Anti-fungal VHH antibodies
VHH antibodies targeting fungal species provide effective anti-fungal activity by retarding fungal growth or causing spore lysis, even at high salt concentrations, addressing the limitations of current anti-fungal agents and proteinaceous pesticides.
Patent Information
- Application Number
- PCT/EP2024/088373
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-07-03
- Filing Date
- 2024-12-23
- Publication Date
- 2025-06-26
AI Technical Summary
Current anti-fungal agents face challenges due to selective pressure leading to resistant fungal strains, and proteinaceous pesticides struggle with stability and efficacy in agricultural formulations, especially at high salt concentrations.
Development of VHH antibodies that bind to fungal species, causing retardation of growth or lysis of fungal spores, and maintaining efficacy at elevated salt concentrations, potentially combined with cell wall disrupting agents.
The VHH antibodies demonstrate effective fungicidal or fungistatic activity, maintaining potency and stability in high salt environments, which could reduce treatment dosages and side effects in both agricultural and medical applications.
Smart Images

Figure IMGF000083_0001 
Figure IMGF000017_0001 
Figure IMGF000018_0001
Abstract
Description
[0001] ANTI-FUNGAL VHH ANTIBODIES
[0002] Field of the invention
[0003] The present invention relates to VHH antibodies that bind to at least one fungal species and to compositions containing the same. The VHH antibodies of the current invention comprises a complementarity determining region 1 (CDR1 ) region having the amino acid sequence set out in any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263; a CDR2 region having the amino acid sequence set out in any one of SEQ ID NO: 4, 91 to 1 15, 244, 257 and 264; and a CDR3 region having the amino acid sequence set out in any one of SEQ ID NO: 5, 1 16 to 140, 245, 258 and 265. The invention further relates to compositions. The invention relates to compositions comprising at least one VHH antibody according to the invention. The invention further relates to compositions comprising at least one VHH and at least one cell wall disrupting agent. The invention also relates to use of the compositions as an anti-fungal agent. The invention further relates to agrochemical compositions and methods of using the same. Additionally, the invention relates to a transgenic plant, plant part, seed, or plant cell. The invention further relates to polynucleotides encoding said VHH antibody. Finally, the invention relates to a method of manufacturing a variant VHH antibody.
[0004] The current invention is therefore situated in the field of VHH antibodies. More specifically, VHH antibodies that bind to at least one fungal species. The current invention situated in the field of antifungal compositions and methods of using said antifungal compositions. The current invention is also situated in the field of protecting or treating crops or plants from a plant pathogenic fungal infection.
[0005] Background
[0006] The presence and persistence of pathogenic fungal infections seen in patients and animals but also in plant crops can be mainly attributed to the selective pressure of broad-spectrum anti-fungals and the general lack of efficacy of anti- fungal agents, which are available at present.
[0007] In humans and animals, systemic fungal infections such as invasive candidiasis and invasive aspergillosis may be caused by a variety of fungal pathogens, for example the virulent Candida species C. albicans, C. tropicalis and C. krusei and the less virulent species C. parapsilosis and Torulopsis glabrata (the latter sometimes referred to as Candida glabrata). Although C. albicans was once the most common fungal isolate obtained from intensive care units, later studies have indicated that C. tropicalis, C. glabrata, C. parapsilosis and C. krusei now account for about half of such isolates. The rise of non-albicans species implies the emergence of Candida species resistant to conventional antifungal therapy.
[0008] Traditionally, C. albicans, C. tropicalis and C. parapsilosis have been treated by the antifungal agent amphotericin B, regarded as the "gold standard" of systemic antifungal therapy. Unfortunately, amphotericin B is itself highly toxic and its use is tempered by side effects including chills, fever, myalgia or thrombophlebitis. Other anti-fungal agents include the oral azole drugs (miconazole, ketoconazole, itraconazole, fluconazole) and 5-fluorocytosine. However, fungal species such as C. krusei and T. glabrata are resistant to fluconazole, and these species often occur in patients where this drug has been administered prophylactically. Furthermore, fluconazole-resistant strains of C. albicans have also been reported. Thus, despite the advances made in therapeutic anti-fungal drugs, the need for effective agents for treatment of fungal infections remains acute. In agriculture, crop protection relies heavily on the use of pesticides, which are applied to the crops by spraying them onto the crop, applying during watering of the crops or incorporating them into the soil. Pesticides are often organic chemical molecules and their repeated application to crops poses toxicity threats to both agricultural workers during handling and to the environment, due to spray drift, persistence in the soil or washing off into surface or ground water. It would be advantageous to be able to use alternative compounds that are less toxic to humans and the environment, but that at the same time provide effective control of plant pests. Proteinaceous pesticides with specificity against a certain plant pest target may be very advantageous in this respect, as they are expected to be short-lived in the environment and to have less toxic off-target effects. However, there are only a few proteinaceous or peptidergic pesticides known. Some examples are Bt toxins, lectins, defensins, fabatins, tachyplesin, magainin, harpin (see WO2010019442), pea albumin 1 -subunit b (PA1 b). However, these proteinaceous pesticides are either small peptides with compact structures, stabilized by several disulphide bridges, or are larger proteins (>300 amino acids) which occur in crystalline form (cry toxins). It is indeed known in the field of agriculture that biologicals, and in particular proteins, are challenging structures for developing pesticides, as they generally have far too little stability to maintain their pesticidal function in an agrochemical formulation, in particular for applications in the field. The current applicant has developed several proteinaceous pesticides based on heavy chain variable domain of a heavy chain antibody (VHH). For instance VHH binding to a glucosylceramide of a fungal pest were developed showing antifungal activity (WO 2014 / 177595, WO 2014 / 191146 and WO 2016 / 071438) and more recently a VHH interaction with a lipid fraction of fungal pests have shown the ability of VHH to cause retardation of growth of a spore and even lysis of a spore of a fungal pests such as the economically important fungal plant pests Botrytis cinerea (WO 2021 / 198396). However, there is still room for improvement. VHH molecules in agricultural and pharmaceutical settings need to perform even at high salt concentrations. It is known that high salt concentrations can impair the ability of an antibody to bind to its target due to the weakening electrostatic interactions and / or hydrogen bonds Janeway CA Jr, Travers P, Walport M, et al. Immunobiology: The Immune System in Health and Disease. 5th edition. New York: Garland Science; 2001. The interaction of the antibody molecule with specific antigen. Available from: https: / / www.ncbi.nlm.nih.gov / books / NBK27160 / ). Additionally, salts and more specifically the divalent cations such as Ca2+ have been shown to have membrane stabilising effects (EDTA-induced Membrane Fluidization and Destabilization: Biophysical Studies on Artificial Lipid Membranes Prachayasittikul Virapong Acta Biochi mica et Biophysica Sinica, 2007, Vol 39 (11), 901-913 DOI: 10.1111 / j. 1745- 7270.2007.00350.x). Therefore where a proteinaceous pesticides disrupts membrane integrity such as the molecules in WO 2021 / 198396, the presence of increased salt concentrations has the potential to decrease the biological activity of such molecules. Alternatively or in addition, the interaction with the cell wall of microorganisms can be influenced by the presence of salts and said interaction could potentially inactivate or reduce the activity of proteinaceous pesticides at elevated salt concentrations by hampering their ability to destabilise the membrane ( The interaction with fungal cell wall polysaccharides determines the salt tolerance of antifungal plant defensins Bleackley Mark R., Dawson Charlotte S., Payne Jennifer A.E., Harvey Peta J., Rosengren K. Johan, Quimbar Pedro, Garcia-Ceron Donovan, Lowe Rohan, Bulone Vincent, van der Weerden Nicole L., Craik David J., Anderson Marilyn A. The Cell Surface, 2019, Vol 5, 100026 DOI: 10.1016 / j.tcsw.2019.100026 PMID: 32743142). In agricultural applications proteinaceous pesticides are present and applied in a formulated product comprising several different compounds of which many can be salts, in addition agricultural formulations are often mixed with water prior to application of the product on crops. The water used in agricultural settings is often water with a high ion content including Ca2+ cations, proteinaceous pesticides therefore commonly encounter elevated salt concentrations. In conclusion, there is a need for VHHs with increased salt tolerance towards their binding characteristics and activity.
[0009] Summary of the invention
[0010] The present inventors have successfully developed VHH antibodies binding to pests, in particular plant, animal or human pathogenic pests, such as but not limited to plant, animal or human pathogenic fungi. More specifically, the present inventors have developed VHH antibodies which bind to at least one fungal species and hereby causing retardation of the growth of said at least one fungal species or lysis of a spore of said at least one fungal species and wherein said effect is maintained at elevated salt concentrations.
[0011] The mere binding of the VHH antibody may be sufficient for the fungicidal activity through retardation of growth and / or lysis and explosion of spores, thus preventing mycelium formation. The VHH antibody may therefore have fungicidal or fungistatic activity.
[0012] Moreover, these VHH antibodies retain their integrity, stability and activity in a composition and that efficacious pest or pathogenic control can surprisingly be achieved by applying compositions, comprising the VHH antibodies as disclosed in the present application, to crops, animals or humans. In addition, these VHH antibodies retain their integrity, stability and activity in a composition with elevated salt concentrations.
[0013] The efficacy and potency of the VHH antibodies at elevated salt concentrations as disclosed herein suggests a potential for either a lower treatment dosage and / or a more effective treatment at the same dose. In addition the ability to maintain efficacy and potency at elevated salt levels suggest improved stability in environments with higher salt concentrations, such as often encountered in pharmaceutical and agricultural settings. This can imply a reduction of unwanted side-effects and reduced toxicity in both agrochemical and medical applications. Moreover, this allows the application of lower amounts or dosages of the VHH antibodies or compositions disclosed herein.
[0014] In particular, the present inventors have developed VHH antibodies that are capable of preventing, protecting, treating or curing a plant, animal or human from (developing) an infection by a pathogen or from any other biological interaction with a pathogen, in particular a fungal pathogen. Therefore, the present invention demonstrates that biological molecules, such as VHH antibodies, can be used to effectively protect or treat a plant, animal or human from being damaged in any way by or from suffering from a biological interaction between the plant, animal or human and a pathogen, such as for instance through infection by a pathogen. Moreover, the present invention demonstrates that the VHH antibodies as disclosed herein do so even at elevated salt concentrations.
[0015] The VHH antibodies and compositions of the present invention can be used as stand-alone products, e.g. stand-alone compositions, such as an anti-fungal composition.
[0016] The VHH antibodies and compositions of the present invention can be used in a preventative or prophylactic manner, i.e. the first application occurs prior to disease presence.
[0017] The VHH antibodies and compositions of the present invention can be used as contact fungicides. According to the invention, there is thus provided a composition comprising at least one VHH antibody, which VHH antibody is capable of binding to at least one fungal species. The VHH antibody thereby causes retardation of growth of a spore of the said at least one fungal species and / or lysis of a spore of the said at least one fungal species. Whereby the VHH antibody causes retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species in the presence of elevated salt concentrations. That is to say, binding of the VHH antibody to at least one fungal species results in retardation of growth of a spore of the said at least one fungal species and / or lysis of a spore of the said at least one fungal species and this effect is maintained at elevated salt concentrations.
[0018] There is also provided a VHH antibody, which VHH antibody binds to at least one fungal species. The VHH antibody thereby causes retardation of growth of a spore of the said fungus and / or lysis of a spore of the said fungus. Whereby the VHH antibody causes retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species in the presence of elevated salt concentrations. That is to say, binding of the VHH antibody to the at least one fungal species results in retardation of growth of a spore of the said at least one fungal species and / or lysis of a spore of the said at least one fungal species and this effect is maintained at elevated salt concentrations.
[0019] Further, the invention provides a composition comprising at least one VHH antibody, which VHH antibody comprises the amino acid sequence set out in any one of SEQ ID NO: 2, 41 to 65 and 242, or an amino acid sequence having at least about 80% sequence identify thereto and which VHH antibody is capable of binding to at least one fungal species. The at least one VHH antibody as set out in SEQ ID NO:2, 41 to 65 and 242, may be encoded by a polynucleotide as set out in respectively SEQ ID NO: 1 , 16 to 40 and 241 (See Table 2 for a concise overview of the relationship between nucleotide sequence, amino acid sequence, CDR domains and FR domains of the VHH antibodies disclosed herein). In a more preferred embodiment the invention provides a composition comprising at least one VHH antibody, which VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2 or 242.
[0020] According to the invention, there is further provided a composition comprising at least one VHH antibody, which VHH antibody comprises: a CDR1 region having the amino acid sequence set out in any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263, a CDR2 region having the amino acid sequence set out in any one of SEQ ID NO: 4, 91 to 115, 244, 257 and 264, and a CDR3 region having the amino acid sequence set out in any one of SEQ ID NO: 5, 1 16 to 140, 245, 258 and 265, and which VHH antibody is capable of binding to at least one fungal species.
[0021] According to an embodiment of the invention, there is further provided a composition comprising at least one VHH antibody, which VHH antibody comprises: a CDR1 region having the amino acid sequence set out in SEQ ID NO: 256 or 263, a CDR2 region having the amino acid sequence set out in SEQ ID NO: 257 or 264, and a CDR3 region having the amino acid sequence set out in any one of SEQ ID NO: 258 or 265, and which VHH antibody is capable of binding to at least one fungal species.
[0022] In a further more specific embodiment of the invention, there is provided a composition comprising at least one VHH antibody, which VHH antibody comprises: a CDR1 region having the amino acid sequence set out in SEQ ID NO: 3 or 243, a CDR2 region having the amino acid sequence set out in SEQ ID NO: 4 or 244, and a CDR3 region having the amino acid sequence set out in any one of SEQ ID NO: 5 or 245, and which VHH antibody is capable of binding to at least one fungal species.
[0023] The invention also provides: a VHH antibody comprising the amino acid sequence set out in SEQ ID NO: 2, 41 to 65 and 242, or an amino acid sequence having at least about 80% sequence identify thereto, wherein said VHH antibody is capable of binding to at least one fungal species; and a polynucleotide as set out in any one of SEQ ID NO: 1 , 16 to 40 and 241 encoding for the at least one VHH antibody as set out in any one of SEQ ID NO: 2, 41 to 65 and 242 respectively (See Table 2); and a VHH antibody comprising a CDR1 region having the amino acid sequence set out in SEQ ID NO: 3, 66 to 90, 243, 256 and 263, a CDR2 region having the amino acid sequence set out in SEQ ID NO: 4, 91 to 115, 244, 257 and 264, and a CDR3 region having the amino acid sequence set out in SEQ ID NO: 5, 116 to 140, 245, 258 and 265, where said VHH antibody is capable of binding to at least one fungal species.
[0024] The invention also provides a VHH antibody comprising or consisting of the amino acid sequence set out in SEQ ID NO: 2, 41 to 65 and 242.
[0025] The invention also provides a VHH antibody having a CDR1 region comprising or consisting of the sequence set out in any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263, a CDR2 region comprising or consisting of the sequence set out in any one of SEQ ID NO: 4, 91 to 115, 244, 257 and 264, and a CDR3 region comprising or consisting of the sequence set out in any one of SEQ ID NO: 5, 1 16 to 140, 245, 258 and 265.
[0026] In an embodiment of the invention the VHH antibody has a CDR1 region comprising or consisting of the sequence set out in SEQ ID NO: 256, such as a CDR1 region comprising or consisting of the sequence set out in SEQ ID NO: 3; a CDR2 region comprising or consisting of the sequence set out in SEQ ID NO: 257, such as a CDR2 region comprising or consisting of the sequence set out in SEQ ID NO: 4; and a CDR3 region comprising or consisting of the sequence set out in SEQ ID NO: 258, such as a CDR3 region comprising or consisting of the sequence set out in SEQ ID NO: 5.
[0027] In another embodiment of the invention the VHH antibody has a CDR1 region comprising or consisting of the sequence set out in SEQ ID NO: 263, such as a CDR1 region comprising or consisting of the sequence set out in SEQ ID NO: 243; a CDR2 region comprising or consisting of the sequence set out in SEQ ID NO: 264, such as a CDR2 region comprising or consisting of the sequence set out in SEQ ID NO: 244; and a CDR3 region comprising or consisting of the sequence set out in SEQ ID NO: 265, such as a CDR3 region comprising or consisting of the sequence set out in SEQ ID NO: 245.
[0028] The invention also provides a VHH antibody comprising or consisting of the amino acid sequence set out in any one of SEQ ID NO: 2, 41 to 65 and 242, or an amino acid sequence having up to 1 , up to 2, up to 3, up to 4 or up to 5 amino acid substitutions thereof.
[0029] The VHH antibodies disclosed herein are summarised in Table 2 providing a preferred combinations of CDR regions and FR regions for each VHH antibody, however, different combinations between the different CDR1 , CDR2 and CDR3 as well as the FR1 , FR2, FR3 and FR4 domains as disclosed herein are embodied and are expected to bind to at least one fungal cell, and wherein said VHH antibody is capable of binding to at least one fungal species and cause retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the said at least one fungal species and wherein optionally said activity is retained at elevated concentrations of salts, such as CaCIs or MgCla at concentrations as described herein. Therefore the VHH antibody embodied herein may be a VHH antibody comprising a combination CDR1 , CDR2 and CDR3 regions wherein the CDR1 region is the CDR region according to any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263, the CDR2 region is the CDR region according to any one of SEQ ID NO: 4, 91 to 1 15, 244, 257 and 264, and the CDR3 region is the CDR region according to any one of SEQ ID NO: 5, 116 to 140, 245, 258 and 265. The combination of CDR1 , CDR2 and CDR3 regions do not necessarily require to be present in the canonical VHH antibody scaffold build up from FR1 , FR2, FR3 and FR4 regions, but may be displayed using alternative scaffolds (i.e. the CDR regions and sequences as disclosed herein are not limited to a specific structural role or function that these CDR sequences may have in the VHH antibodies) as further discussed herein. In a preferred embodiment, said CDR regions are flanked by any combination of FR regions, such as the FR regions as disclosed herein where the VHH antibody is build up according to FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4. Therefore the VHH antibody embodied herein may be a VHH antibody comprising a combination of, from the N-terminus to the C-terminus: FR1 , CDR1 , FR2, CDR2, FR3, CDR3 and FR4 regions; wherein the FR1 region is the FR region according to any one of SEQ ID NO: 6, 141 to 165, 246, 259 and 266, the CDR1 region is the CDR region according to any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263, the FR2 region is the FR region according to any one of SEQ ID NO: 7, 166 to 190, 247, 260 and 267, the CDR2 region is the CDR region according to any one of SEQ ID NO: 4, 91 to 1 15, 244, 257 and 264, the FR3 region is the FR region according to any one of SEQ ID NO: 8, 191 to 215, 248, 261 and 268, the CDR3 region is the CDR region according to any one of SEQ ID NO: 5, 116 to 140, 245, 258 and 265, and the FR4 region is the FR region according to any one of SEQ ID NO: 9, 216 to 240, 249, 262 and 269; and wherein said VHH antibody is capable of binding to at least one fungal species and cause retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the said at least one fungal species and wherein optionally said activity is retained at elevated concentrations of salts, such as CaCIz or MgClz at concentrations as described herein.
[0030] Any of the VHH antibodies of the invention may be provided in a composition, for example an agrochemical composition.
[0031] A composition as disclosed herein may comprise at least one heavy chain variable domain of a heavy chain antibody (VHH), which is naturally devoid of light chains or a functional fragment thereof, such as but not limited to a heavy chain single variable domain of a camelid heavy chain antibody (camelid VHH) or a functional fragment thereof.
[0032] A composition as disclosed herein may comprise at least one camelized heavy chain variable domain of a conventional four-chain antibody (camelized VH), or a functional fragment thereof.
