenoxyphenyl)carbamoyl)oxy)methyl)-7-(pyridin-3-yloxy)isoindolin-2-yl)pentanoate (60 mg) in low purity. This material was used in the next step without further purification.

[0421] To a solution of partially purified tert-butyl 5-amino-5-oxo-4-(1-oxo-6-((((4-phenoxyphenyl)carbamoyl)oxy)methyl)-7-(pyridin-3-yloxy)isoindolin-2-yl)pentanoate (60 mg) in 1,4-dioxane (5 mL) was added methanesulfonic acid (0.96 μL, 0.015 mmol). The resulting mixture was stirred at 80 °C for 2 h. The reaction mixture was then concentrated in vacuo. The crude material was purified by preparative HPLC to give (2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(pyridin-3-yloxy)isoindolin-5-yl)methyl (4-phenoxyphenyl)carbamate (6.50 mg, 4% yield over two steps). LCMS (Method S): Retention time 2.20 min, [M+H] + 579.2; 1H NMR(400 MHz, DMSO-d6) δ 10.95(s, 1H), 9.69(br s, 1H), 8.29(d, J=2.8 Hz, 1H), 8.25(d, J=3.8 Hz, 1H), 7.87(d, J=7.8 Hz, 1H), 7.60(d, J=7.8 Hz, 1H), 7.44-7.30(m, 5H), 7.27-7.21(m, 1H), 7.10-7.06(m, 1H), 6.97-6.92(m, 4H), 5.20(s, 2H), 4.94(dd, J=5.1, 13.3 Hz, 1H), 4.53-4.31(m, 2H), 2.90-2.75(m, 1H), 2.60-2.53(m, 1H) 2.36-2.26(m, 1H), 2.00-1.88(m, 1H)

[0422] Example 172 [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(pyridin-3-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 172A: tert-butyl 5-amino-4-(6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate [ka] A mixture of tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate (60 mg, 0.136 mmol), 4-nitrophenyl (4-(3,4-difluorophenoxy)phenyl)carbamate (68.3 mg, 0.177 mmol), and potassium carbonate (56.3 mg, 0.408 mmol) in acetone (3 mL) was stirred at 70° C. for 2 hours. The reaction mixture was cooled to room temperature and filtered. The filtrate was concentrated, and the resulting residue was purified by silica gel column chromatography (eluent: 0-10% MeOH / DCM) to give tert-butyl 5-amino-4-(6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate (60 mg, 64% yield). LCMS (Method E): Retention time 0.96 min, [M+H] + 689.1; 1 H NMR(400 MHz, chloroform-d) δ 8.36-8.20(m, 2H), 7.79(d, J=7.7 Hz, 1H), 7.41(d, J=7.7 Hz, 1H), 7.26-7.18(m, 2H), 7.09(q, J=9.0 Hz, 1H), 6.97-6.90(m, 2H), 6.78(ddd, J=11.3, 6.6, 2.9 Hz, 1H), 6.68(dtd, J=8.9, 3.2, 1.8 Hz, 1H), 6.23(br s, 1H), 5.32(br s, 2H), 4.78-4.70(m, 1H), 4.65-4.40(m, 2H), 2.39-2.12(m, 4H), 1.38(s, 9H)

[0423] Example 172: A mixture of tert-butyl 5-amino-4-(6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-1-oxo-7-(pyridin-3-yloxy)isoindolin-2-yl)-5-oxopentanoate (60 mg, 0.087 mmol) and methanesulfonic acid (0.023 mL, 0.348 mmol) in 1,4-dioxane (2 mL) was stirred at 70° C. for 2 hours. The reaction mixture was cooled to room temperature and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 42–62% B (0.0–30.0 min), 62–100% B (30.0–30.1 min), 100% B (30.1–34.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(pyridin-3-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (31 mg, 55% yield). LCMS (Method D): Retention time 1.71 min, [M+H] + 615.2; 1H NMR(500 MHz, DMSO-d6) δ 9.69(br s, 1H), 8.25-8.12(m, 2H), 7.85(br d, J=7.9 Hz, 1H), 7.58(br d, J=7.8 Hz, 1H), 7.47-7.32(m, 3H), 7.28(br dd, J=8.0, 4.4 Hz, 1H), 7.14(br d, J=8.0 Hz, 1H), 7.06(ddd, J=11.6, 6.6, 2.4 Hz, 1H), 6.98(br d, J=8.6 Hz, 2H), 6.75(br d, J=9.5Hz, 1H), 5.18(s, 2H), 4.91(br dd, J=12.9, 4.5 Hz, 1H), 4.53-4.42(m, 1H), 4.41-4.29(m, 1H), 2.87-2.72(m, 1H), 2.60-2.56(m, 1H), 2.38-2.23(m, 1H), 2.00-1.88(m, 1H)

[0424] Example 173 {2-[(3S)-2,6-dioxopiperidin-3-yl]-3-oxo-4-(3-phenylpropoxy)-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 173A: tert-butyl 5-amino-4-(7-hydroxy-1-oxo-6-vinylisoindolin-2-yl)-5-oxopentanoate [ka] To a solution of tert-butyl 5-amino-4-(6-bromo-7-hydroxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (30.0 g, 61.7 mmol) in 1,4-dioxane (100 mL) was added potassium vinyltrifluoroborate (16.53 g, 123 mmol), aqueous potassium phosphate trihydrate (2 M, 93 mL, 185 mmol), and Pd(dppf)Cl (4.51 g, 6.17 mmol). The resulting mixture was purged with nitrogen for 10 minutes and stirred at 100 °C for 12 hours. The reaction mixture was diluted with water (100 mL) and extracted with ethyl acetate (3 × 70 mL). The combined organic layers were washed with brine (100 mL), dried (NaSO), filtered, and concentrated. The crude material was purified by flash chromatography (SiO, 0-40% ethyl acetate / petroleum ether) to give tert-butyl 5-amino-4-(7-hydroxy-1-oxo-6-vinylisoindolin-2-yl)-5-oxopentanoate (19 g, 76% yield). LCMS (Method S): Retention time 2.51 min, [M+2H-tBu] + 305.0

[0425] Intermediate 173B: tert-butyl 5-amino-4-(7-hydroxy-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] To a cooled (0 °C) solution of tert-butyl 5-amino-4-(7-hydroxy-1-oxo-6-vinylisoindolin-2-yl)-5-oxopentanoate (19 g, 46.9 mmol) in THF (100 mL) and water (20 mL) was added aqueous osmium tetroxide (4 wt%, 29.8 g, 4.69 mmol) under a nitrogen atmosphere. The resulting mixture was stirred at 0 °C for 30 minutes and then at room temperature for 1 hour. The reaction mixture was cooled again to 0 °C, and sodium periodate (30.1 g, 141 mmol) was added slowly over 10 minutes. The mixture was then stirred at room temperature for 12 hours. The reaction mixture was diluted with cold water (30 mL) and extracted with ethyl acetate (3 x 30 mL). The organic layer was washed with brine (30 mL), dried (Na2SO4), filtered, and concentrated to give crude tert-butyl 5-amino-4-(6-formyl-7-hydroxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (20 g).

[0426] To a cooled (0 °C) solution of crude tert-butyl 5-amino-4-(6-formyl-7-hydroxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (20 g) in methanol (30 mL) was added sodium borohydride (7.10 g, 188 mmol). The resulting mixture was stirred at 0 °C for 4 h. The reaction mixture was then concentrated, and the crude product was purified twice by reverse-phase chromatography (415 g RediSep C18 column, 35% acetonitrile / water (containing 5 mM ammonium formate), 100 mL / min) to give tert-butyl 5-amino-4-(7-hydroxy-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (6.2 g, 34% yield over two steps). LCMS (Method K): Retention time 1.55 min, [M+H] + 365.0

[0427] Intermediate 173C: tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-(3-phenylpropoxy)isoindolin-2-yl)-5-oxopentanoate [ka] A mixture of tert-butyl 5-amino-4-(7-hydroxy-6-(hydroxymethyl)-1-oxoisoindolin-2-yl)-5-oxopentanoate (50 mg, 0.137 mmol), (3-bromopropyl)benzene (41.0 mg, 0.206 mmol), and potassium carbonate (56.9 mg, 0.412 mmol) in DMF (1 mL) was stirred at 80 °C for 2 h. The reaction mixture was cooled to room temperature, diluted with water, and extracted with ethyl acetate. The combined organic layers were dried (MgSO), filtered, and concentrated. The residue was purified by silica gel column chromatography (eluting with 20-100% ethyl acetate / hexane) to give tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-(3-phenylpropoxy)isoindolin-2-yl)-5-oxopentanoate (49 mg, 74%). LCMS (Method E): Retention time 0.95 min, [M+H] + 483.2; 1 H NMR(500 MHz, chloroform-d) δ 7.57(d, J=7.6 Hz, 1H), 7.34-7.29(m, 2H), 7.27-7.23(m, 2H), 7.23-7.19(m, 1H), 7.16(d, J=7.6 Hz, 1H), 6.33(br s, 1H), 5.41(br s, 1H), 4.88(dd, J=8.7, 6.4 Hz, 1H), 4.83-4.72(m, 2H), 4.53-4.37(m, 3H), 4.33(dt, J=9.3, 6.6 Hz, 1H), 2.89-2.83(m, 2H), 2.43-2.08(m, 7H), 1.44(s, 9H)

