Patents
Literature
14410 results about "Pharmaceutical medicine" patented technology
Efficacy Topic
Property
Owner
Technical Advancement
Application Domain
Technology Topic
Technology Field Word
Patent Country/Region
Patent Type
Patent Status
Application Year
Inventor
Pharmaceutical medicine is a medical discipline concerned with the discovery, evaluation, registration, monitoring and clinical aspects of pharmaceutical development. All medical specialties overlap to some extent, and likewise the boundaries of pharmaceutical medicine are elastic. But, at its centre is the clinical testing of medicines, translation of pharmaceutical drug research into new medicines, safety and well-being of patients and research participants in clinical trials, and understanding the safety profile of medicines and their benefit-risk balance. Pharmaceutical physicians work in the pharmaceutical industry, universities / medical schools, drug regulatory authorities and contract research organisations, but have a close affinity with their medical colleagues elsewhere.
Fused ring compound and use thereof in KRAS inhibitor
PCT designated stage expiredWO2025077770A1Organic active ingredientsOrganic chemistryMetaboliteKras mutation
A fused ring compound, a pharmaceutical composition comprising same, and the use thereof. The compound has a structure as represented by formula (I), or is a tautomer, a mesomer, a racemate, an enantiomer, a diastereomer or a mixture form thereof, a metabolite, a metabolic precursor, an isotope-substituted form, a pharmaceutically acceptable salt, a hydrate, a solvate, a polymorph or a co-crystal thereof. The compound can be used for treating one or more cancers caused by KRAS mutation.
Owner:CHENGDU HYPERWAY PHARM CO LTD +1
Fused ring compound and use
PCT designated stage expiredWO2025077663A1Organic active ingredientsOrganic chemistryMetaboliteKras mutation
A fused ring compound, a pharmaceutical composition comprising same, and a use. The compound has a structure represented by formula (I) or a tautomer, mesomere, racemate, enantiomer, diastereomer or mixture thereof, metabolite, metabolic precursor, isotope substitution form, pharmaceutically acceptable salt, hydrate, solvate, polymorph or eutectic thereof. The compound can be used for treating a cancer caused by KRAS mutations, and said cancer is selected from one or more cancers caused by KRAS G12C, KRAS G12V, KRAS G12A and G12D mutations. In particular, the compound can serve as a G12D inhibitor and has relatively high inhibitory activity.
Owner:CHENGDU HYPERWAY PHARM CO LTD +1
Compositions and methods of use for modified release minoxidil
The compositions and methods provided herein include a pharmaceutical formulation for oral administration comprising a daily dose of a modified release formulation of minoxidil or a pharmaceutically acceptable salt thereof. Also provided herein are pharmaceutical formulations for oral administration comprising a daily dose of a modified release formulation of minoxidil or a pharmaceutically acceptable salt thereof and one or more additional active agents. Also provided herein are methods of treating hair loss by administering to a subject in need thereof a daily dose of a modified release formulation of minoxidil or a pharmaceutically acceptable salt thereof. Further provided herein is a kit including a slow modified release vehicle comprising oral minoxidil or a pharmaceutically acceptable salt thereof.
Owner:VERADERMICS INC
Macrocyclic compound containing amide substitution
PCT designated stage expiredWO2025119392A1Organic active ingredientsOrganic chemistryDiseasePharmaceutical drug
The present application relates to the technical field of medicines, and relates to a macrocyclic compound containing amide substitution, in particular to a compound as shown in formula (I) or a pharmaceutically acceptable salt thereof, and a preparation method therefor, a pharmaceutical composition containing the compound, and a use thereof in the treatment of disease.
Owner:CHIA TAI TIANQING PHARMA GRP CO LTD
GLP-1R and GCGR double-target-activated polypeptide or derivative thereof, pharmaceutically acceptable salt and application of polypeptide or derivative and pharmaceutically acceptable salt
The invention provides a polypeptide or a derivative and a pharmaceutically acceptable salt thereof. The amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1. The polypeptide or the derivative and the pharmaceutically acceptable salt thereof disclosed by the invention can be combined with GLP-1R and GCGR, and is used for effectively activating the GLP-1R and the GCGR. Therefore, the polypeptide or the derivative and the pharmaceutically acceptable salt thereof can be used for detecting GLP-1R and / or GCGR, and can also be used for treating or preventing GLP-1R and / or GCGR related diseases (such as metabolic disorder related diseases, such as obesity, diabetes, fatty liver diseases, non-alcoholic fatty liver diseases and the like).