[0033] A composition as disclosed herein may comprise at least one heavy chain variable domain of an antibody or a functional fragment thereof, which does not have an amino acid sequence that is exactly the same as (i.e. as in a degree of sequence identity of 100% with) the amino acid sequence of a naturally occurring VH domain, such as the amino acid sequence of a naturally occurring VH domain from a mammal, and in particular from a human being.
[0034] It is understood that a VHH antibody as defined herein can be derived from an organism comprising a heavy chain single variable domain such as a camelid species (referred to as a VHH or sometimes known as nanobodies) or shark species (sometimes referred to as Immunoglobulin new antigen receptors or IgNARs). Additionally the VHH antibody as defined herein can be derived from a heavy chain of a conventional antibody. The skilled person will know that when obtaining a VHH antibody from a conventional antibody certain modification may have to be made to improve solubility and / or stability of the VH chain in absence of the VL light chain.
[0035] A composition as disclosed herein may be an agrochemical composition.
[0036] An agrochemical composition as disclosed herein may at least comprise a VHH antibody, capable of binding to a fungus.
[0037] The at least one VHH antibody in the agrochemical composition disclosed herein may be present in an amount effective to protect or treat a plant or a part of any thereof from an infection or other biological interaction with a fungal pathogen, such as for example but not limited to the concentration of the VHH antibody in the agrochemical composition ranging from 0.0001 % to 50% by weight.
[0038] The at least one VHH antibody in the agrochemical compositions disclosed herein may be formulated in an aqueous solution, optionally but without limitation together with a suitable carrier and / or one or more suitable additive, such as an agrochemically suitable carrier and / or one or more suitable additive.
[0039] An agrochemical composition as disclosed herein may comprise at least one VHH antibody, which binds to at least one pathogenic fungus, i.e. at least one plant pathogenic fungus.
[0040] An agrochemical composition as disclosed herein may comprise at least one VHH antibody which specifically binds to at least one plant pathogenic fungus, such as but not limited to a plant pathogenic fungus of a genus chosen from the group comprising Alternaria, Ascochyta, Botrytis, Cercospora, Colletotrichum, Diplodia, Erysiphe, Fusarium, Gleosporium, Leptosphaeria, Gaeumanomyces, Helminthosporium, Macrophomina, Nectria, Oidium, Penicillium, Peronospora, Phoma, Phymatotrichum, Phytophthora, Plasmopara, Podosphaera, Puccinia, Pyrenophora, Pyricularia, Pythium, Rhizoctonia, Scerotium, Sclerotinia, Septoria, Thielaviopsis, Uncinula, Venturia, Verticillium, Magnaporthe, Blumeria, Mycosphaerella, Ustilago, Melampsora, Phakospora, Monilinia, Mucor, Rhizopus, and Aspergillus.
[0041] An agrochemical composition as disclosed herein may comprise at least one VHH antibody which specifically binds to at least one plant pathogenic fungus, such as but not limited to a plant pathogenic fungus of a species chosen from the group comprising Alternaria alternata, Alternaria aroborescens, Alternaria solani, Botrytis cinerea, Cercospora beticola Colletotrichum orbiculare, Colletotrichum gloeosporioides, Colletotrichum lindemuthianum, Colletotrichum coccodes, Colletotrichum Musea, Colletotrichum Fruticola, Fusarium graminearum, Fusarium culmorum, Fusarium oxysporum, Penicillium digitatum, Penicillium Italicum, Phakopsora pachvrhizi, Uncinula necator, Oidium Neolycopersici, Podosphaera aphanis and Podosphaera xanthii.
[0042] An agrochemical composition as disclosed herein may comprise at least one VHH antibody, which binds to at least one fungal species, which is a fungus for a plant chosen from the group comprising cereals, sorghum, rice, sugar beet, fodder beet, fruit, nuts, the plantain family or grapevines, leguminous crops, oil crops, cucurbits, fibre plants, fuel crops, vegetables, ornamentals, shrubs, broad-leaved trees, evergreens, grasses, coffee, tea, tobacco, hops, pepper, rubber and latex plants.
[0043] In a preferred embodiment, the at least one VHH antibody in the agrochemical composition disclosed herein, may comprise: DVQLQESGGGLVQAGGSLRLSCAASRRTGTRYVMAWFRQAPGKEREFVAGVDWSGSGQYYAE SVKGRFTISKDNTRKTVYLQMNALKPEDTAVYYCAATRRLSGRAYLWATASTYDYWGRGTQVTVSS (SEQ ID NO: 2); or
[0044] DVQLQESGGGLVQAGGSLRLSCTPSTSRFSGVPRMAWYRQAPGKQREKVAEITRAGSRTYADA VKGRFTISRDNAKNTVYLQMDRLKPEDTAVYWCVRARWQSGTPRTPGTQVTVSS (SEQ ID NO: 242); or a sequence having at least about 80% sequence identity thereto and which VHH antibody is capable of binding to at least one fungal species.
[0045] The at least one VHH antibody in the agrochemical compositions disclosed herein may at least comprise the amino acid sequence of a CDR1 region having the sequence RYVMA (SEQ ID NO: 256) or GVPRMA (SEQ ID NO: 263), a CDR2 region having the sequence GVDWSGSGQYYAESVKG (SEQ ID NO: 257) or EITRAGSRTYADAVKG (SEQ ID NO: 264), and a CDR3 region having the sequence TRRLSGRAYLWATASTYDY (SEQ ID NO: 258) or ARWQSGTP (SEQ ID NO: 265) and which VHH antibody is capable of binding to at least one fungus.
[0046] In a further more specific embodiment, the at least one VHH antibody in the agrochemical compositions disclosed herein may at least comprise the amino acid sequence of a CDR1 region having the sequence RRTGTRYVMAW (SEQ ID NO: 3) or TSRFSGVPRMAW (SEQ ID NO: 243), a CDR2 region having the sequence AGVDWSGSGQYYAESVKGR (SEQ ID NO: 4) or AEITRAGSRTYADAVKGR (SEQ ID NO: 244), and a CDR3 region having the sequence TRRLSGRAYLWATASTYDY (SEQ ID NO: 5) or ARWQSGTP (SEQ ID NO: 245) and which VHH antibody is capable of binding to at least one fungus.
[0047] The VHH antibodies disclosed herein are generally capable of binding to a fungus.
[0048] In a further aspect, the present invention provides compositions comprising at least one VHH antibody, which specifically binds to a fungus, for use as an anti-fungal agent. The present invention also provides the VHH antibodies, which specifically bind to a fungus, for use as an anti-fungal agent.
[0049] Accordingly, the invention provides a composition comprising at least one VHH antibody, which VHH antibody comprises: the amino acid sequence set out in any one of SEQ ID NO: 2, 41 to 65 and 242, or an amino acid sequence having at least about 80% sequence identify thereto and which VHH antibody is capable of binding to a fungus for use as an anti-fungal agent; or a CDR1 region comprising the amino acid sequence set out in any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263, a CDR2 region comprising the amino acid sequence set out in any one of SEQ ID NO:4, 91 to 115, 244, 257 and 264, and a CDR3 region comprising the amino acid sequence set out in any one of SEQ ID NO: 5, 1 16 to 140, 245, 258 and 265, and which VHH antibody is capable of binding to at least one fungal species. The invention furthermore provides a VHH antibody or a composition comprising a VHH antibody, wherein the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 3, 66 to 90, 243, 256 and 263, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 4, 91 to 115, 244, 257 and 264, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 5, 1 16 to 140, 245, 258 and 265 ; and wherein the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2, 41 to 65 and 242, or an amino acid sequence having at least about 80% sequence identity thereto. The compositions or agrochemical compositions comprising at least one VHH antibody, may further comprise at least one cell wall disrupting agent. The cell wall disrupting agent may be an enzyme. The enzyme may be a cell wall degrading enzyme, such as, but not limited to an endo-1 ,3-beta-D-glucanase, an exo-1 ,3-beta-D-glucanase and a chitinase. The endo-1 ,3-beta-D-glucanase, exo-1 ,3-beta-D-glucanase and chitinase may be from Trichoderma species or an Aspergillus species.
[0050] The compositions disclosed herein may include at least one VHH antibody or functional fragment thereof and at least one cell wall disrupting agent. In some embodiments, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263, a CDR2 region comprising the amino acid sequence set out in any one of SEQ ID NO:4, 91 to 115, 244, 257 and 264, and a CDR3 region comprising the amino acid sequence set out in any one of SEQ ID NO: 5, 116 to 140, 245, 258 and 265; and the cell wall disrupting agent is an endo-1 ,3-beta-D-glucanase, an exo-1 ,3-beta-D-glucanase and / or a chitinase. In some embodiments, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263, a CDR2 region comprising the amino acid sequence set out in any one of SEQ ID NO: 4, 91 to 115, 244, 257 and 264, and a CDR3 region comprising the amino acid sequence set out in any one of SEQ ID NO: 5, 1 16 to 140, 245, 258 and 265, and the cell wall disrupting agent is a glucanase. In some embodiments, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263, a CDR2 region comprising the amino acid sequence set out in any one of SEQ ID NO:4, 91 to 115, 244, 257 and 264, and a CDR3 region comprising the amino acid sequence set out in any one of SEQ ID NO: 5, 1 16 to 140, 245, 258 and 265, and the cell wall disrupting agent is a chitinase. In an embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 256, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 257, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 258; and the cell wall disrupting agent is an endo-1 ,3-beta-D-glucanase, an exo-1 ,3-beta-D- glucanase and / or a chitinase. In a more preferred embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 256, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 257, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 258, and the cell wall disrupting agent is a glucanase. In a more preferred embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 256, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 257, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 258, and the cell wall disrupting agent is a chitinase. In a some preferred embodiments, the composition comprising a VHH antibody comprising a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 256, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 257, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 258, and at least two cell wall disrupting agents, wherein the cell wall disrupting agents are at least a chitinase and a glucanase.
[0051] In another embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 263, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 264, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 265; and the cell wall disrupting agent is an endo-1 ,3-beta-D-glucanase, an exo-1 ,3-beta-D-glucanase and / or a chitinase. In a more preferred embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 263, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 264, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 265, and the cell wall disrupting agent is a glucanase. In a more preferred embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 263, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 264, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 265, and the cell wall disrupting agent is a chitinase. In some preferred embodiments, the composition comprises a VHH antibody comprising a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 263, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 264, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 265, and at least two cell wall disrupting agents, wherein the cell wall disrupting agents are at least a chitinase and a glucanase.
[0052] In a more specific embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 3, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO:4, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 5; and the cell wall disrupting agent is an endo-1 ,3-beta-D-glucanase, an exo-1 ,3-beta-D-glucanase and / or a chitinase. In a more preferred embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 3, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 4, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 5, and the cell wall disrupting agent is a glucanase. In a more preferred embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 3, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 4, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 5, and the cell wall disrupting agent is a chitinase. In a some preferred embodiments, the composition comprising a VHH antibody comprising a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 3, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 4, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 5, and at least two cell wall disrupting agents, wherein the cell wall disrupting agents are at least a chitinase and a glucanase.
[0053] In another more specific embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 243, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 244, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 245; and the cell wall disrupting agent is an endo-1 ,3-beta-D-glucanase, an exo-1 ,3-beta-D- glucanase and / or a chitinase. In a more preferred embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 243, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 244, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 245, and the cell wall disrupting agent is a glucanase. In a more preferred embodiment, the VHH antibody comprises a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 243, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 244, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 245, and the cell wall disrupting agent is a chitinase. In some preferred embodiments, the composition comprises a VHH antibody comprising a CDR1 region comprising the amino acid sequence set out in SEQ ID NO: 243, a CDR2 region comprising the amino acid sequence set out in SEQ ID NO: 244, and a CDR3 region comprising the amino acid sequence set out in SEQ ID NO: 245, and at least two cell wall disrupting agents, wherein the cell wall disrupting agents are at least a chitinase and a glucanase.
[0054] The compositions disclosed herein may include at least one VHH or functional fragment thereof and at least one cell wall disrupting agent. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2, 41 to 65 and / or 242, or an amino acid sequence having at least about 80% sequence identity thereto; and the cell wall disrupting agent is an endo-1 ,3-beta-D-glucanase, an exo- 1 ,3-beta-D-glucanase and / or a chitinase. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2, 41 to 65 and / or 242, or an amino acid sequence having at least about 80% sequence identity thereto and the cell wall disrupting agent is a glucanase. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2, 41 to 65 and / or 242, or an amino acid sequence having at least about 80% sequence identity thereto and the cell wall disrupting agent is a chitinase.
[0055] The compositions disclosed herein may include at least one VHH or functional fragment thereof and at least one cell wall disrupting agent. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2, 41 to 65 and / or 242; and the cell wall disrupting agent is an endo-1 ,3- beta-D-glucanase, an exo-1 ,3-beta-D-glucanase and / or a chitinase. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2, 41 to 65 and / or 242 and the cell wall disrupting agent is a glucanase. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2, 41 to 65 and / or 242 and the cell wall disrupting agent is a chitinase.
[0056] In a preferred embodiment the composition may include at least one VHH or functional fragment thereof and at least one cell wall disrupting agent. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2; and the cell wall disrupting agent is an endo-1 ,3-beta-D- glucanase, an exo-1 ,3-beta-D-glucanase and / or a chitinase. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2 and the cell wall disrupting agent is a glucanase. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 2 and the cell wall disrupting agent is a chitinase. In some preferred embodiments, the composition comprises a VHH antibody comprising the amino acid sequence set out in SEQ ID NO: 2 and at least two cell wall disrupting agents, wherein the cell wall disrupting agents are at least a chitinase and a glucanase.
[0057] In a preferred embodiment the composition may include at least one VHH or functional fragment thereof and at least one cell wall disrupting agent. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 242; and the cell wall disrupting agent is an endo-1 ,3-beta-D- glucanase, an exo-1 ,3-beta-D-glucanase and / or a chitinase. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 242 and the cell wall disrupting agent is a glucanase. In some embodiments, the VHH antibody comprises the amino acid sequence set out in SEQ ID NO: 242 and the cell wall disrupting agent is a chitinase. In some preferred embodiments, the composition comprises a VHH antibody comprising the amino acid sequence set out in SEQ ID NO: 242 and at least two cell wall disrupting agents, wherein the cell wall disrupting agents are at least a chitinase and a glucanase. In some embodiments, the compositions disclosed herein may include at least one VHH, at least one glucanase and at least one chitinase.
[0058] The invention also provides use of a composition or VHH antibody as disclosed herein as an antifungal agent. The invention also provides use of a composition, such as an agricultural composition, comprising at least one VHH antibody and at least one cell wall disrupting agent as described herein. Such use may be as an anti-fungal agent on a plant. Accordingly, the present invention provides uses of agrochemical compositions comprising at least one VHH antibody, which specifically binds to at least one fungal species, as an anti-fungal agent on plants. More specifically, in the present invention the at least one VHH antibody is capable of binding to a fungus and acts as an anti-fungal agent on plants in the presence of elevated salt concentrations. In addition to the non-therapeutic use as an antifungal agent (e.g. on a plant), the present invention also provides the therapeutic use of the antibodies and compositions of the invention as an antifungal agent (e.g. to treat and / or prevent a fungal infection in an animal, such as a human).
[0059] In the invention, an antifungal agent may be a fungistatic agent and / or fungicidal agent.
[0060] The invention also provides nucleic acid sequences encoding any of the VHH antibody sequences disclosed herein. The nucleic acid sequences encoding the VHH antibody of the invention may be SEQ ID NO: 1 , 16 to 40 and 241 . Alternatively, the nucleic acid sequence encoding the VHH antibody according to SEQ ID NO: 2 of the invention may be selected from the group of nucleic acid sequences according to SEQ ID NOs: 10 to 15; and the nucleic acid sequence encoding the VHH antibody according to SEQ ID NO: 242 of the invention may be selected from the group of nucleic acid sequences according to SEQ ID NOs: 250 to 255. The present invention furthermore provides vectors comprising nucleic acids encoding a VHH of the invention. Further, the invention provides host cells comprising the nucleic acids and vectors disclosed herein.
[0061] Also, the present invention provides methods for protecting or treating a plant or a part of a plant from an infection with a plant pathogenic fungus, wherein the methods at least comprise the step of applying directly or indirectly to the plant or to a part of the plant, an agrochemical composition or VHH antibody as disclosed herein. The agrochemical composition or VHH antibody may be applied under conditions effective to protect or treat the plant or a part of the plant against infection with said plant pathogenic fungus. Therefore, in a particular embodiment, the present invention provides a method for treating a plant comprising (the step of) applying the agrochemical composition of VHH antibody of the invention to the plant.
[0062] These methods may comprise applying directly or indirectly to the plant or to a part of the plant a VHH antibody as disclosed herein, for example at an application rate of around 50g of the VHH antibody per hectare, such as but not limited to an application rate of around 75g of the VHH antibody per hectare, such as an application rate of around 100g of the VHH antibody per hectare, or in particular an application rate of around 200g of VHH antibody per hectare. In a preferred embodiment the application rate of the VHH antibody as disclosed herein is 100g or lower, preferably 75g or lower and in a most preferred embodiment the application rate of the VHH antibody as described herein is 50g or lower.
[0063] These methods may comprise applying directly or indirectly to the plant or to a part of the plant a VHH antibody as disclosed herein, for example at an application rate between a preferred range of between 1g and 100g of the VHH antibody per hectare, such as but not limited to an application rate of between 1g and 75g of the VHH antibody per hectare, in particular and preferred embodiment an application rate of between 1g and 50g of the VHH antibody . It being understood that the VHH antibody when applied directly or indirectly to the plant or to a part of the plant, the VHH antibody may be contained in an agrochemical composition. These methods may be part of an integrated pest management method for protection or treating a plant or part of said plant from an infection with a plant pathogenic fungus, at least comprising the step of applying directly or indirectly to said plant or to a part of said plant, a composition comprising at least one VHH antibody and one or more agrochemicals, under conditions effective to protect or treat said plant or a part of said plant against said infection with said plant pathogenic fungus.
[0064] The invention further relates to a mixture comprising at least one VHH antibody capable of binding a fungus and at least one agrochemical.
[0065] The agrochemical compositions or VHH antibody as disclosed herein may be directly or indirectly applied to the plant or to a part of the plant by spraying, atomizing, foaming, fogging, culturing in hydroculture, culturing in hydroponics, coating, submerging, and / or encrusting, optionally post-harvest.
[0066] The present invention also provides post-harvest treatment methods for protecting or treating a harvested plant or a harvested part of the plant from an infection with a plant pathogenic fungus, at least comprising the step of applying directly or indirectly to the harvested plant or to a harvested part of the plant, an agrochemical composition or VHH antibody as disclosed herein, under conditions effective to protect or treat the harvested plant or a harvested part of the plant against infection with the plant pathogenic fungus.
[0067] The present invention also provides methods of inhibiting the growth of a plant pathogenic fungus or methods of killing a plant pathogenic fungus, the methods comprising at least the step of applying directly or indirectly to a plant or to a part of the plant, an agrochemical composition or VHH antibody as disclosed herein.
[0068] In these methods, the agrochemical compositions or VHH antibody as disclosed herein may be directly or indirectly applied to the plant or to a part of the plant by spraying, atomizing, foaming, fogging, culturing in hydroculture, culturing in hydroponics, coating, submerging, and / or encrusting, optionally postharvest.