[0428] Intermediate 173D: 3-(6-(hydroxymethyl)-1-oxo-7-(3-phenylpropoxy)isoindolin-2-yl)piperidine-2,6-dione [ka] A mixture of tert-butyl 5-amino-4-(6-(hydroxymethyl)-1-oxo-7-(3-phenylpropoxy)isoindolin-2-yl)-5-oxopentanoate (45 mg, 0.093 mmol) and methanesulfonic acid (0.036 mL, 0.559 mmol) in 1,4-dioxane (1 mL) was stirred at 80 °C for 2 hours. The reaction mixture was cooled to room temperature and purified by reverse-phase chromatography (30% acetonitrile / water with 0.1% TFA) to give 3-(6-(hydroxymethyl)-1-oxo-7-(3-phenylpropoxy)isoindolin-2-yl)piperidine-2,6-dione (14 mg, 37%). LCMS (Method E): Retention time 0.83 min, [M+H] + 409.1

[0429] Example 173: Phosgene (20% in toluene, 36.3 mg, 0.073 mmol) was added dropwise to 3-(6-(hydroxymethyl)-1-oxo-7-(3-phenylpropoxy)isoindolin-2-yl)piperidine-2,6-dione (20 mg, 0.049 mmol) in THF (1 mL). The resulting mixture was stirred at room temperature for 1 hour and then concentrated in vacuo. The residue was dissolved in THF (1 mL), and then 4-(3,4-difluorophenoxy)aniline (11.9 mg, 0.054 mmol) was added, followed by DIEA (0.019 mL, 0.108 mmol). The reaction mixture was stirred at room temperature for 2 h and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 49–79% B (0.0–20.0 min), 79–100% B (20.0–20.1 min), 100% B (20.1–24.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give {2-[(3S)-2,6-dioxopiperidin-3-yl]-3-oxo-4-(3-phenylpropoxy)-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (2.5 mg, 8% yield). LCMS (Method D): Retention time 2.51 min, [M+H] + 656.0; 1H NMR(500 MHz, DMSO-d6) δ 9.77(br s, 1H), 7.68(d, J=7.6 Hz, 1H), 7.49(br d, J=8.2 Hz, 2H), 7.44-7.35(m, 1H), 7.32(d, J=7.9 Hz, 1H), 7.26-7.10(m, 5H), 7.07(ddd, J=11.9, 6.8, 3.1 Hz, 1H), 7.01(d, J=8.9 Hz, 2H), 6.79-6.72(m, 1H), 5.25(s, 2H), 5.06(dd, J=13.0, 5.0Hz, 1H), 4.47-4.38(m, 1H), 4.38-4.24(m, 3H), 2.95-2.83(m, 1H), 2.78-2.69(m, 2H), 2.66-2.56(m, 1H), 2.38(qd, J=13.4, 4.7 Hz, 1H), 2.10-1.94(m, 3H)

[0430] Example 174 2-({5-[({[4-(3,4-difluorophenoxy)phenyl]carbamoyl}oxy)methyl]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-4-yl}oxy)acetate methyl [ka] Intermediate 174A: tert-butyl 2-((5-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-2-(2,6-dioxopiperidin-3-yl)-3-oxoisoindolin-4-yl)oxy)acetate [ka] Intermediate 174A was prepared according to the general method described for Example 52, substituting tert-butyl 2-bromoacetate for iodoethane in the first step and 4-(3,4-difluorophenoxy)benzoic acid for 4-phenoxybenzoic acid in the last step. LCMS (Method E): Retention time 1.09 min, [M+H] + 652.1;1 H NMR(400 MHz, methanol-d4) δ 7.70(d, J=7.7 Hz, 1H), 7.46(br d, J=8.7 Hz, 2H), 7.30(d, J=7.7 Hz, 1H), 7.21(dt, J=10.2, 9.2 Hz, 1H), 6.96(d, J=9.0 Hz, 2H), 6.86(ddd, J=11.8, 6.7, 2.9 Hz, 1H), 6.73(dtd, J=9.0, 3.2, 1.7 Hz, 1H), 5.43(s, 2H), 5.11(dd, J=13.4, 5.2 Hz, 1H), 5.01(d, J=2.1 Hz, 2H), 4.54-4.37(m, 2H), 2.99-2.85(m, 1H), 2.82-2.70(m, 1H), 2.47(qd, J=13.2, 4.7 Hz, 1H), 2.16(dtd, J=12.7, 5.2, 2.4 Hz, 1H), 1.45(s, 9H)

[0431] Intermediate 174B: 2-((5-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-2-(2,6-dioxopiperidin-3-yl)-3-oxoisoindolin-4-yl)oxy)acetic acid [ka] HCl solution (4 N / 1,4-dioxane, 0.192 mL, 0.767 mmol) was added to tert-butyl 2-((5-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-2-(2,6-dioxopiperidin-3-yl)-3-oxoisoindolin-4-yl)oxy)acetate (25 mg, 0.038 mmol) in DCM (1 mL). The resulting mixture was stirred at room temperature for 15 hours. The reaction mixture was concentrated in vacuo to give 2-((5-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-2-(2,6-dioxopiperidin-3-yl)-3-oxoisoindolin-4-yl)oxy)acetic acid (22 mg, 87% yield). LCMS (Method E): Retention time 0.97 min, [M+H]+ 596.1; 1 H NMR(400 MHz, methanol-d4) δ 7.72(d, J=7.7 Hz, 1H), 7.46(br d, J=8.8 Hz, 2H), 7.32(d, J=7.7 Hz, 1H), 7.26-7.14(m, 1H), 6.96(d, J=8.9 Hz, 2H), 6.86(ddd, J=11.8, 6.7, 2.9 Hz, 1H), 6.73(dtd, J=9.0, 3.2, 1.9 Hz, 1H), 5.44(s, 2H), 5.17-5.05(m, 3H), 4.55-4.38(m, 2H), 2.97-2.85(m, 1H), 2.82-2.70(m, 1H), 2.56-2.42(m, 1H), 2.17(ddt, J=12.7, 5.2, 2.6 Hz, 1H)

[0432] Example 174: A solution of TMS-diazomethane (2 M in hexane, 0.020 mL, 0.040 mmol) was added to 2-((5-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-2-(2,6-dioxopiperidin-3-yl)-3-oxoisoindolin-4-yl)oxy)acetic acid (8 mg, 0.013 mmol) in methanol (0.5 mL) and toluene (0.5 mL). The resulting mixture was stirred at room temperature for 1 hour and concentrated in vacuo to give methyl 2-({5-[({[4-(3,4-difluorophenoxy)phenyl]carbamoyl}oxy)methyl]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-4-yl}oxy)acetate (6 mg, 66% yield). LCMS (Method E): Retention time 1.01 min, [M+H] + 610.1; 1H NMR (400 MHz, methanol-d4) δ 7.71(d, J=7.7 Hz, 1H), 7.46(br d, J=8.6 Hz, 1H), 7.32(d, J=7.7 Hz, 1H), 7.25-7.08(m, 3H), 7.01-6.93(m, 2H), 6.88-6.80(m, 1H), 6.73(dtd, J=9.0, 3.2, 1.9 Hz, 1H), 5.43(s, 2H), 5.19-5.06(m, 3H), 4.46(d, J=7.4 Hz, 2H), 3.73(s, 3H), 2.98-2.74(m, 2H), 2.54-2.41(m, 1H), 2.22-2.10(m, 1H)

[0433] Example 175 {4-[(Dimethylcarbamoyl)methoxy]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] A mixture of 2-((5-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-2-(2,6-dioxopiperidin-3-yl)-3-oxoisoindolin-4-yl)oxy)acetic acid (30 mg, 0.050 mmol), dimethylamine solution (11% in 2-propanol, 20.7 mg, 0.050 mmol), HATU (28.7 mg, 0.076 mmol), and DIEA (0.018 mL, 0.101 mmol) in DMF (1 mL) was stirred at room temperature for 1 hour. The reaction mixture was purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 42–62% B (0.0–30.0 min), 62–100% B (30.0–30.1 min), 100% B (30.1–34.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give {4-[(dimethylcarbamoyl)methoxy]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (17.1 mg, 53% yield). LCMS (Method C): Retention time 1.88 min, [M+H] + 623.2; 1H NMR(500 MHz, DMSO-d6) δ 9.76(br s, 1H), 7.65(d, J=7.7 Hz, 1H), 7.48(br d, J=8.5 Hz, 2H), 7.44-7.35(m, 1H), 7.30(d, J=7.6 Hz, 1H), 7.16-7.05(m, 1H), 7.01(br d, J=8.9 Hz, 2H), 6.85-6.70(m, 1H), 5.46-5.34(m, 2H), 5.30(s, 2H), 5.07(dd, J=13.0, 5.1 Hz, 1H), 4.52-4.21(m, 2H), 2.90(s, 3H), 2.86-2.83(m, 1H), 2.78(s, 3H), 2.64-2.55(m, 1H), 2.43-2.30(m, 1H), 2.05-1.96(m, 1H)