Owner:TENCENT TECHNOLOGY (SHENZHEN) CO LTD
KRAS g12d degraders and uses thereof
PCT designated stage expiredWO2025151765A1Organic active ingredientsOrganic chemistryMutated proteinKRAS
The invention relates to compounds of Formula I, II II-1, III, or III-1 and pharmaceutically acceptable salts thereof, and methods of making and using the same. The compounds of the invention are effective in inhibiting and / or degrading KRAS protein with a G12D mutation and are suitable for use in methods of treating cancers mediated, in whole or in part, by KRAS G12D mutation.
Owner:1200 PHARMA LLC
Indole derivative as ras inhibitor, and use thereof
Owner:SHANDONG SIMCERE BIO PHARMA CO LTD
Macrocyclic compounds as ras inhibitors for the treatment of cancer
PCT designated stageWO2025214350A1Organic active ingredientsOrganic chemistryPharmaceutical drugPharmaceutical medicine
Related to macrocyclic compounds and therapeutic uses thereof. Disclosed a compound of formula (I), or a pharmaceutically acceptable salt thereof, a solvate thereof or a solvate of the pharmaceutically acceptable salt, and their use for the preparation of a medicament of treatment of cancer. Provided herein are useful compounds for the inhibition of RAS mutant and the compound shows good inhibitory activity against RAS.
Owner:SUNRISE ONCOLOGY (HONG KONG) LTD
Fused tetracyclic compounds and use thereof
PCT designated stage expiredWO2025146194A1Organic active ingredientsOrganic chemistryPharmaceutical medicineMedicinal chemistry
The invention relates to compounds of formula (I), a stereoisomer thereof, a pharmaceutically acceptable salt thereof, a pharmaceutically acceptable salt of the stereoisomer thereof, a prodrug thereof, a deuterated molecule thereof or a PROTAC molecule thereof that selectively inhibit the activity of K-Ras G12D protein, compositions comprising the same, the methods of using the same and related intermediates.
Owner:JACOBIO PHARMACEUTICALS CO LTD
Pan-ras inhibitor compound
PCT designated stageWO2025209533A1Organic active ingredientsOrganic chemistryImmunologic disordersAutoimmune condition
The present invention relates to a compound as shown in formula (A) having a pan-RAS inhibitory effect, or an isotopic derivative or stereoisomer thereof, or a pharmaceutically acceptable salt thereof, and a pharmaceutical composition containing the compound, and the use of the compound of formula (A) in the prevention and / or treatment of cancers, tumors, inflammatory diseases, autoimmune diseases or immune-mediated diseases.
Owner:ADLAI NORTYE BIOPHARMA CO LTD
Formulations comprising triptan compounds
The invention provides a pharmaceutical composition for intranasal administration comprising a salt of sumatriptan or a physiologically acceptable solvate thereof, an alkyl glycoside or saccharide alkyl ester and optionally at least one pharmaceutically acceptable excipient, wherein the said composition provides Tmax value of less than 30 minutes upon said administration. Other aspects and embodiments are contemplated and described.The invention also provides a pharmaceutical composition for intranasal administration comprising a triptan, a pharmaceutically acceptable vehicle and a mucosal permeation enhancer, wherein upon said administration said composition provides a Tmax substantially equivalent to subcutaneous administration of said triptan. Other aspects and embodiments are contemplated and described.
Owner:TONIX MEDICINES INC
Heterocyclic conjugates and uses thereof
PCT designated stageWO2025171055A1Pharmaceutical non-active ingredientsAntineoplastic agentsCombinatorial chemistryPharmaceutical medicine
The present disclosure provides compounds and pharmaceutically acceptable salts thereof, and methods of using the same. The compounds and methods have a range of utilities as therapeutics, diagnostics, and research tools. In particular, the subject compositions and methods are useful for reducing signaling output of oncogenic protein.
Owner:KUMQUAT BIOSCIENCES INC
Spiro compound, and preparation method therefor and use thereof
A spiro compound, and a preparation method therefor and a use thereof. Specifically, the present invention relates to a compound of formula (I) or a pharmaceutically acceptable salt, stereoisomer, tautomer, polymorph, solvate, N-oxide, isotopically labeled compound, metabolite, or prodrug thereof, a pharmaceutical composition comprising the compound, a preparation method therefor, and a use thereof in preparation of a drug for preventing or treating KRAS-mediated related diseases.
Owner:SICHUAN KELUN BIOTECH BIOPHARMACEUTICAL CO LTD
Quinazoline compound, and pharmaceutical composition thereof and use thereof
Disclosed in the present invention are a quinazoline compound, and a pharmaceutical composition thereof and the use thereof. Provided in the present invention is a compound as represented by formula I, a stereoisomer thereof or a pharmaceutically acceptable salt thereof. The compounds of the present invention have a good degradation effect on the KRAS protein with a G12D mutation, have a good inhibitory activity against the proliferation of tumor cells with a KRAS G12D mutation, and exhibit good pharmacokinetic properties.