[0069] The invention also provides use of a composition comprising at least one VHH antibody and at least one cell wall disrupting agent, where the cell wall disrupting agent is preferably a cell wall degrading enzyme, where more preferably the cell wall degrading enzyme is a endo-1 ,3-beta-D-glucanase, an exo- 1 ,3-beta-D-glucanase and / or a chitinase, as disclosed herein, as an anti-fungal agent. Such use may be as an anti-fungal agent on a plant. Accordingly, the present invention provides uses of agrochemical compositions comprising at least one VHH antibody, which specifically binds to at least one fungal species, and at least one cell wall disrupting agent where the cell wall disrupting agent is preferably a cell wall degrading enzyme, where more preferably the cell wall degrading enzyme is an endo-1 ,3-beta-D- glucanase, an exo-1 ,3-beta-D-glucanase and / or a chitinase, as an anti-fungal agent on plants. More specifically, in the present invention the at least one VHH antibody is capable of binding to a fungus and acts as an anti-fungal agent on plants in the presence of elevated salt concentrations and the cell wall disrupting agent is capable of disruption and / or degrading the cell wall of a fungus. In addition to the non- therapeutic use as an antifungal agent (e.g. on a plant), the present invention also provides the therapeutic use of the VHH antibodies and compositions of the invention as an antifungal agent (e.g. to treat and / or prevent a fungal infection in an animal, such as a human).
[0070] Also, the present invention provides methods for protecting or treating a plant or a part of a plant from an infection with a plant pathogenic fungus, wherein the methods at least comprise the step of applying directly or indirectly to the plant or to a part of the plant, an agrochemical composition comprising at least one VHH antibody as disclosed herein and at least one cell wall disrupting agent as disclosed herein. The agrochemical composition comprising at least one VHH antibody and at least one cell wall disrupting agent may be applied under conditions effective to protect or treat the plant or a part of the plant against infection with said plant pathogenic fungus. Therefore, in a particular embodiment, the present invention provides a method for treating a plant comprising (the step of) applying the agrochemical composition comprising at least one VHH antibody and at least one cell wall disrupting agent of the invention to the plant.
[0071] These methods may comprise applying directly or indirectly to the plant or to a part of the plant a VHH antibody and a cell wall disrupting agent as disclosed herein, for example at an application rate of around 50g of the VHH antibody per hectare and around 50g of the cell wall disrupting agent per hectare, such as but not limited to an application rate of around 75g of the VHH antibody per hectare and 75g of the cell wall disrupting agent per hectare, such as an application rate of around 100g of the VHH antibody per hectare and 100g of the cell wall disrupting agent per hectare, or in particular an application rate of around 200g of VHH antibody per hectare and 200g of the cell wall disrupting agent per hectare. In a preferred embodiment the application rate of the VHH antibody as disclosed herein and the cell wall disrupting agent as disclosed herein is for each 100g or lower, preferably for each 75g or lower and in a most preferred embodiment the application rate of the VHH antibody as described herein and the cell wall disrupting agent as described herein is for each 50g or lower. In some embodiments these methods may comprise applying directly or indirectly to the plant or to a part of the plant at least one VHH antibody and at least one cell wall disrupting agent as disclosed herein and where the total application rate remains the same or essentially the same as described here above. In some embodiments these methods may comprise applying directly or indirectly to the plant or to a part of the plant at least one VHH antibody and at least one cell wall disrupting agent and where the at least on cell wall disrupting agent is an endo-1 ,3-beta-D-glucanase, an exo-1 ,3-beta-D-glucanase and / or a chitinase and where the total application rate remains the same, essentially the same or lower as described here above. In a preferred embodiment, where at least one VHH and at least one cell wall disrupting agent is applied, the total amount of the at least one VHH and the at least one cell wall disrupting agent required to reach an antifungal effect, is lower than the total amount of the at least one VHH and the at least one cell wall disrupting agent separately required to reach the same antifungal effect.
[0072] These methods may comprise applying directly or indirectly to the plant or to a part of the plant a VHH antibody as disclosed herein and a cell wall disrupting agent as described herein, for example at an application rate between a preferred range of between 1 g and 100g of the VHH antibody per hectare and of between 1g and 100g of the cell wall disrupting agent per hectare, such as but not limited to an application rate of between 1g and 75g of the VHH antibody per hectare and of between 1 g and 75g of the cell wall disrupting agent per hectare, in particular and preferred embodiment an application rate of between 1g and 50g of the VHH antibody and of between 1g and 50g of the cell wall disrupting agent per hectare. It being understood that the VHH antibody and the cell wall disrupting agent when applied directly or indirectly to the plant or to a part of the plant, the VHH antibody and the cell wall disrupting agent may be contained in an agrochemical composition. In some embodiments These methods may be part of an integrated pest management method for protection or treating a plant or part of said plant from an infection with a plant pathogenic fungus, at least comprising the step of applying directly or indirectly to said plant or to a part of said plant, a composition comprising at least one VHH antibody and one or more agrochemicals, under conditions effective to protect or treat said plant or a part of said plant against said infection with said plant pathogenic fungus. In a preferred embodiment, where at least one VHH and at least one cell wall disrupting agent is applied at a certain application rate, the application rate of the at least one VHH and the at least one cell wall disrupting agent required to reach an antifungal effect, is lower than the application rate of the at least one VHH and the at least one cell wall disrupting agent separately required to reach the same antifungal effect. It being understood that in a most preferred embodiment these (post-harvest) methods providing the application directly or indirectly to a plant or to a part of a plant of a VHH antibody and cell wall disrupting agent as described herein require a lower amount of each of the VHH antibody and cell wall disrupting agent to be applied to obtain a similar antifungal effect compared to when the VHH antibody and cell wall disrupting agent would be applied alone or where the combination of the VHH antibody and cell wall disrupting agent would merely lead to an additive effect.
[0073] The invention further relates to a mixture comprising at least one VHH antibody capable of binding a fungus, at least one cell wall disrupting agent and at least one agrochemical.
[0074] The agrochemical compositions comprising at least one VHH antibody and at least one cell wall disrupting agent as disclosed herein may be directly or indirectly applied to the plant or to a part of the plant by spraying, atomizing, foaming, fogging, culturing in hydroculture, culturing in hydroponics, coating, submerging, and / or encrusting, optionally post-harvest.
[0075] The present invention also provides post-harvest treatment methods for protecting or treating a harvested plant or a harvested part of the plant from an infection with a plant pathogenic fungus, at least comprising the step of applying directly or indirectly to the harvested plant or to a harvested part of the plant, an agrochemical composition comprising at least one VHH antibody as disclosed herein and at least one cell wall disrupting agent, under conditions effective to protect or treat the harvested plant or a harvested part of the plant against infection with the plant pathogenic fungus.
[0076] The present invention also provides methods of inhibiting the growth of a plant pathogenic fungus or methods of killing a plant pathogenic fungus, the methods comprising at least the step of applying directly or indirectly to a plant or to a part of the plant, an agrochemical composition comprising at least one VHH antibody as disclosed herein and at least one cell wall disrupting agent as disclosed herein.
[0077] In these methods, the agrochemical compositions comprising at least one VHH antibody as disclosed herein and at least one cell wall disrupting agent as disclosed herein may be directly or indirectly applied to the plant or to a part of the plant by spraying, atomizing, foaming, fogging, culturing in hydroculture, culturing in hydroponics, coating, submerging, and / or encrusting, optionally post-harvest.
[0078] The present invention also provides for a transgenic plant, plant part, seed or plant cell comprising a nucleic acid sequence encoding a VHH antibody as disclosed herein and where the VHH antibody is expressed in said transgenic plant, plant seed, seed or plant cell. By expressing the VHH antibody in a transgenic plant, plant part, seed or plant cell the VHH antibody may protect or treat the transgenic plant, plant part, seed or plant cell against infection with a plant pathogenic fungus.
[0079] The present invention also provides for a transgenic plant, plant part, seed or plant cell comprising a nucleic acid sequence encoding at least one VHH antibody as disclosed herein and at least one cell wall disrupting agent as disclosed herein and where at least one VHH antibody and at least one cell wall disrupting agent are expressed in said transgenic plant, plant seed, seed or plant cell. By expressing the VHH antibody and cell wall disrupting agent in a transgenic plant, plant part, seed or plant cell the VHH antibody may protect or treat the transgenic plant, plant part, seed or plant cell against infection with a plant pathogenic fungus.
[0080] Finally the present invention also provides a method for manufacturing a variant of the VHH antibody as disclosed herein. Where the variant of the VHH antibody binds to at least one fungal species thereby causes retardation of growth of a spore of the said at least one fungal species and / or lysis of a spore of the at least one fungal species. Whereby the variant of the VHH antibody causes retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species in the presence of elevated salt concentrations. That is to say, binding of the variant of the VHH antibody to the at least one fungal species results in retardation of growth of a spore of the said at least one fungal species and / or lysis of a spore of the said at least one fungal species and this effect is maintained at elevated salt concentrations.
[0081] Brief description of the drawings
[0082] Table 1 : Figure legends
[0083] Description of the sequence listing
[0084] The sequence listing provides at least the following sequences of Table 2:
[0085]
[0086] Table 2: Correlation between SEQ ID NOs and the VHH antibody sequences and CDR sequences
[0087] SEQ ID NO 10 to 15 set out alternative nucleotide sequences encoding the amino acid sequence of SEQ ID NO: 2.
[0088] SEQ ID NO 250 to 255 set out alternative nucleotide sequences encoding the amino acid sequence of SEQ ID NO: 242.
[0089] Detailed description of the invention
[0090] Reference to any prior art in this specification is not, and should not be taken as, an acknowledgment or any form of suggestion that this prior art forms part of the common general knowledge in any country.
[0091] All documents cited in the present specification are hereby incorporated by reference in their entirety. Unless otherwise defined, all terms used in disclosing the invention, including technical and scientific terms, have the meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
[0092] The present invention will be described with respect to particular embodiments but the invention is not limited thereto but only by the claims. Any reference signs in the claims shall not be construed as limiting the scope.
[0093] Definitions
[0094] Where the term "comprising" is used in the present description and claims, it does not exclude other elements or steps.
[0095] Where an indefinite or definite article is used when referring to a singular noun e.g. "a" or "an", "the", this includes a plural of that noun unless something else is specifically stated.
[0096] The term ’’about” as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, is meant to encompass variations of + / -10% or less, preferably + / -5% or less, more preferably + / -1% or less, and still more preferably + / -0.1 % or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier 'about' refers is itself also specifically, and preferably, disclosed.
[0097] The following terms or definitions are provided solely to aid in the understanding of the invention. Unless specifically defined herein, all terms used herein have the same meaning as they would to one skilled in the art of the present invention. Practitioners are particularly directed to Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nded., Cold Spring Harbor Press, Plainsview, New York (1989); and Ausubel et al., Current Protocols in Molecular Biology (Supplement 47), John Wiley & Sons, New York (1999), for definitions and terms of the art. The definitions provided herein should not be construed to have a scope less than understood by a person of ordinary skill in the art.
[0098] Unless indicated otherwise, all methods, steps, techniques and manipulations that are not specifically described in detail can be performed and have been performed in a manner known per se, as will be clear to the skilled person. Reference is for example again made to the standard handbooks, to the general background art referred to above and to the further references cited therein.
[0099] As used herein, the terms "complementarity determining region" or "CDR" within the context of antibodies refer to variable regions of either the H (heavy) or the L (light) chains (also abbreviated as VH and VL, respectively) and contain the amino acid sequences capable of specifically binding to antigenic targets. These CDR regions account for the basic specificity of the antibody for a particular antigenic determinant structure. Such regions are also referred to as "hypervariable regions." The CDRs represent non-contiguous stretches of amino acids within the variable regions but, regardless of species, the positional locations of these critical amino acid sequences within the variable heavy and light chain regions have been found to have similar locations within the amino acid sequences of the variable chains. The variable heavy and light chains of all canonical antibodies each have 3 CDR regions, each non- contiguous with the others (termed L1 , L2, L3, H1 , H2, H3) for the respective light (L) and heavy (H) chains. VHH antibodies lack the light chain canonical antibodies.
[0100] The term "affinity", as used herein, refers to the degree to which a polypeptide, in particular an immunoglobulin, such as an antibody, or an immunoglobulin fragment, such as a VHH antibody, binds to an antigen so as to shift the equilibrium of antigen and polypeptide toward the presence of a complex formed by their binding. Thus, for example, where an antigen and antibody (fragment) are combined in relatively equal concentration, an antibody (fragment) of high affinity will bind to the available antigen so as to shift the equilibrium toward high concentration of the resulting complex.
[0101] The term "binding to a fungus” or "interacting with fungus” or "specifically binding to a fungus” as used herein interchangeably in the context of and antibody, such as a VHH antibody, means that the antibody is capable of binding to or interacting with a fungus, or part of a fungus. Said fungus is preferably a plant pathogenic fungus such as Botrytis cinerea to which the VHH antibody of the current invention were raised. Therefore, in a particular embodiment, the VHH antibody of the invention binds to Botrytis cinerea. However, binding to a fungus of the VHH antibody of the current invention is not limited to a specific fungal species. That is to say, cross-activity is possible where the VHH antibody of the current invention bind to a fungus that is not Botrytis cinerea. In a more preferred embodiment, binding to a fungus also leads to retardation of growth of a spore of said fungus or lysis of a spore of said fungus. In a more preferred embodiment retardation of growth of a spore of said fungus or lysis of a spore of said fungus occurs in the presence of elevated salt concentrations as further described herein. The VHH antibody of the current invention however does not bind to or interact with all fungal species, for example the VHH antibody of the current invention does not bind to the fungal species Trichoderma reesei. Therefore, the VHH antibody of the current invention may be characterised by the ability to bind to a plant pathogenic fungus as disclosed herein, as compared to the absence of binding to Trichoderma reesei, and were said assessment is made as provided in the binding assay of Example 4. More specifically, the VHH antibodies of the current invention may bind to the plant pathogenic fungi as disclosed herein at a concentration of between 101and 1 pM or higher and where such a binding leads to a median fluorescent intensity (MFI) of above background levels and where said MFI increases with higher concentrations of the VHH antibody. Where the MFI value is the fluorescent signal emitted by the DY488 fluorophore conjugated to a monoclonal antibody binding to the C-terminal strep-tag that may be added to the VHH antibodies of the invention for this assay and as measured in the presence of PBS buffer. More specifically, the MFI value may be 10 or more, 20 or more, 50 or more, 100 or more, when binding to a plant pathogenic fungal species as described herein, whereas the MFI value of binding to Trichoderma reesei essential stays below or at the background level at concentration 10-1and 1 pM.
[0102] The terms "inhibiting”, ’’reducing” and / or ’’preventing” as used herein may refer to a VHH antibody as disclosed herein that binds to a fungus and inhibits, reduces and / or prevents a biological activity of said fungus, as measured using a suitable in vitro, cellular or in vivo assay, such as for example the assay given in Example 5. Accordingly, ’’inhibiting”, ’’reducing” and / or ’’preventing” may also refer to inhibiting, reducing and / or preventing one or more biological or physiological mechanisms, effects, responses, functions pathways or activities of the fungus.
[0103] Thus, more particularly, ’’inhibiting”, ’’reducing” and / or ’’preventing” using VHH antibody as disclosed herein may mean either inhibiting, reducing and / or preventing the normal physiological or biological mechanisms, effects, responses, functions, pathways or activities in which the fungus is involved, such as by at least 10%, but preferably at least 20%, for example by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more, as measured using a suitable in vitro, cellular or in vivo assay, such as the assay in Example 5, compared to the same assay under the same conditions but without using the VHH antibody as disclosed herein.
[0104] The inhibiting or antagonizing activity or the enhancing or agonizing activity of a VHH antibody as disclosed herein may be reversible or irreversible, but for agrochemical, pharmaceutical and pharmacological applications will typically occur reversibly.
[0105] A VHH antibody as disclosed herein is considered to be ‘‘(in) essentially isolated (form)” as used herein, when it has been extracted or purified from the host cell and / or medium in which it is produced.
[0106] In some aspects the amino acid sequence as disclosed herein are the amino acid sequences of a VHH antibody comprising 3 CDR domains and 4 framework FR regions. In a more specific aspect the amino acid sequence of a VHH antibody as described herein comprises or consists of the amino acid sequence set out in any one of SEQ ID NO: 2, 41 to 65 and 242, or a sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% identity thereto. In another aspect, the present invention provides an amino acid sequence of a VHH antibody comprising: a CDR1 region comprising or consisting of the sequence set out in any one of SEQ ID NO:
[0107] 3, 66 to 90, 243, 256 and 263; a CDR2 region comprising or consisting of the sequence set out in any one of SEQ ID NO:
[0108] 4, 91 to 1 15, 244, 257 and 264; and a CDR3 region comprising or consisting of the sequence set out in any one of SEQ ID NO:
[0109] 5, 116 to 140, 245, 258 and 265. The amino acid sequence of a VHH antibody defined herein may suitably have certain framework region sequences. For example, the amino acid sequence of a VHH antibody defined herein may comprise a framework region 1 (FR1 ) sequence comprising or consisting of the sequence set out in any one of SEQ ID NO: 6, 141 to 165, 246, 259 and 266, a framework region 2 (FR2) sequence comprising or consisting of the sequence set out in any one of SEQ ID NO: 7, 166 to 190, 247, 260 and 267, a framework region 3 (FR3) sequence comprising or consisting of the sequence set out in any one of SEQ ID NO: 8, 191 to 215, 248, 261 and 268, and a framework region 4 (FR4) sequence comprising or consisting of the sequence set out in any one of SEQ ID NO: 9, 216 to 240, 249, 262 and 269.
[0110] In a preferred aspect, the VHH antibody as described herein comprises or consists of the amino acid sequence set out in SEQ ID NO: 2, or a sequence having, with increasing preference, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% identity thereto. In another preferred aspect, the VHH antibody as described herein comprises or consists of the amino acid sequence set out in SEQ ID NO: 242, or a sequence having, with increasing preference, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% identity thereto. In some aspects, the VHH antibody as described herein comprises or consists of the amino acid sequence set out in any one of SEQ ID NO: 41 to 65, or a sequence having, with increasing preference, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% identity thereto.
[0111] The VHH antibodies comprising the amino acid sequence provided in any one of SEQ ID NO: 41 to 65 are variant VHH antibodies obtained from SEQ ID NO: 2. More specifically SEQ ID NO: 41 to 65 were retrieved by clustering of the VHH antibody amino acid sequences as identified from the respective VHH library using deep sequencing. Starting from SEQ ID NO: 2, VHH amino acid sequence information was clustered based on either 80% or 90% or higher identity to the full VHH sequence or 90% or higher identity to the CDR3 region.
[0112] Because of its great potential for diversity, the CDR3 is taken as the most important component in conferring binding activity and specificity of a VHH antibody. Furthermore, during clustering of VHH antibody amino acid sequences present in the VHH library, CDR3 was overrepresented meaning CDR3 is likely the main contributor to the binding of 11 A11 to its target. Therefore, the current invention further relates to a VHH antibody comprising a CDR3 region comprising or consisting of the sequence set out in SEQ ID NO: 5, 1 16 to 140 and 245. In a preferred embodiment, the VHH antibody according to the invention comprises a CDR3 region comprising or consisting of the sequence set out in SEQ ID NO: 5. In another preferred embodiment, the VHH antibody according to the invention comprises a CDR 3 region comprising or consisting of the sequence set out in SEQ ID NO: 245. In a preferred embodiment said VHH antibodies further comprise a CDR1 and a CDR2 region. In a more preferred embodiment, said VHH antibodies further comprise a CDR1 region, a CDR2 region, a FR1 region, a FR2 region, a FR3 region and a FR4 region.