[0434] Examples 176 to 178 The compounds listed in Table 17 were prepared following the general method described for Example 175, substituting the appropriate amine for dimethylamine: [ka] [Table 26]

[0435] Example 179 {4-[(1-acetylpiperidin-4-yl)oxy]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 179A: tert-butyl 4-((2-(2,6-dioxopiperidin-3-yl)-5-(hydroxymethyl)-3-oxoisoindolin-4-yl)oxy)piperidine-1-carboxylate [ka] Intermediate 179A was prepared following the general method described for Example 141, Intermediate 141D, substituting tert-butyl 4-hydroxypiperidine-1-carboxylate for (S)-tetrahydro-2H-pyran-3-ol. LCMS (Method E): Retention time 0.79 min, [M+H] + 474.0; 1 H NMR(400 MHz, methanol-d4) δ 7.72(d, J=7.6 Hz, 1H), 7.28(d, J=7.7 Hz, 1H), 5.13-5.03(m, 1H), 4.82-4.75(m, 1H), 4.72(s, 2H), 4.48-4.32(m, 2H), 3.96-3.84(m, 2H), 3.03(m, 2H), 2.95-2.71(m, 2H), 2.52-2.35(m, 1H), 2.18-2.11(m, 1H), 2.02-1.93(m, 2H), 1.74-1.63(m, 2H), 1.47(s, 9H)

[0436] Intermediate 179B: tert-butyl 4-((2-(2,6-dioxopiperidin-3-yl)-5-(hydroxymethyl)-3-oxoisoindolin-4-yl)oxy)piperidine-1-carboxylate [ka] A mixture of tert-butyl 4-((2-(2,6-dioxopiperidin-3-yl)-5-(hydroxymethyl)-3-oxoisoindolin-4-yl)oxy)piperidine-1-carboxylate (40 mg, 0.084 mmol), 4-(3,4-difluorophenoxy)benzoic acid (23.3 mg, 0.093 mmol), DIEA (0.019 mL, 0.110 mmol), and diphenylphosphoryl azide (27.9 mg, 0.101 mmol) in 1,4-dioxane (1 mL) was heated at 105 °C for 15 hours. The reaction mixture was cooled to room temperature and purified by silica gel column chromatography (eluent: 0-10% MeOH / DCM) to give tert-butyl 4-((5-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-2-(2,6-dioxopiperidin-3-yl)-3-oxoisoindolin-4-yl)oxy)piperidine-1-carboxylate (40 mg, 66% yield). LCMS (Method E): Retention time 1.10 min, [M+H] + 721.1; 1 H NMR(400 MHz, chloroform-d) δ 8.07(s, 1H), 7.66(d, J=7.7 Hz, 1H), 7.40(br d, J=8.4 Hz, 1H), 7.17(s, 1H), 7.13-7.04(m, 1H), 6.97(d, J=9.0 Hz, 2H), 6.88-6.76(m, 2H), 6.74-6.63(m, 1H), 5.33(s, 2H), 5.18(dd, J=13.2, 5.2 Hz, 1H), 4.99-4.88(m, 1H), 4.58-4.27(m, 2H), 3.96(br d, J=7.6 Hz, 2H), 3.15-2.94(m, 2H), 2.92-2.73(m, 2H), 2.34(dd, J=13.2, 4.8 Hz, 1H), 2.23-2.11(m, 1H), 2.03-1.93(m, 2H), 1.83-1.72(m, 2H), 1.47(s, 9H)

[0437] Intermediate 179C: tert-butyl 4-((2-(2,6-dioxopiperidin-3-yl)-5-(hydroxymethyl)-3-oxoisoindolin-4-yl)oxy)piperidine-1-carboxylate [ka] A solution of HCl (4 N in 1,4-dioxane, 0.132 mL, 0.527 mmol) was added to tert-butyl 4-((5-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-2-(2,6-dioxopiperidin-3-yl)-3-oxoisoindolin-4-yl)oxy)piperidine-1-carboxylate (38 mg, 0.053 mmol) in DCM (0.5 mL) at room temperature. The resulting mixture was stirred for 15 hours and then concentrated in vacuo to give (2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(piperidin-4-yloxy)isoindolin-5-yl)methyl (4-(3,4-difluorophenoxy)phenyl)carbamate as the HCl salt (34 mg, 93% yield). LCMS (Method E): Retention time 0.88 min, [M+H] + 621.2; 1 H NMR (400 MHz, chloroform-d) δ 7.39(d, J=7.7 Hz, 1H), 7.22-7.07(m, 2H), 7.00(d, J=7.7 Hz, 1H), 6.91-6.79(m, 1H), 6.69-6.57(m, 2H), 6.53-6.46(m, 1H), 6.44-6.35(m, 1H), 4.98(s, 2H), 4.74(dd, J=13.3, 5.2 Hz, 1H), 4.59(tt, J=7.4, 3.8 Hz, 1H), 4.21-4.03(m, 2H), 3.19-3.07(m, 2H), 2.88-2.72(m, 2H), 2.59-2.36(m, 2H), 2.15(qd, J=13.2, 4.9 Hz, 1H), 1.99-1.73(m, 5H)

[0438] Example 179: To a cooled (0 °C) mixture of (2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(piperidin-4-yloxy)isoindolin-5-yl)methyl (4-(3,4-difluorophenoxy)phenyl)carbamate HCl salt (15 mg, 0.023 mmol) in DCM (0.5 mL) was added acetic anhydride (2.2 μL, 0.023 mmol). The reaction mixture was stirred for 1 h and purified by preparative HPLC (column: XBridge C18, 19 mm x 200 mm, particle size: 5 μm; mobile phase A: acetonitrile / water (5:95) containing 10 mM ammonium acetate, mobile phase B: acetonitrile / water (95:5) containing 10 mM ammonium acetate; temperature: 25 °C; gradient: 42–62% B (0.0–30.0 min), 62–100% B (30.0–30.1 min), 100% B (30.1–34.0 min); flow rate: 20 mL / min). The product-containing fractions were combined and dried on a centrifugal evaporator to give {4-[(1-acetylpiperidin-4-yl)oxy]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (7.6 mg, 50% yield). LCMS (Method C): Retention time 1.85 min, [M+1] + 663.0; 1H NMR(500 MHz, DMSO-d6) δ 9.74(br s, 1H), 7.72-7.57(m, 2H), 7.48(br d, J=8.5 Hz, 2H), 7.43-7.37(m, 1H), 7.33-7.28(m, 1H), 7.19(br s, 1H), 7.08(ddd, J=11.7, 6.8, 2.7 Hz, 1H), 7.01(br d, J=8.9 Hz, 2H), 6.81-6.72(m, 1H), 5.32-5.19(m, 2H), 4.85-4.80(m, 1H), 4.73(dd, J=10.0, 4.8 Hz, 1H), 4.59-4.39(m, 2H), 4.38-4.22(m, 1H), 4.09-3.93(m, 1H), 3.79-3.66(m, 1H), 3.47-3.33(m, 1H), 3.20-3.06(m, 1H), 2.99-2.83(m, 1H), 2.28-2.12(m, 2H), 2.04(s, 3H), 1.97-1.84(m, 2H), 1.75-1.66(m, 1H), 1.63-1.45(m, 1H)

[0439] Intermediate I-12 (S)-4,5-Diamino-5-oxopentanoic acid-2,2,3,3,4-d5tert-butyl ester hydrochloride [ka] (S)-tert-Butyl 4,5-diamino-5-oxopentanoate-2,2,3,3,4-d5 hydrochloride was prepared from commercially available L-glutamic acid-2,3,3,4,4-d5 according to the general method for preparing (S)-tert-butyl 4,5-diamino-5-oxopentanoate disclosed in WO2019040109 A1.