Owner:HANGZHOU POLYMED BIOPHARMACEUTICALS INC
Substituted 2-(pyrrolidin-3-yl)acetic acid derivative, preparation method therefor and use thereof
PCT designated stage expiredWO2025103442A1Organic active ingredientsOrganic chemistryAcetic acidPharmaceutical medicine
The present invention provides a compound as shown in formula (I), and a pharmaceutically acceptable salt of the compound. The compound in the present invention exhibits a strong inhibitory effect on Lp(a) assembly, and can be used for treating cardiovascular diseases (CVD).
Owner:INNOVSTONE THERAPEUTICS LIMITED
Macrocyclic compounds as modulators of KRAS and uses thereof
PCT designated stageWO2025194057A1Organic active ingredientsOrganic chemistryPharmaceutical drugPharmaceutical medicine
Disclosed herein are compounds useful for the inhibition of KRAS G12D, G12V, G12A, G12S, G12R, G13D, Q61H, Q61L, Q61R or G12C. The compounds have a general Formula (I): or pharmaceutically acceptable salts thereof, wherein the variables of Formula (I) are as defined herein. Also provided herein are pharmaceutical compositions comprising the compounds, uses of the compounds, and compositions for treatment of, for example, a KRAS G12D, G12V, G12A, G12S, G12R, G13D, Q61H, Q61L, Q61R or G12C disorder.
Owner:AMGEN INC
Spiro compound as KRAS mutant inhibitor
PCT designated stageWO2025190342A1Organic chemistryHeterocyclic compound active ingredientsKRASPharmaceutical drug
The present invention provides a compound of formula (I) or a pharmaceutically acceptable salt, isotopic variant, tautomer or stereoisomer thereof as a KRAS mutant inhibitor. The present invention also provides a pharmaceutical composition comprising the compound or the pharmaceutically acceptable salt, isotopic variant, tautomer or stereoisomer thereof, and a use in treating cancer.
Owner:SUZHOU PUHE BIOPHARMA CO LTD
Spirocyclic compounds as modulators of KRAS and uses thereof
PCT designated stageWO2025194054A1Organic active ingredientsOrganic chemistryChemical compoundPharmaceutical drug
Disclosed herein are compounds useful for the inhibition of KRAS G12D, G12V, G12A, G12S, G12R, G13D, Q61H, Q61L, Q61R or G12C. The compounds have a general Formula (I): (I) or pharmaceutically acceptable salts thereof, wherein the variables of Formula (I) are as defined herein. Also provided herein are pharmaceutical compositions comprising the compounds, uses of the compounds, and compositions for treatment of, for example, a KRAS G12D, G12V, G12A, G12S, G12R, G13D, Q61H, Q61L, Q61R or G12C disorder.
Owner:AMGEN INC
Methods of treatment for cystic fibrosis
This disclosure provides methods of treating cystic fibrosis or a CFTR-mediated disease comprising administering Compound I, a deuterated derivative thereof, or a pharmaceutically acceptable salt of any of the foregoing. The disclosure also provides pharmaceutical compositions comprising Compound I, a deuterated derivative thereof, or a pharmaceutically acceptable salt of any of the foregoing, and optionally comprising one or more additional CFTR-modulating agents.
Owner:VERTEX PHARMACEUTICALS INC
Small molecule inhibitors of KRAS proteins
PCT designated stageWO2025235740A1Organic active ingredientsOrganic chemistryCancer preventionPharmaceutical drug
Compounds of Formula (I) or their pharmaceutically acceptable salts can inhibit the G12C, G12D, G12V, and / or G13D mutants of Kirsten rat sarcoma (KRAS) protein and are expected to have utility as therapeutic agents, for example, for treating cancer. The disclosure also provides pharmaceutical compositions which comprise compounds of Formula (I) or pharmaceutically acceptable salts thereof. The disclosure also relates to methods for use of the compounds or their pharmaceutically acceptable salts in the therapy and prophylaxis of cancer and for preparing pharmaceuticals for this purpose.