[0113] “Plant” as used herein, means an entire plant or a part thereof, including fresh fruit, vegetables and seeds. The plant or plant part may be a live plant or part thereof. Also, the term "plant'' as used herein encompasses whole plants, ancestors and progeny of the plants and plant parts, including seeds, shoots, stems, leaves, roots (including tubers), flowers, and tissues and organs. In some aspects, each of the aforementioned plant or plant parts may comprise the polynucleotide of the invention encoding a VHH antibody. The term "plant" also encompasses plant cells, suspension cultures, callus tissue, embryos, meristematic regions, gametophytes, sporophytes, pollen and microspores, again wherein each of the aforementioned may comprise the gene / nucleic acid of interest.
[0114] “Crop" as used herein means a plant species or variety that is grown to be harvested as food, livestock fodder, fuel raw material, or for any other economic purpose. As a non-limiting example, said crops can be maize, cereals, such as wheat, rye, barley and oats, sorghum, rice, sugar beet and fodder beet, fruit, such as pome fruit (e.g. apples and pears), citrus fruit (e.g. oranges, lemons, limes, grapefruit, or mandarins), stone fruit (e. g. peaches, nectarines or plums), nuts (e.g. almonds or walnuts), soft fruit (e.g. cherries, strawberries, blackberries or raspberries), the plantain family or grapevines, leguminous crops, such as beans, lentils, peas and soya, oil crops, such as sunflower, safflower, rapeseed, canola, castor or olives, cucurbits, such as cucumbers, melons or pumpkins, fibre plants, such as cotton, flax or hemp, fuel crops, such as sugarcane, miscanthus or switchgrass, vegetables, such as potatoes, tomatoes, peppers, lettuce, spinach, onions, carrots, egg-plants, asparagus or cabbage, ornamentals, such as flowers (e.g. petunias, pelargoniums, roses, tulips, lilies, or chrysanthemums), shrubs, broad-leaved trees (e.g. poplars or willows) and evergreens (e.g. conifers), grasses, such as lawn, turf or forage grass or other useful plants, such as coffee, tea, tobacco, hops, pepper, rubber or latex plants.
[0115] In a preferred embodiment, the agrochemical compositions or VHH antibodies of the current invention may be used to treat pathogenic fungal infections on pepper plants.
[0116] In another preferred embodiment, the agrochemical compositions of VHH antibodies of the current invention may be used to treat pathogenic fungal infection on cucurbits.
[0117] In another preferred embodiment, the agrochemical compositions of VHH antibodies of the current invention may be used to treat pathogenic fungal infection on grapes.
[0118] In another preferred embodiment, the agrochemical compositions of VHH antibodies of the current invention may be used to treat pathogenic fungal infection on strawberries.
[0119] A “field” or “plant field” refers to an agricultural area where plants are cultivated. The field may be any piece of land designated for the purpose of growing plants, such as the plants and crops disclosed herein. The field may also be a piece of land covered by a greenhouse. The field may also refer to an area where the plants and crops may be cultured in elevated structures comprising the plants and crops disclosed herein i.e. the plants and crops may not be growing directly on the piece of land but rather in elevated structures comprising soil or water. For example the field may comprise plants and crops grown in a hydroponics setup. The field may, but must not, comprise growing plants, that is to say that the field may be an empty field, as the invention can also be applied for pre-treating a field before sowing or plant growing. In a preferred embodiment, however, the field is a field comprising living plants.
[0120] A “pest”, as used here, is an organism that is harmful to plants, animals, humans or human concerns, and includes, but is not limited to crop pests (as later defined), household pests, such as cockroaches, ants, etc., and disease vectors, such as malaria mosquitoes.
[0121] A “plant pest”, “plant pathogen” or “crop pest”, as used in the application interchangeably, refers to organisms that specifically cause damage to plants, plant parts or plant products, particularly plants, plant parts or plant products, used in agriculture. Note that the term “plant pest” or “crop pest” is used in the meaning that the pest targets and harms plants, preferably the “plant pest”, “crop pest” or “plant pathogen” is a plant pathogenic fungus. “Fungus”, as used herein, means a eukaryotic organism, belonging to the group of Eumycota. The term fungus in the present invention also includes fungal-like organisms such as the Oomycota. Oomycota (or oomycetes) form a distinct phylogenetic lineage of fungus-like eukaryotic microorganisms. This group was originally classified among the fungi but modern insights support a relatively close relationship with the photosynthetic organisms such as brown algae and diatoms, within the group of heterokonts.
[0122] Examples of “plant pathogenic fungi” or a “plant pathogenic fungus” as used herein, are known in the art and include, but are not limited to, those selected from the group consisting of the Genera: Alternaria; Ascochyta; Botrytis; Cercospora; Colletotrichum; Diplodia; Erysiphe; Fusarium; Leptosphaeria; Gaeumanomyces; Helminthosporium; Macrophomina; Nectria; Oidium, Peronospora; Phakopsora; Phoma; Phymatotrichum; Phytophthora; Plasmopara; Podosphaera; Puccinia; Puthium; Pyrenophora; Pyricularia; Pythium; Rhizoctonia; Scerotium; Sclerotinia; Septoria; Thielaviopsis; Uncinula; Venturia; and Verticillium. Specific examples of plant fungi infections which may be combated with the agrochemical compositions or VHH antibodies of the invention include, powdery mildew and botrytis cinerea in fruit and vegetable crops such as grapes and strawberries. Additional specific examples of plant fungi infections which may be combated with the agrochemical compositions of the invention include Erysiphe graminis in cereals, Erysiphe cichoracearum and Sphaerotheca fuliginea in cucurbits, Podosphaera leucotricha in apples, Podosphaera aphanis, for example to treat powdery mildew, for example on strawberry, Podosphaera xanthii, for example to treat powdery mildew, for example on cucumber, Oidium neolycopersici, for example to treat powdery mildew, for example on tomatoes, Uncinula necator in vines, Puccinia sp. In cereals, Rhizoctonia sp. In cotton, potatoes, rice and lawns, Ustilago sp. In cereals and sugarcane, Venturia inaequalis (scab) in apples, Helminthosporium sp. In cereals, Septoria nodorum in wheat, Septoria tritici in wheat, Rhynchosporium secalis on barley, Botrytis cinerea (gray mold) in strawberries, tomatoes and grapes, Cercospora arachidicola in groundnuts, Peronospora tabacina in tobacco, or other Peronospora in various crops, Pseudocercosporella herpotrichoides in wheat and barley, Pyrenophera teres in barley, Pyricularia oryzae in rice, Phytophthora infestans in potatoes and tomatoes, Fusarium sp. (such as Fusarium oxysporum) and Verticillium sp. In various plants, Plasmopara viticola in grapes, Alternaria sp. In fruit and vegetables, Pseudoperonospora cubensis in cucumbers, Mycosphaerella fijiensis in banana, Ascochyta sp. In chickpeas, Leptosphaeria sp. On canola, Phakopsora spp., such as Phakopsora pachyrhizi, and Colleotrichum sp. In various crops, for example Colletotrichum orbiculare which may cause anthracnose in squash or Colletotrichum gloeosporioides causing anthracnose in peppers. The compositions according to the invention are active against normally sensitive and resistant species and against all or some stages in the life cycle of the plant pathogenic fungus.
[0123] In particular embodiments, the agrochemical compositions or VHH antibodies as disclosed herein bind a plant pathogenic fungus from the genus chosen from the group comprising Alternaria, Ascochyta, Botrytis, Cercospora, Colletotrichum, Diplodia, Erysiphe, Fusarium, Leptosphaeria, Gaeumanomyces, Helminthosporium, Macrophomina, Nectria, Oidium, Penicillium, Peronospora, Phoma, Phymatotrichum, Phytophthora, Plasmopara, Podosphaera, Puccinia, Pyrenophora, Pyricularia, Pythium, Rhizoctonia, Scerotium, Sclerotinia, Septoria, Thielaviopsis, Uncinula, Venturia, Verticillium, Magnaporthe, Blumeria, Mycosphaerella, Ustilago, Melampsora, Phakopsora, Monilinia, Mucor, Rhizopus, and Aspergillus. In a more preferred embodiment, the agrochemical compositions or VHH antibodies as disclosed herein bind a plant pathogenic fungus from the genus chosen from the group comprising Botrytis, Colletotrichum, Phakopsora, Uncinula, Oidium and Podosphaera.
[0124] In a more preferred embodiment, the agrochemical compositions or VHH antibodies as disclosed herein are directed against a plant pathogenic fungus according to the species chosen from the group comprising Alternaria alternata, Alternaria aroborescens, Alternaria solani, Botrytis cinerea, Cercospora beticola, Colletotrichum orbiculare, Colletotrichum gloeosporioides, Colletotrichum lindemuthianum, Colletotrichum coccodes, Colletotrichum Musea, Colletotrichum Fruticola, Fusarium graminearum, Fusarium culmorum, Fusarium oxysporum, Penicillium digitatum, Penicillium Italicum, Phakopsora pachvrhizi, Uncinula necator, Oidium Neolycopersici, Podosphaera aphanis and Podosphaera xanthii.
[0125] In a preferred embodiment, the agrochemical compositions or VHH antibodies as disclosed herein are directed against a plant pathogenic fungus Botrytis cinerea.
[0126] In a preferred embodiment, the agrochemical compositions or VHH antibodies as disclosed herein are directed against a plant pathogenic fungus Colletotrichum gloeosporioides. In another preferred embodiment, the agrochemical compositions or VHH antibodies as disclosed herein are directed against a plant pathogenic fungus Podosphaera xanthii.
[0127] “Pest infection” or “pest disease” as used herein refers to any inflammatory condition, disease or disorder in a living organism, such as a plant, animal or human, which is caused by a pest.
[0128] “Fungal infection” or “fungal disease” as used herein refers to any inflammatory condition, disease or disorder in a living organism, such as a plant, animal or human, which is caused by a fungus.
[0129] “Active substance”, “active ingredient” or “active principle”, as used interchangeably herein, means any biological, biochemical or chemical element and its derivatives, fragments or compounds based thereon, including micro-organisms, having general or specific action against harmful organisms on a subject, and in particular on plants, parts of plants or on plant products, as they occur naturally or by manufacture, including any impurity inevitably resulting from the manufacturing process.
[0130] “Agrochemical”, as used herein, means suitable for use in the agrochemical industry (including agriculture, horticulture, floriculture and home and garden uses, but also products intended for non-crop related uses such as public health / pest control operator uses to control undesirable insects and rodents, household uses, such as household fungicides and insecticides and agents, for protecting plants or parts of plants, crops, bulbs, tubers, fruits (e.g. from harmful organisms, diseases or pests); for controlling, preferably promoting or increasing, the growth of plants; and / or for promoting the yield of plants, crops or the parts of plants that are harvested (e.g. its fruits, flowers, seeds etc.). Examples of such substances will be clear to the skilled person and may for example include compounds that are active as insecticides (e.g. contact insecticides or systemic insecticides, including insecticides for household use), herbicides (e.g. contact herbicides or systemic herbicides, including herbicides for household use), fungicides (e.g. contact fungicides or systemic fungicides, including fungicides for household use), nematicides (e.g. contact nematicides or systemic nematicides, including nematicides for household use) and other pesticides or biocides (for example agents for killing insects or snails); as well as fertilizers; growth regulators such as plant hormones; micro-nutrients, safeners, pheromones; repellants; insect baits; and / or active principles that are used to modulate (i.e. increase, decrease, inhibit, enhance and / or trigger) gene expression (and / or other biological or biochemical processes) in or by the targeted plant (e.g. the plant to be protected or the plant to be controlled), such as nucleic acids (e.g., single stranded or double stranded RNA, as for example used in the context of RNAi technology) and other factors, proteins, chemicals, etc. known per se for this purpose, etc. Examples of such agrochemicals will be clear to the skilled person; and for example include, without limitation: glyphosate, paraquat, metolachlor, acetochlor, mesotrione, 2, 4-D, atrazine, glufosinate, sulfosate, fenoxaprop, pendimethalin, picloram, trifl uralin , bromoxynil, captan, clodinafop, Dithiocarbamate, fluroxypyr, phenylpyrroles (such as fludioxonil), hydroxyanilides (such as fenhexamid), dicarboximides (such as iprodione), kresoxim-methyl, nicosulfuron, bensulfuron, imazetapyr, dicamba, imidacloprid, thiamethoxam, fipronil, chlorpyrifos, deltamethrin, lambda-cyhalotrin, endosulfan, methamidophos, carbofuran, clothianidin, cypermethrin, abamectin, diflufenican, spinosad, fluopyram, indoxacarb, bifenthrin, tefluthrin, azoxystrobin, thiamethoxam, tebuconazole, mancozeb, morpholine, cyazofamid, fluazinam, Myclobutanil, pyraclostrobin, epoxiconazole, chlorothalonil, strobilurin, triazole, vinclozolin, copper fungicides (for example copper oxychloride, copper hydroxide), anilinopyrimidines (e.g., cyprodinil, pyrimethanil, mepanipyrim), trifloxystrobin, prothioconazole, difenoconazole, carbendazim, propiconazole, thiophanate, sulphur, boscalid, tricyclazole, hexaconazole, metalaxyl, benomyl, benzimidazole, kitazin, tridemorph, propineb, streptomycin sulfate, and oxytetracycline and other known agrochemicals or any suitable combination(s) thereof.
[0131] Further examples of agrochemicals are biological substances, such as a microbials, for example a Pseudomonas strain such as Pseudomonas chlororaphis (ma342), Pseudomonas sp. strain dsmz 13134; or a Bacillus strain such as Bacillus thuringiensis ssp. aizawai Abts-1857, Bacillus thuringiensis ssp. aizawai Gc-91 , Bacillus thuringiensis ssp. kurstaki 101 13p / B, Bacillus thuringiensis ssp. kurstaki Sa-1 1 10473p / B, Bacillus thuringiensis ssp. kurstaki Strain EG 2348, Bacillus thuringiensis ssp. Israeliensis (Serotype H-14) Strain AM65-52, Bacillus amyloliquefaciens subsp. plantarum D747, Bacillus amyloliquefaciens MBI 600, Bacillus amyloliquefaciens strain FZB24, Bacillus amyloliquefaciens strain qst 713, Bacillus firmus 1-1582; or a Streptomyces strain such as Streptomyces strain K61 ; or a Trichoderma strain such as Trichoderma harzianum T-22, Trichoderma asperellum strain T34, Trichoderma atroviride strain SC1 ; or a Coniothyrium strain such as Coniothyrium minitans, an Isaria strain such as Isaria fumosorosea var. apopka strain 97; or a Pythium strain such as Pythium oligandrum M1 ; or a Clonostachys strain such as Clonostachys rosea J1446; or a Paecilomyces strain such as Paecilomyces fumosoroseus FE9901 ; or a Metarhizium strain such as metarhizium brunneum strain MA 43; or a Beauveria strain such as Beauveria bassiana ATCC 74040, Beauveria bassiana strain GHA; or a Aureobasidium strain such as Aureobasidium pullulans strain DSM14940 or DSM14941 ; or a Ampelomyces strain such as Ampelomyces quisqualis strain AQ10; or a Saccharomyces strain such as Saccharomyces cerevisiae LASO2; or a Candida strain such as Candida oleophila strain O; or an Alamthomyce strain such as Akanthomyce muscarius strain VE6. The microbial can also be a virus such as Granulose virus 8615p / b, Granulose virus 9198p / b, Granulose virus 10147p / b Granulose virus 10521 p / b Granulose virus 1 1 196g / b, pepino mosaic virus or a tomato mosaic virus.
[0132] Further examples of agrochemicals are biological substances may be bioactive proteins such as a small peptide with anti-microbial properties such as an antimicrobial peptide (AMP). AMPs usually have a length of in the range of 10 to 50 amino acids. AMPs are commonly anionic or cationic and can be subdivided in 4 classes: (i) anionic peptides which are rich in glutamic and aspartic acids , (ii) linear cationic a-helical peptides, (iii) cationic peptides enriched for specific amino acidrich in proline, arginine, phenylalanine, glycine, tryptophan and (iv) anionic / cationic peptides forming disulfide bonds More specific examples are plant derived AMPs with antimicrobial or antiviral activities such as peptides composed of at least two helical domains connected by a linker / turn such as plant-derived amphipathic helix or two helices engineered into a helix-tum-helix (HTH) format in which homologous or heterogeneous helices are connected by a peptide linker. For example, as described in WO2021202476, W02020072535, W02020176224 or W02003000863. Other examples of bioactive proteins are Bt toxins, e.g., a Cry protein, a Cyt protein, or a Vip protein, or an 5-endotoxin (e.g., Crystal (Cry) toxins and / or cytolytic (Cyt) toxins); vegetative insecticidal proteins (Vips); secreted insecticidal protein (Sips); or Bin-like toxins. “Vip” or “VIP” or “Vegetative Insecticidal Proteins” refer to proteins discovered from screening the supernatant of vegetatively grown strains of Bt for possible insecticidal activity. Vips have little or no similarity to Cry proteins. Of particular use and preference for use with this document are what have been called VIP3 or Vip3 proteins, which have Lepidopteran activity. Vips are thought to have a similar mode of action as Bt cry peptides. Further examples may be polypeptides derived from spider venom such as venom from funnel-web spiders such as agatoxins or diguetoxins more specifically a Mu-diguetoxin-dc1 a variant polypeptides or a U1 -agatoxin-Ta1 b variant polypeptide. Other examples are polypeptides derived from sea anemone, such as Av3 toxins. Such as described in WO2022067214 or WO2021216621 or WO2022212777.
[0133] An “agrochemical composition” as used herein means a composition for agrochemical use, as further defined, comprising at least one active substance, optionally with one or more additives favouring optimal dispersion, atomization, deposition, leaf wetting, distribution, retention and / or uptake of agrochemicals. It will become clear from the further description herein that an agrochemical composition as used herein includes biological control agents or biological pesticides (including but not limited to biological biocidal, biostatic, fungistatic and fungicidal agents) and these terms will be interchangeably used in the present application. Accordingly, an agrochemical composition as used herein includes compositions comprising at least one biological molecule as an active ingredient, substance or principle for controlling pests in plants or in other agro-related settings (such for example in soil). Non-limiting examples of biological molecules being used as active principles in the agrochemical compositions disclosed herein are proteins (including antibodies and fragments thereof, such as but not limited to heavy chain variable domain fragments of antibodies, including VHH’s), nucleic acid sequences, (poly-) saccharides, lipids, vitamins, hormones glycolipids, sterols, and glycerolipids.
[0134] As a non-limiting example, the additives in the agrochemical compositions disclosed herein may include but are not limited to diluents, solvents, adjuvants, surfactants, wetting agents, spreading agents, oils, stickers, thickeners, penetrants, buffering agents, acidifiers, anti-settling agents, anti-freeze agents, photo-protectors, defoaming agents, biocides and / or drift control agents.
[0135] A “fungistatic composition” or a “fungistatic agent” as used herein means any active ingredient, substance or principle or a composition comprising any active ingredient, substance or principle for fungistatic use (as further defined herein) comprising at least one active fungistatic substance or ingredient, optionally combined with one or more additives favoring optimal dispersion, atomization, deposition, leaf wetting, distribution, retention and / or uptake of the active substance or ingredient. As a non-limiting examples such additives are diluents, solvents, adjuvants, (ionic) surfactants, wetting agents, spreading agents, oils, stickers, thickeners, penetrants, buffering agents, acidifiers, anti-settling agents, anti-freeze agents, photo-protectors, defoaming agents, biocides, protease inhibitors and / or drift control agents. A “fungicidal composition” or a “fungicidal agent” as used herein means any active ingredient, substance or principle or a composition comprising any active ingredient, substance or principle for fungicidal use (as further defined herein) comprising at least one active fungicidal substance or ingredient, optionally combined with one or more additives favoring optimal dispersion, atomization, deposition, leaf wetting, distribution, retention and / or uptake of the active substance or ingredient. As a non-limiting examples such additives are diluents, solvents, adjuvants, (ionic) surfactants, wetting agents, spreading agents, oils, stickers, thickeners, penetrants, buffering agents, acidifiers, anti-settling agents, anti-freeze agents, photo-protectors, defoaming agents, biocides, protease inhibitors and / or drift control agents.