[0440] Example 180 {2-[(3S)-2,6-dioxo(3,4,4,5,5- 2H5) Piperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate [ka] Intermediate 180A: (S)-5-amino-4-(6-bromo-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoic acid-2,2,3,3,4-d5 tert-butyl ester [ka] A mixture of methyl 3-bromo-6-(bromomethyl)-2-methoxybenzoate (575 mg, 1.70 mmol), (S)-2,2,3,3,4-d5 tert-butyl 4,5-diamino-5-oxopentanoate hydrochloride (431 mg, 1.77 mmol), and DIEA (0.743 mL, 4.25 mmol) in acetonitrile (3.75 mL) was stirred at 60 °C for 15 h. The reaction mixture was concentrated, redissolved in ethyl acetate, and washed with water and then brine. The organic layer was dried over MgSO. After filtration and concentration, the crude product was redissolved in a minimum amount of ethyl acetate. Hexane was then added to precipitate the product, giving (S)-2,2,3,3,4-d5tert-butyl 5-amino-4-(6-bromo-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (0.66 g, 90% yield) as a white solid. LCMS (Method E): Retention time 0.92 min, [M+H] + 432.1, 434.1; 1 H NMR (400 MHz, chloroform-d) δ 7.75 (d, J = 8.1 Hz, 1H), 7.09 (d, J = 8.0 Hz, 1H), 6.38 (br s, 1H), 5.43 (br s, 1H), 4.62-4.34 (m, 2H), 4.12 (s, 3H), 1.45 (s, 9H).

[0441] Intermediate 180B: (S)-5-amino-4-(6-(hydroxymethyl)-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate-2,2,3,3,4-d5 tert-butyl [ka] A mixture of (S)-2,2,3,3,4-d5 tert-butyl 5-amino-4-(6-bromo-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (650 mg, 1.50 mmol), 1-(tributylstannyl)methanol (724 mg, 2.26 mmol), and Pd(PPh3)4 (174 mg, 0.150 mmol) in 1,4-dioxane (10.7 mL) was degassed with nitrogen and then heated at 100 °C for 5 h. The reaction mixture was concentrated and purified by flash chromatography (column: 80 g SiO, 0-20% MeOH / DCM) to give (S)-2,2,3,3,4-d5 tert-butyl 5-amino-4-(6-(hydroxymethyl)-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (0.43 g, 75% yield) as a pale foam. LCMS (Method E): Retention time 0.76 min, [M+H] + 384.1; 1 H NMR(400 MHz, chloroform-d) δ 7.57(d, J=7.6 Hz, 1H), 7.18(d, J=7.6 Hz, 1H), 6.40(br s, 1H), 5.49-5.33(m, 1H), 4.78(dd, J=6.0, 4.9 Hz, 2H), 4.58-4.34(m, 2H), 4.17(s, 3H), 2.28(t, J=6.3 Hz, 1H), 1.44(s, 9H)

[0442] Intermediate 180C: (S)-2,2,3,3,4-d5 tert-butyl 5-amino-4-(6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate [ka] A mixture of (S)-2,2,3,3,4-tert-butyl 5-amino-4-(6-(hydroxymethyl)-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (400 mg, 1.04 mmol), 4-(3,4-difluorophenoxy)benzoic acid (522 mg, 2.09 mmol), diphenylphosphoryl azide (718 mg, 2.61 mmol), and DIEA (0.455 mL, 2.61 mmol) in 1,4-dioxane (2.65 mL) was heated at 90–98 °C for 1–2 h. (A significant exotherm was observed when the internal temperature reached ∼80 °C; heating was stopped to avoid overheating; gas evolution was observed.) The reaction mixture was cooled to room temperature and concentrated to remove all volatiles. The crude material was purified by flash chromatography (Column: 40 g SiO, 0-80% ethyl acetate / hexanes) to afford (S)-2,2,3,3,4-d5 tert-butyl 5-amino-4-(6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoate (498 mg, 76% yield) as a pale foam. LCMS (Method E): Retention time 1.06 min, [M+H] + 631.3, [M+K] + 669.3; 1 H NMR(499 MHz, chloroform-d) δ 7.65(d, J=7.8 Hz, 1H), 7.39(br d, J=8.5 Hz, 2H), 7.20(d, J=7.6 Hz, 1H), 7.16-7.05(m, 1H), 6.98(d, J=9.0 Hz, 2H), 6.80(ddd, J=11.4, 6.7, 2.9 Hz, 1H), 6.74-6.62(m, 2H), 6.30(br s, 1H), 5.34(d, J=2.8 Hz, 2H), 5.29(br s, 1H), 4.58-4.38(m, 2H), 4.19(s, 3H), 1.45(s, 9H)

[0443] Intermediate 180D: (S)-5-amino-4-(6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoic acid-2,2,3,3,4-d5 [ka] TFA (2.13 mL, 27.6 mmol) was added to (S)-5-amino-4-(6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoic acid-2,2,3,3,4-d5 tert-butyl ester (498 mg, 0.790 mmol) in DCM (4.4 mL). The resulting mixture was stirred at room temperature for 2 hours and then concentrated in vacuo to give (S)-5-amino-4-(6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoic acid-2,2,3,3,4-d5 (450 mg, 99% yield) as an off-white foam. LCMS (Method E): Retention time 0.95 min, [M+H] + 575.2, [M+K] + 613.2; 1 H NMR(400 MHz, chloroform-d) δ 7.83-7.74(m, 1H), 7.68(d, J=7.7 Hz, 1H), 7.38(br d, J=8.0 Hz, 2H), 7.24(d, J=7.7 Hz, 1H), 7.16-7.05(m, 1H), 6.97(d, J=8.9 Hz, 2H), 6.80(ddd, J=11.4, 6.6, 2.9 Hz, 2H), 6.74-6.66(m, 1H), 6.61(br d, J=1.5 Hz, 1H), 5.57-5.46(m, 1H), 5.33(d, J=2.2 Hz, 2H), 4.78(d, J=18.0 Hz, 1H), 4.48(d, J=18.0 Hz, 1H), 4.11(s, 3H)

[0444] Example 180: Thionyl chloride (0.380 mL, 5.21 mmol) was diluted with anhydrous 1,4-dioxane and added slowly to a cooled (−55° C.) solution of (S)-5-amino-4-(6-((((4-(3,4-difluorophenoxy)phenyl)carbamoyl)oxy)methyl)-7-methoxy-1-oxoisoindolin-2-yl)-5-oxopentanoic acid-2,2,3,3,4-d5 (374 mg, 0.651 mmol) in DMF (8.54 mL). The resulting mixture was stirred at −55° C. for 15 minutes, and then pyridine (0.948 mL, 11.72 mmol) was added slowly. The reaction mixture was stirred at −55° C. for 20 minutes. The reaction was then quenched with ice, followed by ice water (three times the volume of DMF), resulting in the formation of a viscous material that solidified upon prolonged stirring. The suspension was stirred at 0-5 °C for 1-2 h and then filtered. The solid was rinsed thoroughly with water and dried overnight. The material was purified by SFC (Column: CHIRALPAK AS-H, 5 x 25 cm, particle size: 5 μm; Mobile phase: carbon dioxide / 1:1 v / v MeOH:acetonitrile (59:41); Temperature: 35 °C; BPR pressure: 100 bar; Flow rate: 320 mL / min) to give {2-[(3S)-2,6-dioxo(3,4,4,5,5- 2 H5) Piperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (280 mg, 77% yield) was obtained as an off-white solid. SFC (Method T): Retention time: 5.65 min ( > 99.9%ee). LCMS (Method E): Retention time 0.99 min, [M+H] + 557.3, [M+K] + 595.4; 1H NMR(400 MHz, DMSO-d6) δ 10.98(s, 1H), 9.78(s, 1H), 7.68(d, J=7.7 Hz, 1H), 7.56-7.30(m, 4H), 7.10(ddd, J=12.0, 6.8, 2.9 Hz, 1H), 7.02(d, J=9.0 Hz, 2H), 6.88-6.63(m, 1H), 5.23(s, 2H), 4.52-4.25(m, 2H), 4.05(s, 3H);19F NMR(376 MHz, DMSO-d6) δ -135.53, -146.01

[0445] Biological assays The pharmacological properties of the compounds of this invention can be confirmed by a number of biological assays. The following exemplary biological assays were performed with at least one compound of the invention.

[0446] Cyclin E1 cytolysis assay (MSD) Culture cells: On day 0, OVCAR3 cells were seeded into a 384-well cell culture plate at 15,000 cells per well in 40 μL of medium (RPMI 1640, 20% FBS, 0.01% insulin, 1% Anti / Anti). Cells were incubated and cultured at 37°C and 5% CO for 24 hours.

[0447] MSD plate coating: On day 1, rabbit anti-CCNE1 antibody (Abcam ab33911, 1 μg / mL DPBS, 10 μL / well) was added to a mesoscale discovery plate (MSD L21XA). The MSD plate was briefly centrifuged to ensure the solution coated the bottom of the wells and incubated overnight at 4°C. On day 2, the plate was washed three times with TBS + 0.2% TWEEN, blocked with 3% MSD Blocker A (MSD R93AA-1, 30 μL / well) for 1 hour, and then washed three times again with TBS + 0.2% TWEEN.