Owner:MERCK SHARP & DOHME LLC
Pyridine derivatives with n-linked cyclic substituents as cgas inhibitors
PendingJP2025114527AOrganic active ingredientsSenses disorderPharmaceutical drugPharmaceutical medicine
To provide a compound which is a novel proline derivative, and to provide a pharmaceutical composition comprising the compound for the treatment of, for example, systemic sclerosis (SSc) and non-alcoholic steatohepatitis (NASH).SOLUTION: A pharmaceutical composition comprises, as a cGAS inhibitor, a compound which is a novel proline derivative encompassed by formula (I), or a prodrug, a pharmaceutically acceptable salt, or a stereoisomer of the compound.SELECTED DRAWING: None
Owner:BOEHRINGER INGELHEIM INT GMBH
Furan ring-containing compound as well as pharmaceutical composition and application thereof
The invention relates to a furan ring-containing compound as well as a pharmaceutical composition and application thereof. Specifically disclosed is a compound represented by formula I or a pharmaceutically acceptable salt thereof. The compound provided by the invention has one or more of the following advantages: (1) the structure is novel; (2) the compound has a good retarding effect (inhibiting effect) on the activity of a Nav1.8 channel; and (3) the compound has good selectivity to other subtypes of Nav and is high in safety. # imgabs0 #
Owner:WUHAN XIRUI PHARMACEUTICAL TECHNOLOGY CO LTD
GLP-1R activating polypeptide or pharmaceutically acceptable salt thereof and application thereof
The invention provides a polypeptide or a pharmaceutically acceptable salt of the polypeptide. The amino acid sequence of the polypeptide is as shown in HSQGTFTSDYSKYLEEAAAAEFVAWLLAGG. The invention further provides a preparation method of the polypeptide. The polypeptide or the pharmaceutically acceptable salt thereof can be combined with the GLP-1R and is used for effectively activating the GLP-1R. Therefore, the polypeptide or the pharmaceutically acceptable salt thereof can be used for effectively treating metabolic disorder related diseases (such as obesity, diabetes, dyslipidemia related diseases, fatty liver diseases, metabolic syndromes and non-alcoholic fatty liver diseases).
Owner:TENCENT TECHNOLOGY (SHENZHEN) CO LTD
Small molecule inhibitors of KRAS proteins
PCT designated stageWO2025230961A1Organic chemistryHeterocyclic compound active ingredientsCancer preventionPharmaceutical drug
Compounds of Formula (I) or their pharmaceutically acceptable salts can inhibit the G12C, G12D, G12V, and / or G13D mutants of Kirsten rat sarcoma (KRAS) protein and are expected to have utility as therapeutic agents, for example, for treating cancer. The disclosure also provides pharmaceutical compositions which comprise compounds of Formula (I) or pharmaceutically acceptable salts thereof. The disclosure also relates to methods for use of the compounds or their pharmaceutically acceptable salts in the therapy and prophylaxis of cancer and for preparing pharmaceuticals for this purpose.
Owner:MERCK SHARP & DOHME LLC
Macrocyclic derivative as ras inhibitor and use thereof
PCT designated stageWO2025242220A1Organic active ingredientsOrganic chemistryDiseasePharmaceutical drug
Owner:SHANDONG SIMCERE BIO PHARMA CO LTD
Cystic fibrosis transmembrane conductance regulator modulating agents
ActiveUS12421251B2Group 4/14 element organic compoundsPreparation by hydrogen halide split-offFibrosisCystic fibrosis transmembrane conductance regulator
Compound (I), deuterated derivatives, and pharmaceutically acceptable salts of any of the foregoing are disclosed. Methods of treating cystic fibrosis using these compounds are also disclosed.
Owner:VERTEX PHARMACEUTICALS INC
Formulations of vimseltinib
ActiveUS12447149B2Organic active ingredientsOrganic chemistryCombinatorial chemistryPharmaceutical medicine
Owner:DECIPHERA PHARMACEUTICALS LLC
Imidazol-2-one derivative and use thereof in medicine
PCT designated stage expiredWO2025103443A1Organic active ingredientsOrganic chemistryDiabetes mellitusMetabolite
Provided in the present invention are a tetrahydropyridopyrazole derivative and use thereof in medicine. Specifically provided is a compound as shown in general formula (I) or a racemate, stereoisomer, tautomer, deuterated substance, solvate, prodrug, metabolite, pharmaceutically acceptable salt or eutectic crystal thereof, an intermediate thereof, a preparation method therefor, and use thereof in the preparation of a related drug for treating diabetes or obesity.
Owner:HAISCO PHARMACEUTICAL GROUP CO LTD
Small molecule protein degraders of KRAS g12d mutant
PCT designated stageWO2025240740A1Organic active ingredientsOrganic chemistryChemical compoundPharmaceutical drug
Compounds or their pharmaceutically acceptable salts can modulate the G12D mutant of Kirsten rat sarcoma (KRAS) protein and are expected to have utility as therapeutic agents, for example, for treating cancer. The disclosure also provides pharmaceutical compositions which comprise compounds disclosed herein or pharmaceutically acceptable salts thereof. The disclosure also relates to methods for use of the compounds or their pharmaceutically acceptable salts in the therapy and prophylaxis of cancer and for preparing pharmaceuticals for this purpose.
Owner:MERCK SHARP & DOHME LLC