[0136] “Agrochemical use”, as used herein, not only includes the use of agrochemicals as defined above (for example, pesticides, growth regulators, nutrients / fertilizers, repellants, defoliants etc.) that are suitable and / or intended for use in field grown crops (e.g., agriculture), but also includes the use of agrochemicals as defined above (for example, pesticides, growth regulators, nutrients / fertilizers, repellants, defoliants etc.) that are meant for use in greenhouse grown crops (e.g. horticulture / floriculture) or hydroponic culture systems and even the use of agrochemicals as defined above that are suitable and / or intended for noncrop uses such as uses in private gardens, household uses (for example, herbicides or insecticides for household use), or uses by pest control operators (for example, weed control etc.).
[0137] “Fungistatic (effect)” or “Fungistatic use”, as used herein, includes any effect or use of an active substance (optionally comprised in a fungicidal or fungistatic composition as defined herein) for controlling, modulating or interfering with the harmful activity of a fungus, including but not limited to inhibiting the growth or activity of the fungus, altering the behavior of the fungus, and repelling the fungus in or on plants, plant parts or in other agro-related settings, such as for example for household uses or in soil.
[0138] “Fungicidal activity”, as used herein, means to interfere with the harmful activity of a fungus, including but not limited to killing the fungus.
[0139] “Fungistatic activity”, as used herein, means to interfere with the harmful activity of a fungus, including but not limited to inhibiting the growth or activity of the fungus, altering the behaviour of the fungus, and repelling the fungus.
[0140] “Fungicidal (effect)” or “Fungicidal use” or “fungicidal activity”, as used herein, includes any effect or use of an active substance (optionally comprised in a fungicidal composition as defined herein) for killing the fungus in or on plants, plant parts or in other agro-related settings, such as for example for household uses or in soil.
[0141] An anti-fungal agent may be any type of protein, VHH antibody or agrochemical having an intrinsic fungicidal or fungistatic activity.
[0142] A “carrier”, as used herein, means any solid, semi-solid or liquid carrier in or on(to) which an active substance can be suitably incorporated, included, immobilized, adsorbed, absorbed, bound, encapsulated, embedded, attached, or comprised. Non-limiting examples of such carriers include nanocapsules, microcapsules, nanospheres, microspheres, nanoparticles, microparticles, liposomes, vesicles, beads, a gel, weak ionic resin particles, liposomes, cochleate delivery vehicles, small granules, granulates, nanotubes, bucky-balls, water droplets that are part of an water-in-oil emulsion, oil droplets that are part of an oil-in-water emulsion, organic materials such as cork, wood or other plant-derived materials (e.g. in the form of seed shells, wood chips, pulp, spheres, beads, sheets or any other suitable form), paper or cardboard, inorganic materials such as talc, clay, microcrystalline cellulose, silica, alumina, silicates and zeolites, or even microbial cells (such as yeast cells) or suitable fractions or fragments thereof.
[0143] As used herein, the term "antibody" refers to polyclonal antibodies, monoclonal antibodies, humanized antibodies, single-chain antibodies, and fragments thereof such as Fab F(ab)2 , Fv, and other fragments that retain the antigen binding function of the parent antibody. As such, an antibody may refer to an immunoglobulin or glycoprotein, or fragment or portion thereof, or to a construct comprising an antigenbinding portion comprised within a modified immunoglobulin-like framework, or to an antigen-binding portion comprised within a construct comprising a non- immunoglobulin-like framework or scaffold.
[0144] As used herein, the term "monoclonal antibody" refers to an antibody composition having a homogeneous antibody population. The term is not limited regarding the species or source of the antibody, nor is it intended to be limited by the manner in which it is made. The term encompasses whole immunoglobulins as well as fragments such as Fab, F ab)2, Fv, and others that retain the antigen binding function of the antibody. Monoclonal antibodies of any mammalian species can be used in this invention. In practice, however, the antibodies will typically be of rat or murine origin because of the availability of rat or murine cell lines for use in making the required hybrid cell lines or hybridomas to produce monoclonal antibodies.
[0145] “Heavy chain variable domain of an antibody or a functional fragment thereof", as used herein, means (i) the variable domain of the heavy chain of a heavy chain antibody, which is naturally devoid of light chains (also indicated hereafter as VHH), including but not limited to the variable domain of the heavy chain of heavy chain antibodies of camelids or sharks or (ii) the variable domain of the heavy chain of a conventional four-chain antibody (also indicated hereafter as VH), including but not limited to a camelized (as further defined herein) variable domain of the heavy chain of a conventional four-chain antibody (also indicated hereafter as camelized VH).
[0146] As further described hereinbelow, the amino acid sequence and structure of a heavy chain variable domain of an antibody can be considered, without however being limited thereto, to be comprised of four framework regions or “FR's”, which are referred to in the art and hereinbelow as “framework region 1 ” or “FR1”; as “framework region 2” or “FR2”; as “framework region 3” or “FR3”; and as “framework region 4” or “FR4”, respectively, which framework regions are interrupted by three complementary determining regions or “CDR's”, which are referred to in the art as “complementarity determining region 1 ” or “CDR1"; as “complementarity determining region 2” or “CDR2”; and as “complementarity determining region 3” or “CDR3”, respectively.
[0147] As also further described hereinbelow, the total number of amino acid residues in a heavy chain variable domain of an antibody (including a HH or a VH) can be in the region of 110-130. It should however be noted that parts, fragments or analogs of a heavy chain variable domain of an antibody are not particularly limited as to their length and / or size, as long as such parts, fragments or analogs retain (at least part of) the functional activity, such as the pesticidal, biocidal, biostatic activity, fungicidal or fungistatic activity (as defined herein) and / or retain (at least part of) the binding specificity of the original a heavy chain variable domain of an antibody from which these parts, fragments or analogs are derived from. Parts, fragments or analogs retaining (at least part of) the functional activity, such as the pesticidal, biocidal, biostatic activity, fungicidal or fungistatic activity (as defined herein) and / or retaining (at least part of) the binding specificity of the original heavy chain variable domain of an antibody from which these parts, fragments or analogs are derived from are also further referred to herein as “functional fragments” of a heavy chain variable domain.
[0148] A method for numbering the amino acid residues of heavy chain variable domains is the method described by Chothia et al. (Nature 342, 877-883 (1989)), the so-called “AbM definition” and the so-called “contact definition”. Herein, this is the numbering system adopted.
[0149] Alternatively, the amino acid residues of a variable domain of a heavy chain variable domain of an antibody (including a VHH or a VH) may be numbered according to the general numbering for heavy chain variable domains given by Kabat et al. (“Sequence of proteins of immunological interest’, US Public Health Services, NIH Bethesda, Md., Publication No. 91 ), as applied to VHH domains from Camelids in the article of Riechmann and Muyldermans, referred to above (see for example FIG. 2 of said reference).
[0150] For a general description of heavy chain antibodies and the variable domains thereof, reference is inter alia made to the following references, which are mentioned as general background art: WO 94 / 04678, WO 95 / 04079 and WO 96 / 34103 of the Vrije Universiteit Brussel; WO 94 / 25591 , WO 99 / 37681 , WO 00 / 40968, WO 00 / 43507, WO 00 / 65057, WO 01 / 40310, WO 01 / 44301 , EP 1134231 and WO 02 / 48193 of Unilever; WO 97 / 49805, WO 01 / 21817, WO 03 / 035694, WO 03 / 054016 and WO 03 / 055527 of the Vlaams Instituut voor Biotechnologie (VIB); WO 03 / 050531 of Algonomics N.V. and Ablynx NV; WO 01 / 90190 by the National Research Council of Canada; WO 03 / 025020 (=EP 1 433 793) by the Institute of Antibodies; as well as WO 04 / 041867, WO 04 / 041862, WO 04 / 041865, WO 04 / 041863, WO 04 / 062551 by Ablynx; Hamers-Casterman et al., Nature 1993 Jun. 3; 363 (6428): 446-8.
[0151] Generally, it should be noted that the term “heavy chain variable domain” as used herein in its broadest sense is not limited to a specific biological source or to a specific method of preparation. For example, as will be discussed in more detail below, the heavy chain variable domains of the invention can be obtained (1 ) by isolating the VHH domain of a naturally occurring heavy chain antibody; (2) by isolating the VH domain of a naturally occurring four-chain antibody (3) by expression of a nucleotide sequence encoding a naturally occurring VHH domain; (4) by expression of a nucleotide sequence encoding a naturally occurring VH domain (5) by “camelization” (as described below) of a naturally occurring VH domain from any animal species, in particular a species of mammal, such as from a human being, or by expression of a nucleic acid encoding such a camelized VH domain; (6) by “camelisation” of a “domain antibody” or “Dab” as described by Ward et al (supra), or by expression of a nucleic acid encoding such a camelized VH domain (7) using synthetic or semi-synthetic techniques for preparing proteins, polypeptides or other amino acid sequences; (8) by preparing a nucleic acid encoding a VHH or a VH using techniques for nucleic acid synthesis, followed by expression of the nucleic acid thus obtained; and / or (9) by any combination of the foregoing. Suitable methods and techniques for performing the foregoing will be clear to the skilled person based on the disclosure herein and for example include the methods and techniques described in more detail hereinbelow.
[0152] However, according to a specific embodiment, the heavy chain variable domains as disclosed herein do not have an amino acid sequence that is exactly the same as (i.e. as a degree of sequence identity of 100% with) the amino acid sequence of a naturally occurring VH domain, such as the amino acid sequence of a naturally occurring VH domain from a mammal, and in particular from a human being.
[0153] The terms "effective amount" and "effective dose", as used herein, mean the amount needed to achieve the desired result or results. As used herein, the terms “determining", "measuring”, "assessing”, “monitoring” and “assaying" are used interchangeably and include both quantitative and qualitative determinations.
[0154] All documents cited in the present specification are hereby incorporated by reference in their entirety. Unless otherwise defined, all terms used in disclosing the invention, including technical and scientific terms, have the meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. By means of further guidance, term definitions are included to better appreciate the teaching of the present invention.
[0155] VHH antibodies
[0156] The VHH antibodies disclosed here are generally capable of binding to at least one fungus. The VHH antibody thereby causes retardation of growth of a spore of the said at least one fungus and / or lysis of a spore of the said at least one fungus. That is to say, binding of the VHH antibody to a fungus results in retardation of growth of a spore of the said at least one fungus and / or lysis of a spore of the said at least one fungus. Therefore, in a particular embodiment, the VHH antibody of the invention causes retardation of growth of a spore of the said at least one fungus. In another particular embodiment, the VHH antibody of the invention causes lysis of a spore of the said at least one fungus.
[0157] The VHH antibodies of and used in the invention may (specifically) bind to at least one fungal species. That is to say, the VHH antibodies of the invention were selected to bind to a fungal antigen. That is to say, the VHH antibodies of the invention were screened for their ability to bind to a fungal antigen or fungal target. Screening of such VHH antibodies may be done by displaying the VHH antibodies in for example phage display or yeast display or other similar technologies in the art which allows to select the VHH antibodies that bind to a certain fungal antigen.
[0158] The fungal antigen or fungal target used in a selection such as a phage selection or a binding assay such as an ELISA as described above may be a plant fungal antigen or a plant fungal target, such as but not limited to a fungal antigen or a fungal target. More specifically, the fungal antigen or fungal target used in a selection such as a phage selection or a binding assay such as an ELISA as described above, may be an antigen taken from the plant pathogenic fungus as described herein. The antigen may comprise a specific protein, lipid or lipid fraction purified from said fungal species. Alternatively the antigen may comprise a mixture of proteins and or lipids. In some cases homogenized fungal material is used where the homogenized material is derived from fungal mycelium, spores, sporulation spores or a mixture thereof. Most specifically the antigen used in a selection, such as a phage selection, or binding assay such as an ELISA, to obtain the VHH antibodies of the invention is a homogenized mixture derived from sporulation Botrytis cinerea spores.
[0159] The VHH antibody of and used in the invention may (specifically) bind to a fungal antigen or fungal target causing retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus. The VHH antibodies of the invention may cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at elevated salt concentrations. That is to say, in an assay as described herein (such as an antifungal assay described in Example 5) to assess the ability of the VHH antibodies to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus, salt concentrations may be increased to a concentration that is higher than the salt concentrations employed in a standard assay where no extra salt is added (such as the assay performed in WO 2021 / 198396). An “IC50 value”, "EC50”, “IC50”, "EC50” or “half maximal inhibitory concentration” as used herein interchangeably is a measure for the potency of a tested VHH antibody in inhibiting the growth of a fungal pathogen. In practice (also see example 5) the growth of a fungal pathogen is tracked by measuring the confluency of said fungal pathogen in for example a well of a 96-well plate in the presence of a series of different concentrations of the tested VHH antibody. The confluency data at the time-point at which the non-treated or negative control reaches 90% saturation is then taken for each VHH antibody concentration. Said confluence values are then plotted against the log transformed concentration values yielding a sigmoidal curve. This sigmoid curve may serve to define an IC50 value. Where this IC50 is the concentration of VHH antibody where the corresponding confluence value is 50% of the saturated value as estimated by the maximum of the sigmoidal function.
[0160] More specifically, the IC50 may be the IC50 for inhibition of spore germination and / or mycelial growth (i.e. the concentration (pM) that inhibits 50% of spore germination and / or mycelial growth) for example of Fusarium oxysporum and / or Botrytis cinerea. In some embodiments, the VHH antibody have an IC50 of less than about 20pM in the presence of 100mM of NaCI, more preferably an IC50 of less than about 15pM in the presence of 100mM of NaCI, more preferably an IC50 of less than about 10pM in the presence of 100mM of NaCI, more preferably an IC50 of less than about 5pM in the presence of 100mM of NaCI.
[0161] In some embodiments, the VHH antibody have an IC50 of less than about 5pM in the absence of 100mM NaCI, in a more preferred embodiment the VHH antibody have an IC50 of less than about 4pM in the absence of 10OmM NaCI, in a more preferred embodiment the VHH antibody have an IC50 of less than about 3pM in the absence of 10OmM NaCI, in an even more preferred embodiment the VHH antibody have an IC50 of less than about 2 pM in the absence of 10OmM NaCI. In a most preferred embodiment the VHH antibody have an IC50 of 2 pM in the absence of 100mM NaCI. And where the IC50 values reflect the concentration needed for 50% inhibition of spore germination and / or mycelial growth, as performed in an assay according to Example 5. The prior art molecule 10G11 _Q1 D of PCT publication WO 2021 / 198396, shows no measurable IC50 value at a concentration of 100pM of NaCI, for inhibition of spore germination and / or mycelial growth, as performed in an assay according to Example 5, whereas without NaCI the IC50 value of 10G1 1 _Q1 D when performed according to the assay in Example 5 is between 2 and 3 pM.
[0162] Therefore, the term “elevated salt concentration” in the context of NaCI, may be defined as a concentration of NaCI where the VHH antibody of the invention retains its capacity of causing retardation of growth of a spore of at least one fungal species and / or lysis of a spore of at least one fungal species as compared to VHH antibody not embodied by the current invention, such as 10G11_Q1 D of PCT publication WO 2021 / 198396. More specifically, the concentration of NaCI considered as elevated may be 100mM or higher.
[0163] In addition the prior art VHH antibody 10G1 1_Q1 D of PCT publication WO 2021 / 198396 lacks the ability to repress spore outgrowth in an antifungal assay as described in Examples 5 and 6 for prolonged periods of time of for example 3 or more days. In some embodiments the VHH antibody of the invention are capable of supressing spore outgrowth in an antifungal assay for 4 days or more, more preferable 5 days or more, even more preferably 6 days or more, even more preferably 7 days or more, even more preferably 8 days or more, even more preferably 9 days or more, even more preferably 10 days or more, even more preferably 12 days or more, even more preferably 14 days or more, even more preferably 16 days or more, even more preferably 18 days or more, even more preferably 20 days or more, when performed in an assay as described in Examples 5 and 6.
[0164] Alternatively, the ability of the VHH antibody of the current invention to cause retardation of growth of a spore of at least one fungal species and / or lysis of a spore of the at least one fungal species, may be assessed by increasing the concentration of MgClz salt in the assay media to set it against the molecules of the prior art.
[0165] The inventors have here provided VHH antibodies that bind to at least one fungal species, hereby causing retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species and have screened for and / or selected for the ability of said VHH antibodies to retain their activity at elevated concentrations of MgClz. The present invention provides VHH antibodies that bind to at least one fungal species, hereby causing retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species and whereby said retardation of growth of a spore of the at least one fungal species or lysis of a spore of the at least one fungal species occurs at MgCI2 concentrations that are higher compared to the activity of a VHH antibody not screened for and / or selected for its ability to retain activity at elevated MgCI2 concentrations. More specifically, in some aspects the VHH antibodies of the current invention retain 50% of their activity at a MgCI2 concentration that is 1 .5 times higher than the prior art molecules not screened and / or selected to have activity at elevated MgCI2 concentrations, in some aspects 1.8 times higher, in some aspects 2 times higher, in some aspects 2.5 times higher, in some aspects 3 times higher, in some aspects 3.5 times higher, in some aspects 4 times higher, and even in some aspects 5 times higher, when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 7, and when comparing to the activity of a VHH antibody that was not screened or selected to have activity at elevated MgCI2 concentrations. In a preferred embodiment, the VHH antibodies of the current invention retain at least 50% of their activity at a MgCI2 concentration that is at least 2 times higher than the prior art molecules not screened and / or selected to have activity at elevated MgCI2 concentrations. For assessing the above, the prior art molecule is preferably 10G1 1 _Q1 D of PCT publication WO 2021 / 198396.
[0166] In a specific aspect, the VHH antibody of this invention retains at least 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a MgClz concentration of 20 pM or higher, in an even more preferred aspect, the VHH antibody of this invention retains at least 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a MgClz concentration of 30 pM or higher, even more preferred at 40 pM or higher, even more preferred 50 pM or higher, when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 7 and as compared to the condition where no MgClz is added.
[0167] Put differently, the VHH antibody of this invention loses 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a MgClz concentration of between 15 pM and 65 pM MgClz compared to the condition where no MgClz is added and when assessed according to the assay in Examples 5 and 8. More specifically the estimated concentration at which 50% of the activity of the VHH antibody of the invention is lost compared to the condition where no MgClz is added is between 20 pM and 50 pM MgClz, even more specifically between 25 pM and 45 pM MgClz when assessing the activity in an antifungal assay, such as the set-up as described in Example 5 and 7 as compared to the condition where no MgClz is added. Whereas the VHH antibody of the prior art such as 10G11_Q1 D of PCT publication WO 2021 / 198396, loses 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a MgCI2 concentration of between 15 pM and 25 pM MgCla, when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 7 and as compared to the condition where no MgCla is added. More specifically the estimated concentration at which 50% of the activity of the VHH antibody of the prior art 10G1 1_Q1 D is lost compared to the condition where no MgCI2 is added is 20 pM MgCla when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 7.
[0168] In some aspects the VHH antibodies of the current invention bind to at least one fungal species, hereby causing retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species and whereby said retardation or lysis is unchanged in the presence of a MgCI2 concentration of 4 pM MgCla, 5 pM MgCla, 6 pM MgCla, 7 pM MgCla, 8 pM MgCla, 9 pM MgCla, 10 pM MgCla, 11 pM MgCla, 12 pM MgCla, 13 pM MgCla, 14 pM MgCla, 15 pM MgCla or even 16pM MgCla, when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 7.