[0448] Cell treatment and lysis: On day 1, the compounds under investigation were added to the cell culture using acoustic dispensing. The cell culture was then centrifuged at 400 g for 4 min to disperse the compounds and incubated at 37 °C and 5% CO2 for 24 h. After incubation, 40 μL of DPBS was added to the cell culture to dilute the medium. All liquid was carefully discarded and immediately replaced with 30 μL of cell lysis buffer (MSD Tris Cell Lysis Buffer (MSD R60TX-2), Halt Protease Inhibitor (ThermoFisher 78438), Phosphatase Inhibitor II (Sigma-Aldrich P5726), Phosphatase Inhibitor III (Sigma-Aldrich P0044), 0.02 M PMSF (Sigma-Aldrich 7626), 0.1% SDS (VWR E719-100ML)). The plates were then sealed and shaken at 300 rpm at room temperature for 5 minutes and freeze-thawed for optimal cell lysis.

[0449] Data collection: After thawing, 25 μL of lysate was transferred to the coated MSD plate. The plate was then sealed and shaken at 300 rpm at 4°C overnight. On day 3, the MSD plate was washed three times with TBS + 0.2% TWEEN. Mouse anti-CCNE1 antibody (Abcam ab238081, 0.5 μg / mL 1% MSD Blocker A, 10 μL / well) was added to the MSD plate, which was then sealed and shaken at room temperature for 3 hours. After primary antibody incubation, the plate was washed three times with TBS + 0.2% TWEEN, and goat anti-mouse Sulfo-Tag antibody (MSD R32AC, 1 μg / mL 1% MSD Blocker A, 10 μL / well) was added to the MSD plate. The plate was resealed and shaken at room temperature for 1 hour, then washed three times with TBS + 0.2% TWEEN. After the final wash, 35 μL of 1x Read Buffer (MSD R92TC-1) was added to each well, and data were collected using an MSD plate reader. The reference compound, [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate, was used at 10 μM to define a 110% response. Assay results for each compound were calculated by dividing the concentration giving a 50% response by the DC concentration. 50 , and the maximum response observed for the compound is D max reported as.

[0450] Phosphorylated retinoblastoma (pRB) cell assay NIH OVCAR3 (HTB-161, American Type Culture Collection, Manassas VA) cells were cultured for up to passage 10 in medium consisting of RPMI (11835-030 Gibco, Grand Island NY), 20% HI FBS (16140-071, Gibco, Grand Island NY), and 0.01 mg / mL bovine pancreatic insulin (I6634-1G, Sigma Aldrich, St. Louis, MO).

[0451] Cells were seeded into 384-well CulturPlates (6007688, Perkin Elmer, Waltham MA) at a density of 10,000 cells / 20 μL of the above medium per well and incubated overnight at 37°C and 5% CO2.

[0452] The next day, cells were treated with 40 nL of compounds dissolved in DMSO at appropriate serial dilutions (10 mM to 1.7 μM) using an Echo 650 (Beckman Coulter, Indianapolis, IN) acoustic dispenser, and then incubated as described above for 24 h.

[0453] After 24 hours, the medium was removed from each well and 20 μL of the following mixture was immediately added: 12 μL deionized water, 4 μL cell lysate, 4 μL reconstituted antibody conjugate, and 1:100 phosphatase inhibitor (Phospho-Rb (Ser807 / 811) Cell Kit (64RBS807PEY, Perkin Elmer, Waltham MA).

[0454] Plates were sealed, protected from light, and incubated at room temperature for at least 4 hours before being read on an EnVision plate reader (Perkin Elmer, Waltham MA) according to the kit manufacturer's protocol. The reference compound, N-(5-{[(5-tert-butyl-1,3-oxazol-2-yl)methyl]sulfanyl}-1,3-thiazol-2-yl)piperidine-4-carboxamide, was used at 10 μM to define a 100% response. Assay results for each compound were calculated as the IC concentration, which represents the concentration giving a 50% response. 50 and the maximum response observed for the compound is Y max reported as.

[0455] GSPT1 cytolysis assay DF15-GSPT1-ePL was constructed using a human DF15 cell line (CVCL_Y429) conditionally coexpressing chimeric GSPT1 (target) and ePL / donor (enhanced ProLabel®, DiscoverX, for enzyme fragment complementation by donor-acceptor pairing). This construct was used to detect intracellular GSPT1 proteolysis in the form of a chemiluminescent signal. Two culture media were used for assay and maintenance: Core-RPMI 1640 medium (containing 10% heat-inactivated fetal bovine serum and 1X penicillin / streptomycin) for assay; and medium (containing 0.1 mM NEAA, 1 mM sodium pyruvate, 25 mM Hepes, 0.1% Pluronic F-68, 1X glutamine, and 4 μg / mL blasticidin (selection reagent)) for subculture and maintenance. Detection was performed on 1536-well tissue culture plates (Corning #3727) seeded with cells at a density of 0.25 million / mL in 3.5 μL of core-RPMI 1640. Pre-titrated test compounds in DMSO were dispensed onto the assay plate using an ECHO (Labcyte acoustic energy liquid handling system). Assay incubation lasted 20 hours in a 37°C incubator with 5% CO2. The plate was then cooled to room temperature for 30 minutes. Then, 3.5 μL of the detection reagent mix, containing predetermined ratios of enzyme acceptor, substrate, and cell lysate, was added per well. Luminescence plate signal readings were performed using an EnVision plate reader (PerkinElmer) 60 minutes after the previous step at room temperature. Raw data were collected and processed using Dotmatics (a data analysis system) to calculate the test compound titers. The reference compound, 3-[5-(3,6-dimethoxyisoquinolin-1-yl)-1-oxo-2,3-dihydro-1H-isoindol-2-yl]piperidine-2,6-dione, was used at 1.43 μL to define a 75% response. The assay results for each compound were calculated by dividing the concentration that produced a 50% response by the DC 50and the maximum response observed for the compound is D max reported as. [Table 27] [Table 28] [Table 29] [Table 30] [Table 31] [Table 32] [Table 33] [Table 34] [Table 35]

[0456] Table 18 shows the activity of Examples 1 to 180 on cyclin E1 degradation, pRB inhibition, and GSPT1 degradation. 50 The smaller the value of DC, the more active the compound is in the cyclin E1 assay. 50 Higher IC values ​​indicate lower activity of the compound in the cyclin E1 assay. 50 The smaller the IC value, the more active the compound is in the pRB assay. 50 A higher value indicates a lower activity of the compound in the pRB assay. 50A smaller value indicates a higher activity of the compound in the GSPT1 assay. 50 A higher value indicates a lower activity of the compound in the GSPT1 assay. 50 / Cyclin E1 DC 50 A higher value of the ratio indicates that the compound is more selective for cyclin E1 degradation activity than for GSPT1 degradation activity, which in turn indicates that the compound is more selective for GSPT1 degradation.

[0457] In the studies reported in Table 18, the exemplified compounds, ie, Examples 1-154 and 159-180, showed a selectivity ratio of at least 9 for cyclin E1 degrading activity over GSPT1 degrading activity.

[0458] The compounds of the present invention have activity as cyclin E1 degraders and are selective for the degradation of GSPT1. Therefore, the compounds of the present invention can be used to treat cancer and other proliferative diseases while reducing or minimizing the side effects associated with GSPT1 degradation. Thus, the present invention fulfills the aforementioned need by providing compounds that are useful for reducing cyclin E1 levels and are selective for the degradation of GSPT1.