[0169] Therefore, the term “elevated salt concentration” in the context of MgCla, may be defined as a concentration of MgCla where the VHH antibody of the invention retains its capacity of causing retardation of growth of a spore of at least one fungal species and / or lysis of a spore of at least one fungal species as compared to VHH antibody not embodied by the current invention, such as 10G11_Q1 D of PCT publication WO 2021 / 198396. More specifically, the concentration of MgCla considered as elevated may be 10pM or higher, more preferably 20 pM or higher.
[0170] The inventors have here provided VHH antibodies that bind to at least one fungal species, hereby causing retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species and have screened for and / or selected for the ability of said VHH antibodies to retain their activity at elevated concentrations of CaCIz. The present invention provides VHH antibodies that bind to at least one fungal species, hereby causing retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species and whereby said retardation of growth of a spore of the at least one fungal species or lysis of a spore of the at least one fungal species occurs at CaCIs concentrations that are higher compared to the activity of a VHH antibody not screened for and / or selected for its ability to retain activity at elevated CaCb concentrations. More specifically, in some aspects the VHH antibodies of the current invention retain 50% of their activity at a CaCIz concentration that is 1 .5 times higher than the prior art molecules not screened and / or selected to have activity at elevated CaCl2 concentrations, in some aspects 1 .8 times higher, in some aspects 2 times higher, in some aspects 2.5 times higher, in some aspects 3 times higher, in some aspects 3.5 times higher, in some aspects 4 times higher, and even in some aspects 5 times higher, when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 8 , and when comparing to the activity of a VHH antibody that was not screened or selected to have activity at elevated CaCl2 concentrations. For assessing the above, the prior art molecule is preferably 10G1 1 _Q1 D of PCT publication WO 2021 / 198396. In a specific aspect, the VHH antibody of this invention retains at least 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a CaCl2 concentration of 150 pM or higher, in an even more preferred aspect, the VHH antibody of this invention retains at least 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a CaCl2 concentration of 200 pM or higher, even more preferably of 250 pM or higher, even more preferably of 300 gM or higher, even more preferably of 350 pM or higher, even more preferred of 450 pM or higher, 500 pM or higher, even more preferred of 550 pM or higher, even more preferred of 600 pM or higher, even more preferred of 650 pM or higher when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 8, and as compared to the condition where no CaCIz is added.
[0171] Put differently, the VHH antibody of this invention loses 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a CaCIz concentration of between 200 pM and 1000 pM CaCIz compared to the condition where no CaCIz is added and when assessed according to the assay in Examples 5 and 8. More specifically the estimated concentration at which 50% of the activity of the VHH antibody of the invention is lost compared to the condition where no CaCIz is added is between 250 pM and 800 pM CaCIz, even more specifically between 250 pM and 700 pM CaCIz when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 8 and as compared to the condition where no CaCIz is added. Whereas the VHH antibody of the prior art such as 10G1 1 _Q1 D of PCT publication WO 2021 / 198396, loses 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a CaCIz concentration of between 100 pM and 200 pM CaCIz, when assessing the activity in an antifungal assay, such as the set-up as described in Example 5 and as compared to the condition where no MgClz is added. More specifically the estimated concentration at which 50% of the activity of the VHH antibody of the prior art is lost compared to the condition where no CaCIz is added is 152 pM CaCIz when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 8.
[0172] In some aspects the VHH antibodies of the current invention bind to at least one fungal species, hereby causing retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species and whereby said retardation or lysis is unchanged in the presence of a CaCIz concentration of 10 pM CaCIz, 20 pM CaCIz, 30 pM CaCIz, 40 pM CaCIz, 50 pM CaCIz, 60 pM CaCIz, 70 pM CaCIz, 80 pM CaCIz, 90 pM CaCIz, 100 pM CaCIz, 110 pM CaCIz, 120 pM CaCIz, 150 pM CaCIz, 200 pM CaCIz, 250 pM CaCIz, 300 pM CaCIz, 350 pM CaCIz, 400 pM CaCIz, 450 pM CaCIz, or even 500 pM CaCIz, when assessing the activity in an antifungal assay, such as the set-up as described in Examples 5 and 8.
[0173] Therefore, the term “elevated salt concentration” in the context of CaCIz, may be defined as a concentration of CaCIz where the VHH antibody of the invention retains its capacity of causing retardation of growth of a spore of at least one fungal species and / or lysis of a spore of at least one fungal species as compared to VHH antibody not embodied by the current invention, such as 10G11_Q1 D of PCT publication WO 2021 / 198396. More specifically, the concentration of CaCIz considered as elevated may be 10OpM or higher, more preferably 150pM or higher.
[0174] The plant pathogenic fungus used in the assay such as an antifungal assay may be a plant pathogenic fungus as described herein. Preferably the plant pathogenic fungus used in the antifungal assay is a Botrytis species, even more preferably Botrytis cinerea.
[0175] The CDR and framework regions maybe defined according to the Kabat numbering system.
[0176] In some embodiments, the VHH antibody may be from 80 to 200 residues in length. In another specific embodiment the VHH antibody has N- or C-terminal extensions.
[0177] In some embodiments the VHH antibody are derived from a precursor polypeptide consisting of a cleavable leader peptide fused to the N-terminus of the VHH antibody. Such a cleavable leader may be required for the successful production and / or secretion of the VHH antibody from a host cell. A cleavable leader often consists of a pre region and a pro region. The pre region is sometimes referred to as the signal peptide whereas the pro region is sometimes referred to as a “carrier peptide” (not to be confused with a carrier in the concept of a composition, more specifically an agrochemical composition). Often the cleavable leader exists of a pre and pro region. However in some cases the pro region may be missing and thus the cleavable leader solely exists of a pre region. In some cases the cleavable leader may be chosen depending on the species of host cell used for the production of the VHH antibody. In some embodiments where the host cell is a Komagataella host cell such as komagataella phaffii (aka Pichia pastoris), the cleavable leader is the pre-pro peptide from a-mating factor (aMF) from Saccharomyces cerevisiae. Additional cleavable leaders can be found in for example WO2012152823 identified as SEQ ID NOs: 1 to 46. In some embodiments, where the host cell is a filamentous fungal host cell, such as a Trichoderma reesei or an Aspergiullus niger host cell, the cleavable leader peptide at the N-terminus may consist of only the signal peptide or signal sequence of, but not limited to glucoamylase Gia peptide, a cellobiohydrolase Cbh1 peptide or a cellobiohydrolase cbh2 peptide. In some embodiments, where the host cell is a filamentous fungal host cell, the N-terminus may contain a signal peptide and a carrier peptide. Carrier peptides may be, but are not limited to, a glucoamylase Gia peptide, a cellobiohydrolase Cbh1 peptide or a cellobiohydrolase cbh2 peptide. Carrier peptides may consist of a functional fragment of, but not limited to, glucoamylase Gia peptide, a cellobiohydrolase Cbh1 peptide or a cellobiohydrolase cbh2 peptide. A functional fragment of a carrier peptide may be limited to the N-terminal region of, but not limited to, glucoamylase Gia peptide, a cellobiohydrolase Cbh1 peptide or a cellobiohydrolase cbh2 peptide. Alternatively the functional fragment of a carrier peptide may be limited to the catalytic domain of the carrier peptide, such as the catalytic domain of the cbh1 carrier peptide. The N-terminal region may consist of only the signal peptide or signal sequence of, but not limited to glucoamylase Gia peptide, a cellobiohydrolase Cbh1 peptide or a cellobiohydrolase cbh2 peptide.
[0178] In some embodiments, where the host cell is a bacterial host cell, such as a Bacillus host cell for such as a Bacillus subtilis or a Bacillus licheniformis host cell, the cleavable leader peptide at the N-terminus may consist of only the signal peptide such as but not limited to the amyS signal peptide, the yvcE signal peptide , the yoqM signal peptide, the yuaB signal peptide, the pel signal peptide the yoaW signal peptide, the yqxi signal peptide, the pelB signal peptide, the lipA signal peptide , the lipB signal peptide, the yoqH signal peptide, the sacB signal peptide, the ybfO signal peptide , the bglS signal peptide, the yddT signal peptide or the yobB signal peptide. Other suitable cleavable leader peptides, where the host cell is a bacterial host cell, such as a Bacillus host cell for such as a Bacillus subtilis or a Bacillus licheniformis host cell may be found in Systematic Screening of Optimal Signal Peptides for Secretory Production of Heterologous Proteins in Bacillus subtilis. Gang Fu; Jinlan Liu; Jinshan Li; Beiwei Zhu; D. Journal of Agricultural and Food Chemistry, 2018. DOI: 10.1021 / acs.jafc.8b04183 Or Optimization of Protease Secretion in Bacillus subtilis and Bacillus licheniformis by Screening of Homologous and Heterologous Signal Peptides. Christian Degering; Thorsten Eggert; Michael Puls; Applied and Environmental Microbiology, 2010, Vol 76 (19), 6370-6376.DOI: 10.1128 / aem.01146-10.
[0179] In some cases, the VHH antibody comprises a N or C-terminal extension that can be used for purification or detection of the protein of interest, such as a His6, c-myc, FLAG, C-tag, 3xFLAG, His5, His10, HA, T7, strep, HSV, and / or an E-tag. In some cases the N-terminal extension that can be used for purification or detection of the protein of interest, such as a His6, c-myc, FLAG, C-tag, 3xFLAG, His5, His10, HA, T7, strep, HSV, and / or an E-tag is located between the cleavable leader and the VHH antibody.
[0180] In some cases, the cleavage of the leader peptide from the precursor polypeptide is incomplete, i.e. a smaller fragment or the entire cleavable leader remains attached the VHH antibody. Therefore, the N terminus can be extended by 1 , 2, 3, 4, 5 or more amino acids derived from the leader. In some aspects the leader peptide will be complete i.e. the N-terminal extension is the length of the original cleavable leader of the precursor polypeptide. Where a smaller fragment or the entire cleavable leader remains attached to the VHH antibody, the VHH antibody of the invention will still bind to at least one fungal pest and will still cause retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species.
[0181] The VHH antibodies of the invention may be provided in the form of compositions, for example agrochemical compositions.
[0182] Compositions comprising at least one VHH antibody
[0183] In one aspect, the present inventors have provided compositions, particularly agrochemical compositions, comprising at least one antibody of the invention. In particular at least one VHH antibody which can bind to at least one fungal species. Importantly, through this interaction with, or a specific part of, the at least one fungal species, the compositions disclosed herein are capable of inhibiting, preventing or reducing one or more biological activities of the plant pathogen, such that the growth of the plant pathogen is inhibited, prevented or reduced. In certain embodiments, the agrochemical compositions as disclosed herein are capable of killing a plant pest through the specific interaction of at least one VHH antibody, which can specifically bind to a pest and which is comprised in the compositions.
[0184] Furthermore, the compositions comprising at least one VHH antibody as disclosed herein have several additional advantages over the traditional immunoglobulin and non-immunoglobulin binding agents known in the art. Indeed, in certain embodiments, the amino acid sequences of a VHH antibody as disclosed herein are isolated heavy chain immunoglobulin variable domains, which are more potent and more stable than conventional four-chain antibodies, leading to (1 ) lower dosage forms, less frequent dosage and thus less side effects; and (2) improved stability resulting in a broader choice of administration routes. Because of their small size, heavy chain immunoglobulin variable domains have the ability to cross membranes and penetrate into physiological compartments, tissues and organs not accessible to other, larger compounds and proteins.
[0185] In particular embodiments, the invention provides an agrochemical composition or a biological pesticide composition for combating plant pests, more particularly a plant fungus, which composition comprises at least one VHH antibody.
[0186] In certain further embodiments, the invention provides an agrochemical composition for combating plant pests, which composition comprises at least two (different) VHH antibodies as the active substance.
[0187] In still further embodiments, the invention provides an agrochemical composition for combating plant pests, which composition comprises at least three (different) VHH antibodies as the active substance. Additional combinations of different VHH antibodies with other polypeptides are also envisaged.
[0188] The agrochemical composition according to the invention is an agrochemical composition, as defined herein, for combating plant pathogenic fungi, as defined before, meaning that the agrochemical composition, more in particular the active substance, as defined before, comprised in the agrochemical composition, is able to interfere with, preferably to reduce or to arrest, the harmful effects of one or more plant pathogenic fungi on one or more plants, preferably crops.
[0189] In a broad embodiment the invention relates to a polypeptide that can bind to at least one fungus and hereby cause retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the at least one fungal species. In some embodiments these polypeptides are comprised in a composition, more specifically an agrochemical composition.
[0190] Binding of a VHH antibody to a at least one fungal species can be determined in any suitable manner known per se, including, for example biopanning, Scatchard analysis and / or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, such as ELISA assays (for example as described in Example 4), and the different variants thereof known in the art.
[0191] In further particular embodiments, the compositions as disclosed herein at least comprise a VHH antibody which: comprises a CDR1 region having the sequence set out in any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263, a CDR2 region having the sequence set out in any one of SEQ ID NO: 4, 91 to 1 15, 244, 257 and 264, and a CDR3 region having the sequence set out in any one of SEQ ID NO: 5, 116 to 140, 245, 258 and 265 (and which is capable of binding to a fungus); or comprises the amino acid sequence set out in any one of SEQ ID NO: 2, 16 to 40 and 241 or an amino acid sequence having at least about 80% sequence identify thereto (and which VHH antibody is capable of binding to a fungus).
[0192] In particular embodiments, the at least one VHH antibody in the compositions as disclosed herein are heavy chain variable domains that comprises, consist or essentially consist of four framework regions (FR1 to FR4 respectively) and three complementarity determining regions (CDR1 to CDR3 respectively); or any suitable fragment of such an heavy chain variable domain (which will then usually contain at least some of the amino acid residues that form at least one of the CDRs, as further described herein). The sequences of the framework regions may be variable, or they may be specified.
[0193] The VHH antibody of the compositions disclosed herein may in particular be a domain antibody (or an heavy chain variable domain that is suitable for use as a domain antibody), a single domain antibody (or an heavy chain variable domain that is suitable for use as a single domain antibody), or a "dAb" (or an heavy chain variable domain that is suitable for use as a dAb); other single variable domains, or any suitable fragment of any one thereof. For a general description of (single) domain antibodies, reference is also made to the prior art cited above, as well as to EP 0368 684. For the term “dAb’s”, reference is for example made to Ward et al. (Nature 1989 Oct 12; 341 (6242): 544-6), to Holt et al., Trends Biotechnol., 2003, 21 (1 1 ):484- 490; as well as to for example WO 06 / 030220, WO 06 / 003388 and other published patent applications of Domantis Ltd.
[0194] Thus, in particular embodiments, the present invention provides VHH antibodies with the (general) structure
[0195] FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4 in which FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to the complementarity determining regions 1 to 3, respectively, and are as further defined herein. In particular, the invention in some specific embodiments provides agrochemical compositions comprising at least one VHH antibody that binds at least one fungal species, and that has at least 70%, at least 75%, at least 80%, preferably at least 85%, such as at least 90% or at least 95% or at least 98% sequence identity or more sequence identity with the amino acid sequence of any one of SEQ ID NO: 2, 41 to 65 and 242, and nucleic acid sequences that encode such amino acid sequences.
[0196] Some particularly preferred amino acid sequences of a VHH antibody as disclosed herein are those which can bind to and / or are directed against a pest, such as a fungus, and which have at least 90% (for example at least 95% or at least 97%) amino acid identity with the amino acid sequence of any one of SEQ ID NO: 2, 41 to 65 and 242 wherein any variation in sequence compared to the reference sequence (i.e. the specified SEQ ID NO sequence) occurs only in the CDR regions. Some particularly preferred amino acid sequences of a VHH antibody as disclosed herein are those which can bind to and / or are directed against a pest, such as a fungus, and which have at least 90% (for example at least 95% or at least 97%) amino acid identity with the amino acid sequence of any one of SEQ ID NO: 2, 41 to 65 and 242 wherein any variation in sequence compared to the reference sequence (i.e. specified SEQ ID NO sequence) occurs only in the framework regions. In other embodiments, variations in the sequence compared to the reference sequence (i.e. the specified SEQ ID NO sequence) may occur in the CDR regions and / or the framework regions. In some embodiments, variations in the sequence compared to the reference sequence (i.e. the specified SEQ ID NO sequence) may occur in the CDR3 region.
[0197] Again, such VHH antibody may be derived in any suitable manner and from any suitable source, and may for example be naturally occurring VHH sequences (i.e. from a suitable species of Camelid) or synthetic or semi-synthetic heavy chain variable domains, including but not limited to “camelized” immunoglobulin sequences (and in particular camelized heavy chain variable domain sequences), as well as those that have been obtained by techniques such as affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, veneering, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person, also including techniques based on mathematic algorithms such as deep learning techniques such as for example the publicly accessible predictive models of IgFold or AlphaFold (see: Fast, accurate antibody structure prediction from deep learning on massive set of natural antibodies. Ruffolo Jeffrey A., Gray Jeffrey J. Biophysical Journal, 2022, Vol 121 (3), 155a-156a DOI: 10.1016 / j.bpj.2021.11.1942); or any suitable combination of any of the foregoing as further described herein.
[0198] It is understood that the agrochemical compositions or the biological control compositions as disclosed herein are stable, both during storage and during utilization, meaning that the integrity of the agrochemical composition is maintained under storage and / or utilization conditions of the agrochemical composition, which may include elevated temperatures, freeze-thaw cycles, changes in pH or in ionic strength, UV-irradiation, presence of harmful chemicals and the like. More preferably, the VHH antibody remain stable in the agrochemical composition, meaning that the integrity and the fungicidal activity of the VHH antibody is maintained under storage and / or utilization conditions of the agrochemical composition, which may include elevated temperatures, freeze-thaw cycles, changes in pH or in ionic strength, LJV- irradiation, presence of harmful chemicals and the like. Most preferably, said VHH antibody remain stable in the agrochemical composition when the agrochemical composition is stored at ambient temperature for a period of two years or when the agrochemical composition is stored at 54°C for a period of two weeks. Preferably, the agrochemical composition of the present invention retains at least about 70% activity, more preferably at least about 80% activity, most preferably at least about 90% activity or more. Optionally, the VHH antibody may be comprised in a carrier, as defined, to protect the VHH antibody from harmful effects caused by other components in the agrochemical composition or from harmful effects during storage or during application. Examples of suitable carriers include, but are not limited to alginates, gums, starch, - cyclodextrins, celluloses, polyurea, polyurethane, polyester, microbial cells or clay.
[0199] The agrochemical composition may occur in any type of formulation, preferred formulations are powders, wettable powders, wettable granules, water dispersible granules, emulsions, emulsifiable concentrates, dusts, suspensions, suspension concentrates, suspoemulsions (mixtures of suspensions and emulsions), capsule suspensions, aqueous dispersions, oil dispersions, aerosols, pastes, foams, slurries or flowable concentrates.