[0459] Inhibition of cyclin E1 cytolysis and PB1 phosphorylation (Western blot) This assay measured the ability of compounds to degrade cyclin E1, inhibit RB phosphorylation, and determine their selectivity for GSPT1 degradation in cancer cells in vitro. HCC1569 cells (ATCC #CRL-2330) were cultured in RPMI medium (Gibco, catalog A104910) containing 10% FBS (Gibco, catalog 10091148). Cells were seeded into 6-well tissue culture plates at a density of 0.5 million cells per well in 2 mL of medium. Cells were then incubated overnight in a cell culture incubator (5% CO2 and 37°C) to allow them to adhere to the plate. The following day, cells were dosed with the desired concentration of compound. Compounds were first resuspended in DMSO to make a 10 mM stock, and then diluted with medium to make a 20 μM stock. Cells were treated with compounds at different concentrations (ranging from 10 μM to 0.05 μM), and DMSO was used as a negative control. After compound administration, cell plates were incubated at 37°C and 5% CO2 for 24 hours. After 24 hours, the cell plates were placed on ice, the growth medium was carefully removed, and the cells were washed once with cold 1X PBS. Cells were lysed by adding 50 μL of ice-cold RIPA buffer containing protease and phosphatase inhibitors. The cells were mashed using a cell scraper, and the extract was transferred to a microcentrifuge tube and placed on ice. To ensure complete lysis, the cell extract was sonicated twice for 10 seconds at 20 kHz. The tube was centrifuged at 13K RPM for 15 minutes at 4°C to remove cell debris. The supernatant was then transferred to a new microcentrifuge tube and placed on ice. Total protein concentration was measured using a BCA assay kit (Thermo Scientific, cat# PI23227). Next, the desired amount of cell lysate, 3X LDS sample buffer (Invitrogen, cat # B0007, containing DTT as a reducing agent), and RIPA buffer were mixed to prepare 100 μL of 1 μg / μL protein sample. The protein sample was reduced and denatured by boiling at 90°C for 5 minutes. Next, 10 μg of total protein was loaded onto a 4-20% TGX gel (Bio-Rad) along with a colored molecular weight marker.Gel electrophoresis was performed at 90–130 V, and then the separated proteins were electrotransferred to a 0.2 μm nitrocellulose membrane (Bio-Rad cat#1704159). Blocking buffer was made from 1X TBST with 5% w / v nonfat dry milk. After transfer, the membrane was blocked by incubating it with 25 mL of blocking buffer for 1 hour. After blocking, the blot was washed once with 1X TBST for 5 minutes and then incubated overnight with primary antibodies (Cyclin E1 and GSPT1 1:2,000; β-Actin 1:10,000) diluted in blocking buffer with gentle agitation on a shaker. The next day, the incubated blots were washed three times for 5 minutes each with 15 mL of 1X TBST, then incubated with a species-appropriate HRP-conjugated secondary antibody (1:10,000 dilution) diluted in blocking buffer at room temperature for 1 hour with gentle agitation. The blots were then washed three times for 5 minutes with 1X TBST before protein detection. Proteins were then detected by incubating the blots with 2 mL of HRP detection reagent (Thermo Scientific cat# A38556) at room temperature for 1 minute. Excess reagent was poured off and carefully removed with a Kimwipe, and the chemiluminescent signal was detected using a Fluorchem imaging system. Primary antibodies: Cyclin E1-Cell Signaling, Catalog 20808; GSPT1-Cell Signaling, Catalog 14990; pS807 / 811 Rb1-Cell Signaling, Catalog 8516; β-Actin-Cell Signaling, Catalog 5125. Relative quantification of Western blots was performed using ImageJ software, and data were then normalized first to a loading control (β-actin) and then to DMSO-treated samples. DCs were calculated from nonlinear regression and sigmoidal dose-response curves using GraphPad Prism software. 50 Or EC 50 Calculate.

[0460] FIG. 1 shows that in HCC1569 cancer cells, Example 35 (i) induced the degradation of cyclin E1 protein in a dose-dependent manner (FIG. 1A); (ii) inhibited RB1 phosphorylation in a dose-dependent manner (FIG. 1B); and (iii) did not significantly degrade GSPT1 protein up to a concentration of 10 μM (FIG. 1C).

[0461] In vivo xenograft tumor efficacy experiments The anti-cancer effect of Example 35 was evaluated in a xenograft model by measuring the reduction in tumor volume in animals treated with Example 35 compared to vehicle control animals. 6 Tumor cells / 1:1 Matrigel® mix (0.2 mL total volume) was injected subcutaneously into female NSG mice (for NIHOVCAR3) and SCID mice (for HCC1569). Both types of mice were purchased from Jackson Laboratory. Tumors were 150–200 mm 3 Once the animals reached 100 mg / kg, they were randomly assigned to treatment groups (8-10 animals / group) for efficacy testing. Example 35 was administered by oral gavage (PO) at the doses and dosing schedules shown in Table 7. Tumor growth and body weights were measured twice weekly throughout the study to assess efficacy and signs of toxicity.

[0462] Example 35 was prepared in 10% ethanol, 10% Vitamin E-TPGS, 30% propylene glycol, and 50% PEG400 and administered by oral gavage (final volume 0.2 mL) at the doses shown in Table 7. Example 35 was prepared weekly and stored at room temperature. Vehicle was administered to the control group at a volume of 0.2 mL per mouse according to the administration schedule of Example 35.

[0463] The efficacy of each dose in each treatment group was calculated using the following formula: %ΔT / ΔC = [(TV T -TV T0 ) / (TV C -TV C0 )]x100%. Here, TV T and TV C indicates the final tumor volume of each treatment group and control group.T0 and TV C0 indicates the baseline tumor volume of the group. The percentage of tumor growth inhibition was calculated using the formula: %TGI = [100% - (%ΔT / ΔC)]. When %ΔT / ΔC was a negative value, the percentage of tumor growth regression was calculated using the following formula: %TGR = [(TV T -TV T0 ) / TV T0 ]x100%.

[0464] For Example 35, in vivo single-agent efficacy was evaluated against the HCC1569 breast cancer xenograft model and the NIHOVCAR3 ovarian cancer xenograft model. The study summary and results are shown in Table 19. [Table 36]

[0465] The studies shown in Table 19 and Figure 2 demonstrated that Example 35 was active in all three mouse xenograft models. Example 35 demonstrated dose-dependent antitumor activity in HCC1569, OVCAR3, and MKN1 xenografts with repeated administration. In the HCC1569 breast cancer xenograft model, Example 35 demonstrated a tumor growth inhibition (TGI) of 70% at a dose of 10 mpk QDx28 and a tumor growth inhibition (TGI) of 100% at doses of 30 mpk and 100 mpk QDx28. In the NIHOVCAR3 ovarian cancer xenograft model, Example 35 demonstrated a tumor growth inhibition (TGI) of 67% at a dose of 30 mpk QDx28, a tumor growth inhibition of 90% at a dose of 100 mpk QDx28, and a tumor growth regression (TGR) of -11% at a dose of 250 mpk QDx28. Example 35 showed a tumor growth inhibition (TGI) of 58% at a dose of 3 mpk QDx28; and 95% at a dose of 30 mpk QDx28; and a tumor growth regression (TGR) of -4% at a dose of 30 mpk QDx28 in an MKN1 gastric cancer xenograft model.

Claims

1. Formula (I) 【Chemistry 1】 [In the formula, R is 【Chemistry 2】 and L is -O-, -CH 2 -, -C(CH 3 ) 2 -, -CF 2 -, -NH-, -N(CH 3 )-,or 【Transformation 3】 and Ring A is phenyl, naphthalenyl, or benzo[b]thiophenyl; R 1 -OCH 3 , -OCH 2 CH 3 , -OCH(CH 3 ) 2 , -OCH 2 CH (CH 3 ) 2 , -OCHF 2 , -OCH 2 C(CH 3 ) 2 OH, -OCH 2 CH 2 OCH 3 , -OCH 2 C(O)OCH 3 , -OCH 2 C(O)NH 2 , -OCH 2 C(O)N(CH 3 ) 2 , -OCH 2 C(O)N(CH 3 ) (CH 2 CH 3 ), -OCH 2 CH 2 CH 2 (phenyl), -OCH 2 C(O) (morpholinyl), -O(C 4-6 -O(cycloalkyl), -O(hydroxycyclohexyl), -O(oxetanyl), -O(tetrahydrofuranyl), -O(tetrahydropyranyl), -O(oxepanyl), -O(phenyl), -O(pyridinyl), or O(acetylpiperidinyl); R 2 are F, Cl, -CH 3 , or -OCH 3 and Each R 3 are independently F, Cl, Br, -CH 3 , -CD 3 , -CHF 2 , -CF 3 , -OCH 3 or cyclopropyl; m is 0 or 1; and n is 0, 1, 2, or 3. a compound of the formula (I), a stereoisomer thereof, a tautomer thereof, or a salt thereof.

2. R is, 【Chemistry 4】 and R 1 But, -OCH 3 , -OCH 2 CH 3 , -OCH(CH 3 ) 2 , -OCHF 2 or -O(phenyl); and Each R 3 are independently F, Cl, Br, -CH 3 , or -OCH 3 That is, 2. The compound of claim 1, its stereoisomer, its tautomer, or its salt.

3. Ring A is phenyl; 2. The compound of claim 1, its stereoisomer, its tautomer, or its salt.

4. L is -O-; 2. The compound of claim 1, its stereoisomer, its tautomer, or its salt.

5. Ring A is phenyl; and L is -O-; 2. The compound of claim 1, its stereoisomer, its tautomer, or its salt.

6. R 1 Ga-OCH 3 , -OCH 2 CH 3 , or -OCH(CH 3 ) 2 That is, 2. The compound of claim 1, its stereoisomer, its tautomer, or its salt.

7. Ring A is phenyl; L is -O-; and R 1 But, -OCH 3 That is, 2. The compound of claim 1, its stereoisomer, its tautomer, or its salt.