[0200] The VHH antibody, may be the only active substance in the agrochemical or biological control composition according to the invention; however, it is also possible that the agrochemical composition comprises one or more additional agrochemicals, as defined, in addition to the VHH antibody (or the at least one, at least two or at least three VHH antibody as disclosed herein). Such additional agrochemicals or biological control compositions may have a different effect on plant pests as the VHH antibody, they may have a synergistic effect with the VHH antibody, or they may even modify the activity of the VHH antibody on certain plants. Suitable additional agrochemicals can be herbicides, insecticides, fungicides, nematicides, acaricides, bactericides, viricides, plant growth regulators, safeners and the like. Such agrochemicals may be chemicals or may be biological substances, for example a microbial. They include, but are not limited to glyphosate, paraquat, metolachlor, acetochlor, mesotrione, 2, 4-D, atrazine, glufosinate, sulfosate, fenoxaprop, pendimethalin, picloram, trifluralin, bromoxynil, captan, clodinafop, Dithiocarbamate, fluroxypyr, phenylpyrroles (such as fludioxoni I), hydroxyanilides (such as fenhexamid), dicarboximides (such as iprodione), kresoxim-methyl, nicosulfuron, bensulfuron, imazetapyr, dicamba, imidacloprid, thiamethoxam, fipronil, chlorpyrifos, deltamethrin, lambda-cyhalotrin, endosulfan, methamidophos, carbofuran, clothianidin, cypermethrin, abamectin, diflufenican, spinosad, fluopyram, indoxacarb, bifenthrin, tefluthrin, azoxystrobin, thiamethoxam, tebuconazole, mancozeb, morpholine, cyazofamid, fluazinam, Myclobutanil, pyraclostrobin, epoxiconazole, chlorothalonil, strobilurin, triazole, vinclozolin, copper fungicides (for example copper oxychloride, copper hydroxide), anilinopyrimidines (e.g., cyprodinil, pyrimethanil, mepanipyrim), trifloxystrobin, prothioconazole, difenoconazole, carbendazim, propiconazole, thiophanate, sulphur, boscalid, tricyclazole, hexaconazole, metalaxyl, benomyl, benzimidazole, kitazin, tridemorph, propineb, streptomycin sulfate, and oxytetracycline and other known agrochemicals or any suitable combination(s) thereof.
[0201] Suitable additional agrochemicals may be a biological substance, such as a microbial, for example a Pseudomonas strain such as Pseudomonas chlororaphis (ma342), Pseudomonas sp. strain dsmz 13134; or a Bacillus strain such as Bacillus thuringiensis ssp. aizawai Abts-1857, Bacillus thuringiensis ssp. aizawai Gc-91 , Bacillus thuringiensis ssp. kurstaki 101 13p / B, Bacillus thuringiensis ssp. kurstaki Sa-1 1 10473p / B, Bacillus thuringiensis ssp. kurstaki Strain EG 2348, Bacillus thuringiensis ssp. Israeliensis (Serotype H-14) Strain AM65-52, Bacillus amyloliquefaciens subsp. plantarum D747, Bacillus amyloliquefaciens MBI 600, Bacillus amyloliquefaciens strain FZB24, Bacillus amyloliquefaciens strain qst 713, Bacillus firmus 1-1582; or a Streptomyces strain such as Streptomyces strain K61 ; or a Trichoderma strain such as Trichoderma harzianum T-22, Trichoderma asperellum strain T34, Trichoderma atroviride strain SC1 ; or a Coniothyrium strain such as Coniothyrium minitans, an Isaria strain such as Isaria fumosorosea var. apopka strain 97; or a Pythium strain such as Pythium oligandrum M1 ; or a Clonostachys strain such as Clonostachys rosea J1446; or a Paecilomyces strain such as Paecilomyces fumosoroseus FE9901 ; or a Metarhizium strain such as metarhizium brunneum strain MA 43; or a Beauveria strain such as Beauveria bassiana ATCC 74040, Beauveria bassiana strain GHA; or a Aureobasidium strain such as Aureobasidium pullulans strain DSM14940 or DSM14941 ; or a Ampelomyces strain such as Ampelomyces quisqualis strain AQ10; or a Saccharomyces strain such as Saccharomyces cerevisiae LASO2; or a Candida strain such as Candida oleophila strain O; or an Alamthomyce strain such as Akanthomyce muscarius strain VE6. The microbial can also be a virus such as Granulose virus 8615p / b, Granulose virus 9198p / b, Granulose virus 10147p / b Granulose virus 10521 p / b Granulose virus 1 1 196g / b, pepino mosaic virus or a tomato mosaic virus.
[0202] Suitable additional agrochemicals may be a bioactive proteins such as a small peptide with antimicrobial properties such as an antimicrobial peptide or AMP. AMPs usually have a length of in the range of 10 to 50 amino acids. AMPs are commonly anionic or cationic and can be subdivided in 4 classes: (I) anionic peptides which are rich in glutamic and aspartic acids , (ii) linear cationic a-helical peptides, (iii) cationic peptides enriched for specific amino acid rich in proline, arginine, phenylalanine, glycine, tryptophan and (iv) anionic / cationic peptides forming disulfide bonds . More specific examples are plant derived AMPs with antimicrobial or antiviral activities such as peptides composed of at least two helical domains connected by a linker / turn such as plant-derived amphipathic helix or two helices engineered into a helix-tum-helix (HTH) format in which homologous or heterogeneous helices are connected by a peptide linker. For example, as described in WO2021202476, W02020072535, W02020176224 or W02003000863. Other examples of bioactive proteins are Bt toxins, e.g., a Cry protein, a Cyt protein, or a Vip protein, or an 5-endotoxin (e.g., Crystal (Cry) toxins and / or cytolytic (Cyt) toxins); vegetative insecticidal proteins (Vips); secreted insecticidal protein (Sips); or Bin-like toxins. “Vip” or “VIP” or “Vegetative Insecticidal Proteins” refer to proteins discovered from screening the supernatant of vegetatively grown strains of Bt for possible insecticidal activity. Vips have little or no similarity to Cry proteins. Of particular use and preference for use with this document are what have been called VIP3 or Vip3 proteins, which have Lepidopteran activity. Vips are thought to have a similar mode of action as Bt cry peptides. Further examples may be polypeptides derived from spider venom such as venom from funnel-web spiders such as agatoxins or diguetoxins more specifically a Mu-diguetoxin-dc1 a variant polypeptides or a U1 -agatoxin-Ta1 b variant polypeptide. Other examples are polypeptides derived from sea anemone, such as Av3 toxins. Such as described in WO2022067214 or WO2021216621 or WO2022212777.
[0203] In some aspects, the VHH antibody of the invention may be a bivalent or multivalent VHH antibody, where two or more VHH antibodies are fused to form a fusion protein. In some aspects the bivalent or multivalent VHH antibody comprises the same VHH antibody. In another aspect, the bivalent or multivalent VHH antibody comprises two or more different VHH antibodies. As such, bivalent or multivalent VHH antibodies may bind multiple antigens, where the antigens are identical. Alternatively, bivalent or multivalent VHH antibodies may bind multiple antigens, where the antigens are different. In some cases the antigens may be identical, but the bivalent or multivalent antibodies may bind different epitopes in the same antigen, in other cases the bivalent or multivalent antibodies may bind the same epitopes in the same antigens.
[0204] As such, In further particular embodiments, two or more VHH antibodies or a combination of VHH antibodies may be linked to each other or may be interconnected. In particular embodiments, the two or more VHH antibodies or a combination of VHH antibodies are linked to each other via one or more suitable linkers or spacers. Suitable spacers or linkers for use in the coupling of different two or more VHH antibodies or a combination of VHH antibodies as disclosed herein will be clear to the skilled person and may generally be any linker or spacer used in the art to link peptides and / or proteins.
[0205] Some particularly suitable linkers or spacers include for example, but are not limited to, polypeptide linkers such as glycine linkers, serine linkers, mixed glycine / serine linkers, glycine- and serine-rich linkers or linkers composed of largely polar polypeptide fragments, or homo- or heterobifunctional chemical crosslinking compounds such as glutaraldehyde or, optionally PEG-spaced, maleimides or NHS esters.
[0206] For example, a polypeptide linker or spacer may be a suitable amino acid sequence having a length from 1 to 50 amino acids, such as from 1 to 30, and in particular from 1 to 10 amino acid residues. It should be clear that the length, the degree of flexibility and / or other properties of the linker(s) may have some influence on the properties of the VHH antibodies, including but not limited to the affinity, specificity or avidity for the pest target. It should be clear that when two or more linkers are used, these linkers may be the same or different. In the context and disclosure of the present invention, the person skilled in the art will be able to determine the optimal linkers for the purpose of coupling heavy chain variable domains as disclosed herein without any undue experimental burden.
[0207] The VHH antibody of the invention may be produced in a microbial fermentation reaction such as described herein. The VHH antibody of the invention may be expressed in the cytoplasm and released by lysing of the microbial cells. In other aspects, The VHH antibody of the invention may be secreted by the microbial cell. In some aspects, The VHH antibody of the invention may be presented on the surface of a microbial cell or spore. For example, the VHH antibody of the invention may be a fusion protein having a targeting sequence, exosporium protein, or exosporium protein fragment that targets the fusion protein to the exosporium of a recombinant Bacillus cereus family member and a pectinase enzyme, wherein the pectinase is a pectate lyase from Bacillus spp. Or a polygalaturonase from Aspergillus niger or certain Bacillus species such as for example disclosed in W02020190998A1 .
[0208] Variant VHH antibodies and composition comprising the same
[0209] In a certain aspects, the VHH antibodies comprised in the agrochemical compositions as disclosed herein may be optionally modified, for example to increase the amount of positive charge (that the VHH antibodies has). That is to say, the VHH antibodies may be modified, typically by way of one or more amino acid substitutions, so that the amount of positive charge of the VHH antibodies may be increased. Thus, an amino acid may thus be substituted with an amino acid which has an increased amount of positive charge (compared to the amino acid that it is substituting). More than one such substitutions may be made, for example two, three, four or five such substitutions. In some embodiments, up to one, up to two, up to three, up to four or up to five such substitutions may be made. Such substitutions may typically be made in a CDR region, for example a CDR1 region, a CDR2 region or a CDR3 region.
[0210] Other substitutions may also be made to the VHH antibodies. In some aspects the VHH antibodies may be modified to improve the binding affinity of the VHH antibody to its target by substituting 1 , 2, 3, 4 or 5 or more amino acid. Such substitutions may typically be made in a CDR region, for example a CDR1 region, a CDR2 region or a CDR3 region. In some aspects the VHH antibodies may be modified to improve their physicochemical properties. For instance to improve the stability of the VHH antibody. In other aspects the VHH antibody may be modified to improve the producibility of the VHH antibody from a microbial host cell such as a Pichia host cell, a Trichoderma host cell, an Aspergillus host cell or a Bacillus host cell. In some aspects the VHH antibodies may be modified to improve the binding affinity of the VHH antibody to its target by substituting 1 , 2, 3, 4 or 5 or more amino acid. Such substitutions may typically be made in a CDR region, for example a CDR1 region, a CDR2 region or a CDR3 region. However, the substitution towards improving the physicochemical properties of the VHH antibody may very well be made in the FR regions, for example in a FR1 region, a FR2 region, a FR3 region or a FR4 region. Examples of possible substitutions are the introduction or removal of disulfide bridges by respectively introducing or removing cysteine residues at the appropriate location. Other examples are the substitution of residues that show to be prone to for example oxidation reactions or other reactions such as hydrolysis such as the cyclisation of a glutamic acid or glutamine to form a lactam, pyroglutamate. For example, the VHH antibody may begin with either a D residue or a Q residue. The present inventors have surprisingly found that having a D residue at position 1 of the VHH antibody (i.e. the first residue of the framework 1 region sequence) may improve the anti-fungal properties of the VHH antibody, although a Q may also be used. Accordingly, for any specified VHH antibody sequence disclosed herein (including the VHH antibody having the sequence of any one of SEQ ID NO: 2, 41 to 65 and 242 or variants thereof), the residue at position 1 may be a Q residue or, preferably for some embodiments, may be a D residue. In some embodiments the nucleotide sequence encoding the VHH antibody as retrieved after selection from a library of VHH antibody sequences, for example after phage display selection, (i.e. the original sequence obtained from for example an immunised lama) will be altered to encode a D residue instead of a Q residue prior to producing the isolated VHH antibody in for example E. coli.
[0211] In some embodiments, the invention provides a VHH antibody comprising or consisting of the amino acid sequence set out in any one of SEQ ID NO: 2, 41 to 65 and 242, or an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90% or at least about 95% or at least about 98% identity thereto.
[0212] In some embodiments, the invention provides a VHH antibody comprising or consisting of the amino acid sequence set out in any one of SEQ ID NO: 2, 41 to 65 and 242, or an amino acid sequence having up to 1 , up to 2, up to 3, up to 4 or up to 5 amino acid substitutions thereto. In some embodiment however, the VHH antibody more than 5 amino acids substitution, provided that the VHH antibody binds to at least one fungal species as described herein and causes retardation of growth of a spore of fungus and / or lysis of a spore of the said fungus and where said activity is retained at elevated concentrations of salts, such as CaCla or MgCls at concentrations as described herein.
[0213] Any amino acid substitutions in the VHH antibody may increase the overall charge of the VHH antibody or may not change the overall charge of the VHH antibody. In some embodiments, any amino acid substitutions do not decrease the overall charge of the VHH antibody.
[0214] Any amino acid substitutions in the VHH antibody may occur anywhere in the VHH antibody sequence. Optionally, the amino acid substitutions may be limited to the CDR regions (and in such embodiments, the VHH antibody retain the original framework region sequences), or may be limited to the framework regions. In some embodiments, any substitutions or variation in the sequence may occur in the CDR regions or at any residue up to 2 amino acid residues either side of the CDR regions (as defined by the Kabat numbering system). In some embodiments, any substitutions or variation in the sequence may occur in the CDR regions or at any residue up to 1 amino acid residues either side of the CDR regions (as defined by the Kabat numbering system). In some embodiments, any substitutions or variation in the sequence may occur in the CDR regions or at the residue adjacent to the N terminus of the CDR3 region (as defined by the Kabat numbering system).
[0215] The present invention extends to additional mutant or variant forms of the disclosed VHH antibody sequences, for example having additional substitutions or having different combinations of substitutions, or having substitutions as different locations in the VHH antibody sequence.
[0216] The present invention also provides VHH antibodies (and compositions comprising VHH antibodies) having certain sequences allowing for mutations or substitutions at specific locations.
[0217] Any of the VHH antibodies disclosed here, including the variants thereof, may be comprised in a composition, for example an agrochemical composition.
[0218] Generally, although the present invention extends to variants of VHH antibodies, the variant VHH antibodies may retain their functional characteristics, or their functional characteristics may be improved. For example, the variant VHH antibodies may be capable of (specifically) binding to at least one fungal species.
[0219] The variants may also cause retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the said at least one fungal species and where said activity is retained at elevated concentrations of salts, such as CaCIz or MgClz at concentrations as described herein. That is to say, binding of the variant VHH antibody to at least one fungal species results in retardation of growth of a spore of the said at least one fungal species and / or lysis of a spore of the said at least one fungal species and where said activity is retained at elevated concentrations of salts, such as CaCIz or MgClz at concentrations as described herein.
[0220] In some embodiments, the variant VHH antibody may cause retardation of growth of a spore of fungus and / or lysis of a spore of the said fungus with an IC50 equal to or less than the IC50 of the reference VHH antibody, particularly the VHH antibody of any one of SEQ ID NO: 2, 41 to 65 and 242, when measured under substantially the same conditions such as described in Example 5. In a preferred embodiment, the variant VHH antibody may cause retardation of growth of a spore of the fungus / and or lysis of a spore of the said fungus with an IC50 equal to or less than the IC50 of the reference VHH antibody, particularly the VHH antibody of any one of SEQ ID NO: 2, 41 to 65 and 242, when measured under substantially the same conditions such as described in Example 5 and in the presence of 100mM NaCI. In an alternative embodiment, the variant VHH antibody may retain 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a MgClz concentration that is equal or higher than the concentrations described above for the VHH antibody of the current invention, preferably the VHH antibody of any one of SEQ ID NO: 2, 41 to 65 and 242. In yet another alternative embodiment, the variant VHH antibody may retain 50% of its ability to cause retardation of growth of a spore of the fungus and / or lysis of a spore of the fungus at a CaCIz concentration that is equal or higher than the concentrations described above for the VHH antibody of the current invention, preferably the VHH antibody of any one of SEQ ID NO: 2, 41 to 65 and 242. The current invention therefore further relates to a method for obtaining a variant of the VHH antibody comprising or consisting of the amino acid sequence set out in any one of SEQ ID NO: 2, 41 to 65 and 242. Said method comprises the steps of: (a) selecting a nucleic acid sequence encoding the VHH antibody comprising or consisting of the amino acid sequence set out in any one of SEQ ID NO: 2, 41 to 65 and 242; (b) modifying the selected nucleic acid sequence encoding the VHH antibody to obtain, when expressed, at least one variant VHH antibody; (c) transforming host cells or unicellular organisms with the modified nucleic acid sequence to express a variant VHH antibody encoded by the modified nucleic acid sequence; (d) assessing the ability of the variant VHH antibody to bind to a fungus; (e) where the variant VHH antibody is not capable of binding to a fungus, repeating the process of steps (a) to (d) until a variant VHH antibody capable of binding to a fungus; (f) where the variant VHH antibody capable of binding to a fungus was identified in step (d), isolating the corresponding modified nucleic acid sequence obtained in step (b) and expressing said nucleic acid, thereby to prepare a variant VHH antibody which binds to the fungus; (g) optionally, isolating and / or purifying the variant VHH antibody; (h) optionally, further manufacturing, isolating and purifying the variant VHH antibody. Suitable techniques to apply in said method for manufacturing a variant VHH antibody that may lead to a variety of modified nucleic acid sequences encoding variant VHH antibodies in step (b) may be, techniques such as error prone PCR, mutagenesis, CDR swapping, but also more directed techniques may be used such as techniques designed to introduce modifications or substitution in a more directed or semi-directed manner, such as techniques based on CRIPSR-Cas, Talens, Zinc-finger enzymes etc. Suitable techniques to apply in said method for manufacturing a variant VHH antibody that may lead to a variety of modified nucleic acid sequences encoding variant VHH antibodies in step (b) may also include techniques based on mathematic algorithms such as deep learning techniques such as for example the publicly accessible predictive models of Ig Fold or AlphaFold (see: Fast, accurate antibody structure prediction from deep learning on massive set of natural antibodies. Buffalo Jeffrey A., Gray Jeffrey J. Biophysical Journal, 2022, Vol 121 (3), 155a-156a DOI: 10.1016 / j.bpj.2021.11.1942); or any suitable combination of any of the foregoing as further described herein. In some embodiments the method for manufacturing a variant of the VHH antibody comprising or consisting of the amino acid sequence set out in any one of SEQ ID NO: 2, 41 to 65 and 242 may be implemented in a directed evolution framework where the method as set out above may be iterated multiple times and where suitable VHH variants are further modified by the method as set above leading to incremental improvements of the VHH antibody. VHH antibody variants may still be capable of binding to at least one fungal species and cause retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the said at least one fungal species and where said activity is retained at elevated concentrations of salts, such as CaCIz or MgClz at concentrations as described herein.
[0221] The VHH antibodies and VHH antibody variants as disclosed herein comprise CDR sequences of antibodies, such as heavy chain antibodies, or of VH or VHH sequences that were raised against a pest target as described herein (or may be based on and / or derived from such CDR sequences). It should however be noted that the invention in its broadest sense is not limited to a specific structural role or function that these CDR sequences may have in the VHH antibodies as disclosed herein, as long as these CDR sequences allow a polypeptide to specifically bind to a pest target such as a fungal antigen or a fungal target. Thus, generally, the invention relates to agrochemical compositions comprising a polypeptide that is capable of binding to a pest target, such as a fungal antigen or a fungal target, and that comprises a combination of CDR sequences as described herein. More specifically the invention relates to agrochemical compositions comprising a polypeptide that is capable of binding to at least one fungal species, and that comprises a combination of CDR sequences as described herein and which polypeptide may still be capable of binding to said at least one fungal species and cause retardation of growth of a spore of said at least one fungal species and / or lysis of a spore of said at least one fungal species and where optionally said activity is retained at elevated concentrations of salts, such as CaCIz or MgClz at concentrations as described herein.