8. The following structure: 【Transformation 5】 having 2. The compound of claim 1, a stereoisomer thereof, or a tautomer thereof.

9. The following structure: 【Transformation 6】 having The compound or its tautomer.

10. The following structure: 【Transformation 7】 having The compound or its tautomer.

11. The following structure: 【Transformation 8】 having 2. The compound of claim 1, a stereoisomer thereof, or a tautomer thereof.

12. The following structure: 【Chemistry 9】 having The compound or its tautomer.

13. The following structure: 【Chemistry 10】 having The compound or its tautomer.

14. The following structure: 【Chemistry 11】 having 2. The compound of claim 1, a stereoisomer thereof, or a tautomer thereof.

15. The following structure: 【Chemistry 12】 having The compound or its tautomer.

16. The following structure: 【Chemistry 13】 having The compound or its tautomer.

17. The compound is [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (1); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (2); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)phenyl]carbamate (3); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (4); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (5); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3-fluorophenyl)methyl]phenyl}carbamate (6); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(1-phenylcyclopropyl)phenyl]carbamate (7); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3-fluorophenyl)(methyl)amino]phenyl}carbamate (8); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3-fluorophenyl)amino]phenyl}carbamate (9); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-bromophenoxy)phenyl]carbamate (10); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-methylphenoxy)phenyl]carbamate (11); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-dimethylphenoxy)phenyl]carbamate (12); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)phenyl]carbamate (13); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chloro-4-fluorophenoxy)phenyl]carbamate (14); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (15); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(3-fluorophenoxy)phenyl]carbamate (16); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3,4-difluorophenyl)methyl]phenyl}carbamate (17); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3,4-difluorophenyl)methyl]-2-methylphenyl}carbamate (18); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3,4,5-trifluorophenyl)methyl]phenyl}carbamate (19); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{2-fluoro-4-[(3-fluorophenyl)methyl]phenyl}carbamate (20); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[(3-chloro-4-fluorophenyl)methyl]phenyl}carbamate (21); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)-2-fluorophenyl]carbamate (22); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (23); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)-2-fluorophenyl]carbamate (24); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-chloro-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (25); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)-2-fluorophenyl]carbamate (26); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-chloro-4-(3-fluorophenoxy)phenyl]carbamate (27); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluorophenoxy)phenyl]carbamate (28); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[difluoro(phenyl)methyl]phenyl}carbamate (29); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-fluorophenyl]carbamate (30); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-methoxyphenoxy)phenyl]carbamate (31); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-methoxyphenoxy)phenyl]carbamate (32); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methoxyphenoxy)-2-methylphenyl]carbamate (33); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-methoxy-4-(2,4,5-trifluorophenoxy)phenyl]carbamate (34); {2-[(3S)-2,6-dioxopiperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (35); {2-[(3R)-2,6-dioxopiperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (36); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)-2-methoxyphenyl]carbamate (37); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-methylphenyl]carbamate (38); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)-2-methylphenyl]carbamate (39); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-methyl-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (40); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-phenylpropan-2-yl)phenyl]carbamate (41); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-methylphenyl]carbamate (42); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(2,4,5-trifluorophenoxy)phenyl]carbamate (43); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4,5-trifluorophenoxy)phenyl]carbamate (44); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-methyl-4-(2,4,5-trifluorophenoxy)phenyl]carbamate (45); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-chloro-4-(3,4-difluorophenoxy)phenyl]carbamate (46); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-methoxyphenyl]carbamate (47); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)-2-methoxyphenyl]carbamate (48); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-methoxyphenyl]carbamate (49); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-2-methoxyphenoxy)-2-methoxyphenyl]carbamate (50); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)-2-methylphenyl]carbamate (51); [2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (52); [2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (53); [2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)phenyl]carbamate (54); [2-(2,6-dioxopiperidin-3-yl)-4-ethoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (55); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (56); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (57); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)phenyl]carbamate (58); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)phenyl]carbamate (59); [4-(difluoromethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (60); [4-(difluoromethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (61); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (62); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (63); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (64); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-fluorophenoxy)phenyl]carbamate (65); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl]carbamate (66); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (67); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)phenyl]carbamate (68); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (69); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-phenoxy-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (70); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-chloro-3-fluorophenoxy)phenyl]carbamate (71); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-methoxy-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (72); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methylphenoxy)-2-methoxyphenyl]carbamate (73); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methylphenoxy)-2-methylphenyl]carbamate (74); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-2-methylphenoxy)-2-methoxyphenyl]carbamate (75); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-2-methylphenoxy)-2-methylphenyl]carbamate (76); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4,5-trifluorophenoxy)phenyl]carbamate (77); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methylphenoxy)phenyl]carbamate (78); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-fluorophenoxy)phenyl]carbamate (79); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl]carbamate (80); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-2-methylphenoxy)phenyl]carbamate (81); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-3-methylphenoxy)-2-methylphenyl]carbamate (82); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chloro-4-fluorophenoxy)-2-methylphenyl]carbamate (83); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)phenyl]carbamate (84); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-(difluoromethyl)phenoxy]phenyl}carbamate (85); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-(difluoromethyl)phenoxy]-2-fluorophenyl}carbamate (86); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-cyclopropylphenoxy)phenyl]carbamate (87); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-(difluoromethyl)phenoxy]-2-methoxyphenyl}carbamate (88); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-(difluoromethyl)-4-fluorophenoxy]phenyl}carbamate (89); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{2-chloro-4-[2-(trifluoromethyl)phenoxy]phenyl}carbamate (90); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-chloro-3-fluorophenoxy)-2-fluorophenyl]carbamate (91); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-{4-[2-( 2 H 3 ) methylphenoxy]phenyl}carbamate (92); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(2-methoxy-4-phenoxyphenyl)carbamate (93); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4,5-difluoro-2-methylphenoxy)-2-fluorophenyl]carbamate (94); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluoro-2-methylphenoxy)phenyl]carbamate (95); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-3-methylphenoxy)phenyl]carbamate (96); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluoro-3-methylphenoxy)-2-methoxyphenyl]carbamate (97); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chloro-4-fluorophenoxy)-2-fluorophenyl]carbamate (98); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluoro-3-methylphenoxy)phenyl]carbamate (99); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chloro-4-fluorophenoxy)-2-methoxyphenyl]carbamate (100); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-methylphenoxy)phenyl]carbamate (101); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (102); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)-2-methylphenyl]carbamate (103); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)-2-methoxyphenyl]carbamate (104); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)-2-fluorophenyl]carbamate (105); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-5-fluorophenoxy)phenyl]carbamate (106); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)-2-fluorophenyl]carbamate (107); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4,5-difluorophenoxy)-2-methoxyphenyl]carbamate (108); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4,5-difluorophenoxy)-2-fluorophenyl]carbamate (109); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)phenyl]carbamate (110); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-3-fluorophenoxy)phenyl]carbamate (111); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,6-difluorophenoxy)phenyl]carbamate (112); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(naphthalen-1-yloxy)phenyl]carbamate (113); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(1-benzothiophen-5-yloxy)phenyl]carbamate (114); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(1-benzothiophen-6-yloxy)phenyl]carbamate (115); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-dichlorophenoxy)-2-fluorophenyl]carbamate (116); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-dichlorophenoxy)-2-fluorophenyl]carbamate (117); [2-(2,6-dioxopiperidin-3-yl)-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-dichlorophenoxy)-2-fluorophenyl]carbamate (118); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (119); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)phenyl]carbamate (120); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-fluorophenoxy)phenyl]carbamate (121); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl]carbamate (122); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (123); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (124); {2-[(3S)-2,6-dioxopiperidin-3-yl]-3-oxo-4-(propan-2-yloxy)-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (125); [4-cyclobutoxy-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (126); [4-cyclobutoxy-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl]carbamate (127); [4-cyclobutoxy-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (128); [2-(2,6-dioxopiperidin-3-yl)-4-(oxetan-3-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (129); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (130); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chlorophenoxy)phenyl]carbamate (131); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (132); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)phenyl]carbamate (133); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (134); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluorophenoxy)phenyl]carbamate (135); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-fluorophenyl]carbamate (136); [4-(cyclohexyloxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (137); [2-(2,6-dioxopiperidin-3-yl)-4-(2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (138); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (139); [2-(2,6-dioxopiperidin-3-yl)-4-(oxan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)-2-fluorophenyl]carbamate (140); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (141); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (142); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-fluorophenoxy)phenyl]carbamate (143); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(4-fluorophenoxy)phenyl]carbamate (144); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (145); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (146); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluorophenoxy)phenyl]carbamate (147); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-fluorophenyl]carbamate (148); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)-2-fluorophenyl]carbamate (149); [2-(2,6-dioxopiperidin-3-yl)-4-[(3R)-oxan-3-yloxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (150); [4-(cyclopentyloxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (151); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3S)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (152); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (153); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (154); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2-chloro-4-fluorophenoxy)phenyl]carbamate (155); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,3-difluorophenoxy)phenyl]carbamate (156); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)phenyl]carbamate (157); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-[(3R)-oxolan-3-yloxy]-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3-chlorophenoxy)phenyl]carbamate (158); [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (159); [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (160); [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (161); [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(4-fluorophenoxy)phenyl]carbamate (162); [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(2,4-difluorophenoxy)-2-fluorophenyl]carbamate (163); [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,5-difluorophenoxy)-2-fluorophenyl]carbamate (164); [2-(2,6-dioxopiperidin-3-yl)-4-(2-hydroxy-2-methylpropoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[2-fluoro-4-(3,4,5-trifluorophenoxy)phenyl]carbamate (165); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-{[(1r,4r)-4-hydroxycyclohexyl]oxy}-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (166); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-{[(1s,4s)-4-hydroxycyclohexyl]oxy}-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (167); [2-(2,6-dioxopiperidin-3-yl)-4-(2-methoxyethoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (168); [2-(2,6-dioxopiperidin-3-yl)-4-(2-methoxyethoxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)-2-fluorophenyl]carbamate (169); [2-(2,6-dioxopiperidin-3-yl)-4-(oxepan-4-yloxy)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (170); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(pyridin-3-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-(4-phenoxyphenyl)carbamate (171); [2-(2,6-dioxopiperidin-3-yl)-3-oxo-4-(pyridin-3-yloxy)-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (172); {2-[(3S)-2,6-dioxopiperidin-3-yl]-3-oxo-4-(3-phenylpropoxy)-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (173); 2-({5-[({[4-(3,4-difluorophenoxy)phenyl]carbamoyl}oxy)methyl]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-4-yl}oxy)methyl acetate (174); {4-[(dimethylcarbamoyl)methoxy]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (175); [4-(carbamoylmethoxy)-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (176); [2-(2,6-dioxopiperidin-3-yl)-4-{[ethyl(methyl)carbamoyl]methoxy}-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (177); [2-(2,6-dioxopiperidin-3-yl)-4-[2-(morpholin-4-yl)-2-oxoethoxy]-3-oxo-2,3-dihydro-1H-isoindol-5-yl]methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (178); {4-[(1-acetylpiperidin-4-yl)oxy]-2-(2,6-dioxopiperidin-3-yl)-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (179); or {2-[(3S)-2,6-dioxo(3,4,4,5,5- 2 H 5 )piperidin-3-yl]-4-methoxy-3-oxo-2,3-dihydro-1H-isoindol-5-yl}methyl N-[4-(3,4-difluorophenoxy)phenyl]carbamate (180) 2. The compound of claim 1, wherein:

18. 10. A pharmaceutical composition comprising a compound of claim 1, its tautomer, or a pharmaceutically acceptable salt thereof; and a pharmaceutically acceptable carrier.

19. 10. A pharmaceutical composition comprising a compound of claim 9 or a tautomer thereof; and a pharmaceutically acceptable carrier.

20. 11. A pharmaceutical composition comprising a compound of claim 10 or a tautomer thereof; and a pharmaceutically acceptable carrier.

21. 12. A pharmaceutical composition comprising a compound of claim 11 or a tautomer thereof; and a pharmaceutically acceptable carrier.

22. 13. A pharmaceutical composition comprising a compound of claim 12 or a tautomer thereof; and a pharmaceutically acceptable carrier.

23. 14. A pharmaceutical composition comprising a compound of claim 13 or a tautomer thereof; and a pharmaceutically acceptable carrier.

24. 16. A pharmaceutical composition comprising a compound of claim 15 or a tautomer thereof; and a pharmaceutically acceptable carrier.

25. 17. A pharmaceutical composition comprising a compound of claim 16 or a tautomer thereof; and a pharmaceutically acceptable carrier.

26. A cancer therapeutic agent comprising the compound according to any one of claims 1 to 17, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

27. 27. The method of claim 26, wherein the cancer is selected from colon cancer, gastric cancer, pancreatic cancer, breast cancer, prostate cancer, lung cancer, ovarian cancer, cervical cancer, kidney cancer, head and neck cancer, lymphoma, leukemia, and melanoma.

28. 27. The therapeutic agent of claim 26, further characterized by administering a second agent selected from a PD1 / PD-L1 antagonist, a CTLA4 antagonist, a chemotherapeutic agent, radiation, or an anti-tumor vaccine before, simultaneously with, or after administration of the therapeutic agent.

29. The therapeutic agent of claim 26, wherein the therapeutic agent reduces cyclin E1 protein levels, and the cyclin E1 is an amino acid sequence encoded by SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, or 9.

30. 30. The therapeutic agent of claim 29, wherein the cyclin E1 protein level is reduced by at least 50%.

31. A cancer therapeutic agent comprising the compound according to claim 9, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

32. 32. The method of claim 31, wherein the cancer is selected from colon cancer, gastric cancer, pancreatic cancer, breast cancer, prostate cancer, lung cancer, ovarian cancer, cervical cancer, kidney cancer, head and neck cancer, lymphoma, leukemia, and melanoma.

33. 32. The therapeutic agent of claim 31, further characterized by administering a second agent selected from a PD1 / PD-L1 antagonist, a CTLA4 antagonist, a chemotherapeutic agent, radiation, or an anti-tumor vaccine before, simultaneously with, or after administration of the therapeutic agent.

34. A cancer therapeutic agent comprising the compound according to claim 10, its tautomer, or a pharmaceutically acceptable salt thereof.

35. 35. The method of claim 34, wherein the cancer is selected from colon cancer, gastric cancer, pancreatic cancer, breast cancer, prostate cancer, lung cancer, ovarian cancer, cervical cancer, kidney cancer, head and neck cancer, lymphoma, leukemia, and melanoma.

36. 35. The therapeutic agent of claim 34, further characterized by administering a second agent selected from a PD1 / PD-L1 antagonist, a CTLA4 antagonist, a chemotherapeutic agent, radiation, or an anti-tumor vaccine before, simultaneously with, or after administration of the therapeutic agent.

37. A cancer therapeutic agent comprising the compound of claim 12, its tautomer, or a pharmaceutically acceptable salt thereof.

38. 38. The method of claim 37, wherein the cancer is selected from colon cancer, gastric cancer, pancreatic cancer, breast cancer, prostate cancer, lung cancer, ovarian cancer, cervical cancer, kidney cancer, head and neck cancer, lymphoma, leukemia, and melanoma.

39. 38. The therapeutic agent of claim 37, further characterized by administering a second agent selected from a PD1 / PD-L1 antagonist, a CTLA4 antagonist, a chemotherapeutic agent, radiation, or an anti-tumor vaccine before, simultaneously with, or after administration of the therapeutic agent.

40. A cancer therapeutic agent comprising the compound of claim 13, a tautomer thereof, or a pharmaceutically acceptable salt thereof.

41. 41. The method of claim 40, wherein the cancer is selected from colon cancer, gastric cancer, pancreatic cancer, breast cancer, prostate cancer, lung cancer, ovarian cancer, cervical cancer, kidney cancer, head and neck cancer, lymphoma, leukemia, and melanoma.

42. 41. The therapeutic agent of claim 40, further characterized by administering a second agent selected from a PD1 / PD-L1 antagonist, a CTLA4 antagonist, a chemotherapeutic agent, radiation, or an anti-tumor vaccine before, simultaneously with, or after administration of the therapeutic agent.

43. 16. A cancer therapeutic agent comprising the compound of claim 15, its tautomer, or a pharmaceutically acceptable salt thereof.

44. 44. The method of claim 43, wherein the cancer is selected from colon cancer, gastric cancer, pancreatic cancer, breast cancer, prostate cancer, lung cancer, ovarian cancer, cervical cancer, kidney cancer, head and neck cancer, lymphoma, leukemia, and melanoma.

45. 44. The therapeutic agent of claim 43, further characterized by administering a second agent selected from a PD1 / PD-L1 antagonist, a CTLA4 antagonist, a chemotherapeutic agent, radiation, or an anti-tumor vaccine before, simultaneously with, or after administration of the therapeutic agent.

46. 17. A cancer therapeutic agent comprising the compound of claim 16, its tautomer, or a pharmaceutically acceptable salt thereof.

47. 47. The method of claim 46, wherein the cancer is selected from colon cancer, gastric cancer, pancreatic cancer, breast cancer, prostate cancer, lung cancer, ovarian cancer, cervical cancer, kidney cancer, head and neck cancer, lymphoma, leukemia, and melanoma.

48. 47. The therapeutic agent of claim 46, further characterized by administering a second agent selected from a PD1 / PD-L1 antagonist, a CTLA4 antagonist, a chemotherapeutic agent, radiation, or an anti-tumor vaccine before, simultaneously with, or after administration of the therapeutic agent.

Images