[0222] Thus, any polypeptide comprising a combination of CDR sequences as described herein in the compositions disclosed herein fall within the scope of this invention including but not limited to microbial proteins, protease inhibitors, toxins, fibronectin, lipocalins, single chain antiparallel coiled coil proteins or repeat motif proteins. Non-limiting examples of such polypeptides, include carbohydrate binding domains (CBD) (Blake et al (2006) J. Biol. Chem. 281 , 29321 -29329), heavy chain antibodies (hcAb), single domain antibodies (sdAb), minibodies (Tramontano et al (1994) J. Mol. Recognition 7, 9-24), the variable domain of camelid heavy chain antibodies (VHH), the variable domain of the new antigen receptors (VNAR), affibodies (Nygren P.A. (2008) FEBS J. 275, 2668-2676), alphabodies (see WO2010066740), designed ankyrin-repeat domains (DARPins) (Stumpp et al (2008) Drug Discovery Today 13, 695-701 ), anticalins (Skerra et al (2008) FEBS J. 275, 2677-2683), knottins (Kolmar et al (2008) FEBS J. 275, 2684-2690) and engineered CH2 domains (nanoantibodies, see Dimitrov DS (2009) mAbs 1 , 26-28) or other polypeptides that can comprise the CDR sequences according to the invention. Particularly, the polypeptide comprising a combination of CDR sequences as described herein may be selected from the group consisting of DARPins, knottins, alphabodies and VHH's. More particularly, the polypeptide comprising a combination of CDR sequences as described herein are selected from the group consisting of alphabodies and VHH’s. Most particularly, the polypeptide comprising a combination of CDR sequences as described herein are VHH’s. In some aspects the polypeptides may be selected using computational models to retrieve suitable polypeptides that may comprise or are suitable to receive the CDR sequences according to the invention allowing, through the CDR sequences, said polypeptide to bind a fungal pest or fungal pest antigen. Any of the foregoing polypeptide may be naturally occurring polypeptides (from any suitable species) or synthetic or semi-synthetic polypeptides sequences that have been obtained by techniques such as affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, veneering, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques, well known to the skilled person, or any suitable combination of any of the foregoing, that may or may not be guided by computational models allowing for the identification or in silica engineering of suitable polypeptides for engineering sequences comprising the CDR sequences according to the invention and allowing the polypeptide to specifically bind to a pest target such as a fungal antigen or a fungal target.
[0223] In a certain aspects, the VHH antibodies comprised in the agrochemical compositions as disclosed herein may be optionally linked to one or more further groups, moieties, or residues via one or more linkers. These one or more further groups, moieties or residues can serve for binding to other targets of interest. It should be clear that such further groups, residues, moieties and / or binding sites may or may not provide further functionality to the VHH antibodies as disclosed herein (and / or to the composition in which it is present) and may or may not modify the properties of the VHH antibodies as disclosed herein. Such groups, residues, moieties or binding units may also for example be chemical groups which can be biologically active.
[0224] These groups, moieties or residues may be, in particular embodiments, linked N- or C- terminally to the VHH antibodies in the compositions as disclosed herein.
[0225] In particular embodiments, the VHH antibodies in the agrochemical compositions as disclosed herein may also have been chemically modified. For example, such a modification may involve the introduction or linkage of one or more functional groups, residues or moieties into or onto the heavy chain variable domain. These groups, residues or moieties may confer one or more desired properties or functionalities to the VHH antibodies. Examples of such functional groups will be clear to the skilled person.
[0226] For example, the introduction or linkage of such functional groups to a VHH antibody can result in an increase in the solubility and / or the stability of the VHH antibody, in a reduction of the toxicity of the VHH antibody, or in the elimination or attenuation of any undesirable side effects of the VHH antibody, and / or in other advantageous properties.
[0227] In particular embodiments, the one or more groups, residues, moieties are linked to the VHH antibody via one or more suitable linkers or spacers.
[0228] Compositions comprising fragments of VHH antibodies
[0229] The present invention also encompasses parts, fragments, analogs, mutants, variants, and / or derivatives of the VHH antibodies comprised in the compositions as disclosed herein and / or VHH antibodies comprising or essentially consisting of one or more of such parts, fragments, analogs, mutants, variants, and / or derivatives, as long as these parts, fragments, analogs, mutants, variants, and / or derivatives are suitable for the purposes envisaged herein. Such parts, fragments, analogs, mutants, variants, and / or derivatives according to the invention are still capable of specifically binding to at least one fungal species, for example a plant pathogenic fungus and cause retardation of growth of a spore of the at least one fungal species and / or lysis of a spore of the said at least one fungal species.
[0230] Targets
[0231] In certain particular embodiments, the compositions as disclosed herein at least comprise a VHH antibody, which binds to a fungus preferably from the fungal species Botrytis, such as a plasma membrane component of a fungus.
[0232] In certain particular embodiments, the compositions as disclosed herein at least comprise a VHH antibody, which binds to a fungus from the fungal species Colletotrichum, such as a plasma membrane component of a fungus.
[0233] In certain particular embodiments, the compositions as disclosed herein at least comprise a VHH antibody, which binds to a fungus from the fungal species Podosphaera, such as a plasma membrane component of a fungus.
[0234] In particular embodiments, the present invention provides agrochemical compositions comprising VHH antibodies that are specifically directed against a structural molecular component of the plasma cell membrane of a pest.
[0235] In particular embodiments, the present invention provides agrochemical compositions comprising VHH antibodies that are specifically directed against a structural molecular component of the plasma cell membrane of a pest, which is not a protein. In particular embodiments, the present invention provides agrochemical compositions comprising VHH antibodies that are specifically directed against a structural molecular component of the plasma cell membrane of a pest, which is a protein.
[0236] Forms of target antigen
[0237] It will be appreciated based on the disclosure herein that for agrochemical and biological control applications, the VHH antibodies of the compositions as disclosed herein may be directed against or specifically bind to several different forms of the pest target, for example a fungal target. It is also expected that the VHH antibodies of the compositions as disclosed herein will bind to a number of naturally occurring or synthetic analogs, variants, mutants, alleles, parts and fragments of their pest target. More particularly, it is expected that the VHH antibodies of the compositions as disclosed herein will bind to at least to those analogs, variants, mutants, alleles, parts and fragments of the target that (still) contain the binding site, part or domain of the natural target to which those VHH antibodies bind.
[0238] Formulations
[0239] It is envisaged that the VHH antibody content contained in the composition, such as the agrochemical composition, as disclosed herein may vary within a wide range and it is generally up to the manufacturer to modify the concentration range of a particular VHH antibody according to the purpose, such as the specific crop pest which is to be attenuated.
[0240] In particular embodiments, the present invention provides agrochemical compositions comprising at least one VHH antibody, wherein said heavy chain variable domain is present in an amount effective to protect or treat a plant or a part of said plant from an infection or other biological interaction with said plant pathogen. In more particular embodiments, the present invention provides agrochemical compositions comprising at least one VHH antibody and at least one cell wall disrupting agent, wherein said heavy chain variable domain and cell wall disrupting agent are present in an amount effective to protect or treat a plant or a part of said plant from an infection or other biological interaction with said plant pathogen.
[0241] In a specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be at least 0.0001 % by weight.
[0242] In a specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be up to 50% by weight.
[0243] In a specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.0001 % to 50% by weight.
[0244] In particular embodiments, the present invention provides agrochemical compositions comprising at least one VHH antibody, wherein the concentration of the at least one VHH antibody and / or the cell wall disrupting agent in the agrochemical composition ranges from 0.001 % to 50% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.001 % to 50% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.01% to 50% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.1% to 50% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 1 % to 50% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 10% to 50% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.0001 % to 40% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.001 % to 40% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.01% to 40% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.1% to 40% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 1 % to 40% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.0001% to 30% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.001% to 30% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.01% to 30% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.1 % to 30% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 1 % to 30% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.0001% to 10% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.001% to 10% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.01 % to 10% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.1% to 10% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 1% to 10% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.0001 % to 1 % by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.001 % to 1% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.01 % to 1% by weight. In yet another specific embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition may be from 0.1% to 1% by weight. In a preferred embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition is between 5% and 50% by weight. In a more preferred embodiment the concentration of the VHH antibody and / or the cell wall disrupting agent contained in the agrochemical composition is between 10% and 35% by weight. In particular embodiments, the agrochemical compositions disclosed herein comprise at least one VHH antibody, which is formulated in an aqueous solution. In a more particular embodiment, the agrochemical compositions disclosed herein comprise at least one VHH antibody and at least one cell wall disrupting agent as described herein, which is formulated in an aqueous solution
[0245] In further particular embodiments, the agrochemical compositions disclosed herein comprise at least one VHH antibody and further comprise an agrochemically suitable carrier and / or one or more suitable additive.
[0246] In further particular embodiment, the agrochemical composition disclosed herein comprise at least one VHH antibody and further comprise at least one cell wall degrading agent as described herein and further comprise an agrochemically suitable carrier and / or one or more suitable additive.
[0247] The compositions according to the invention may comprise, in addition to the anti-pest VHH antibody described above, a cell wall disrupting agent as described above, solid or liquid carriers which are acceptable in the pest treatment of plants and / or parts of plants and / or surfactants which are also acceptable in the pest treatment of plants and / or parts of plants. In particular, there may be used inert and customary carriers and customary surfactants. These compositions cover not only compositions ready to be applied to the plants and / or parts of plants to be treated by immersion or using a suitable device, but also the commercial concentrated compositions which have to be diluted before application to the plants and / or parts of plants.
[0248] These agrochemical compositions according to the invention may also contain any sort of other ingredients such as, for example, protective colloids, adhesives, thickeners, thixotropic agents, penetrating agents, stabilizers, sequestrants, texturing agents, flavouring agents, taste enhancers, sugars, sweeteners, colorants and the like. More generally, the active substances, i.e. the at least one heavy chain variable domain, may be combined with any solid or liquid additives corresponding to the usual formulation techniques.
[0249] These agrochemical compositions according to the invention may also contain any sort of other active ingredient such as, for example, other anti-bacterial or anti-fungal active ingredients.
[0250] The surfactant may be an emulsifying agent, a dispersing agent or a wetting agent of the ionic or nonionic type or a mixture of such surfactants. There may be mentioned, for example, salts of polyacrylic acids, salts of lignosulphonic acids, salts of phenolsulphonic or naphthalenesulphonic acids, polycondensates of ethylene oxide with fatty alcohols or with fatty acids or with fatty amines, substituted phenols (in particular alkylphenols or arylphenols), salts of esters of sulphosuccinic acids, derivatives of taurine (in particular alkyl taurates), phosphoric esters of polyoxyethylated phenols or alcohols, esters of fatty acids and polyols, sulphate, sulphonate and phosphate functional group-containing derivatives of the above compounds. The presence of at least one surfactant is generally essential when the inert carrier is not soluble in water and when the solvent for application is water.
[0251] The agrochemical compositions as disclosed herein are themselves in fairly diverse, solid or liquid, forms.
[0252] As solid composition forms, there may be mentioned dustable powders (content of active substance which may be up to 100%) and granules, in particular those obtained by extrusion, by compacting, by impregnation of a granulated carrier, by granulation using a powder as starting material (the content of active substance in these granules being between 0.5 and 80% for these latter cases). Such solid compositions may be optionally used in the form of a liquid which is viscous to a greater or lesser degree, depending on the type of application desired, for example by diluting in water.
[0253] As liquid composition forms or forms intended to constitute liquid compositions during application, there may be mentioned solutions, in particular water-soluble concentrates, emulsions, suspension concentrates, wettable powders (or spraying powder), oils and waxes.
[0254] The suspension concentrates, which can be applied by spraying, are prepared so as to obtain a stable fluid product which does not form a deposit and they usually contain from 10 to 75% of active substance, from 0.5 to 15% of surfactants, from 0.1 to 10% of thixotropic agents, from 0 to 10% of appropriate additives, such as antifoams, corrosion inhibitors, stabilizers, penetrating agents and adhesives and, as carrier, water or an organic liquid in which the active substance is not or not very soluble: some organic solids or inorganic salts may be dissolved in the carrier to help prevent sedimentation or as antigels for water.
[0255] The agrochemical compositions as disclosed herein can be used as such, in form of their formulations or as the use forms prepared therefrom, such as aerosol dispenser, capsule suspension, cold fogging concentrate, hot fogging concentrate, encapsulated granule, fine granule, flowable concentrate for seed treatment, ready-to-use solutions, dustable powder, emulsifiable concentrate, emulsion oil in water, emulsion water in oil, macrogranule, macrogranule, oil dispersible powder, oil miscible flowable concentrate, oil miscible liquid, froths, paste, seed coated with a pesticide, suspension concentrate (flowable concentrate), suspensions-emulsions-concentrates, soluble concentrate, suspensions, soluble powder, granule, water soluble granules or tablets, water soluble powder for seed treatment, wettable powder, natural and synthetic materials impregnated with active compound, micro-encapsulation in polymeric materials and in jackets for seed, microencapsulation biological particles, for example those described in WO2018 / 201160, WO2018 / 201161 and WO2019 / 060903, as well as ULV-cold and hot fogging formulations, gas (under pressure), gas generating product, plant rodlet, powder for dry seed treatment, solution for seed treatment, ultra-low volume (ULV) liquid, ultra-low volume (ULV) suspension, water dispersible granules or tablets, water dispersible powder for slurry treatment.
[0256] These formulations are prepared in a known manner by mixing the active compounds or active compound combinations with customary additives, such as, for example, customary extenders and also solvents or diluents, emulsifiers, dispersants, and / or bonding or fixing agent, wetting agents, water repellents, if appropriate siccatives and UV stabilisers, colorants, pigments, defoamers, preservatives, secondary thickeners, adhesives, gibberellins and water as well further processing auxiliaries.
[0257] These compositions include not only compositions which are ready to be applied to the plant or seed to be treated by means of a suitable device, such as a spraying or dusting device, but also concentrated commercial compositions which must be diluted before application to the crop.
[0258] General application methods
[0259] The VHH antibodies and compositions of the invention beneficially provide antifungal activity. Therefore, in a particular embodiment, the present invention provides the use of a VHH antibody or composition for use as an antifungal agent. Methods of the invention may comprise applying a VHH antibody or composition to a surface. “Surface" in the context of application of the invention refers to any external or internal substrate or area where the VHH antibody or composition can be applied to. The term encompasses, but is not limited to, human and animal surfaces, such as the skin, mouth, mucous membranes, or respiratory organs (lungs); plant surfaces, such as seeds, shoots, stems, leaves, roots (including tubers), flowers, fruits, vegetables, and tissues and organs; inanimate surfaces, such as the surfaces of objects or equipment, such as agricultural equipment, storage facilities and household surfaces (including countertops, floors, walls, and other areas that may require decontamination from fungal contaminants). In a preferred embodiment, said surface is a plant surfaces, such as leaves.
[0260] Methods of application and plant protection or treatment
[0261] In certain aspects, the present invention provides methods comprising applying directly or indirectly an agrochemical composition or VHH antibody of the invention to a plant or a part of the plant. The methods may be performed to a plant field. Thus, the present invention also provides methods comprising applying directly or indirectly an agrochemical composition or VHH antibody of the invention to a plant field. In a particular further embodiment, the agrochemical composition or VHH antibody of the invention is applied to the plant, part of the plant or plant field at an application rate or concentration as detailed herein.
[0262] In certain aspects, the present invention provides methods for protecting or treating a plant or a part of a plant from an infection or other biological interaction with a plant pathogen, at least comprising the step of applying directly or indirectly to the plant or to a part of the plant, an agrochemical composition or VHH antibody as disclosed herein. The composition or VHH antibody may be applied under conditions effective to protect or treat the plant or a part of the plant against that infection or biological interaction with the plant pathogen.
[0263] In particular embodiments, these methods comprise applying directly or indirectly to the plant or to a part of the plant an agrochemical composition as disclosed herein, for example at an application rate higher than 50g of the agrochemical composition per hectare, such as but not limited to an application rate higher than 75g of the agrochemical composition per hectare, such as an application rate higher than 100g of the agrochemical composition per hectare, or in particular an application rate higher than 200g of the agrochemical composition per hectare.
[0264] In particular embodiments, these methods comprise applying directly or indirectly to the plant or to a part of the plant an agrochemical composition as disclosed herein for example at an application rate between 50g and 1000g of the agrochemical composition per hectare, such as but not limited to an application rate of between 50g and 800g of the agrochemical composition per hectare, in particular an application rate of between 75g and 500g of the agrochemical composition per hectare, such as between 75g and 200g of the agrochemical composition per hectare or between 75g and 150g per hectare.
[0265] In yet another embodiment, the invention provides methods for combating or inhibiting plant pests, which methods comprise applying an agrochemical composition according to the invention to a plant, such as a crop, or a part of a plant or a crop, for example at an application rate below 500g of said VHH antibody per hectare. In specific embodiments the application rate is below 400g / ha, below 300g / ha, below 200 g / ha, below 10Og / ha, 50 g / ha, below 40 g / ha, below 35 g / ha, below 30 g / ha, below 25 g / ha, below 20 g / ha, below 15 g / ha, below 10 g / ha, below 5 g / ha, below 1 g / ha or even lower amounts of VHH antibody / ha. In a further embodiment, said upper application rate may be combined with any one of the following lower application rates to provide a suitable application rate range, namely wherein the application rate is above 0.1 g / ha, above 1 g / ha, above 2 g / ha, above 3 g / ha, above 4 g / ha, above 5 g / ha, above 6 g / ha, above 7 g / ha, above 8 g / ha, above 9 g / ha, above 10g / ha, above 15 g / ha, or above 20 g / ha. A preferred lower application rate is above 10 g / ha. As is evident therefrom, in a further particular embodiment, the application rate of the VHH antibody according to the invention is between 1 g / ha and 500 g / ha, such as between 10g / ha and 450 g / ha, such as between 100 g / ha and 400 g / ha, such as between 150 g / ha and 350 g / ha. In a more preferred embodiment, the application rate of the VHH antibody according to the invention is between 100g / ha and 400g / ha. Where an application rate is understood as the amount of VHH applied per application, an application being understood as a single event (such as a spray event) of applying the VHH antibody or agrochemical composition comprising said VHH antibody on a crop, field of crops or field of plants. In a specific treatment program, multiple applications may happen over a certain time point. For instance a first application may be followed by a second application and where the time between the first application and the second application may be several days such as one week. In some embodiments up to 10 preferably up to 5 applications may be envisioned. It being understood that such a treatment plan may vary between crops and the plant pathogenic fungus targeted by the treatment.
[0266] The VHH antibodies of the current invention have an improved activity over the prior art molecule 10G11_Q1 D of PCT publication WO 2021 / 198396. That is to say, the VHH antibodies of the current invention when treating a plant field against a fungal plant pest require a lower application rate to achieve an activity that is at least equal compared to the prior art molecule 10G1 1_Q1 D. Specifically, the VHH antibodies of the current invention achieve an activity that is at least equal against a fungal plant pest when applied at an application rate of between 100 g / ha and 400 g / ha and as compared to an application rate of 500 g / ha of the prior art molecule 10G1 1 _Q1 D. In a preferred embodiment the VHH antibody according to the current invention is applied at an application rate of between 100 g / ha and 400 g / ha when treating or preventing Botrytis cinerea infection in grape vines, preferably said application is part of an integrated pest management program, preferably two applications are administered, more preferably one application may be done at flowering and a second application at bunch closure. In some preferred embodiments, the VHH antibodies of the current invention have an improved potency compared to the prior art molecule 10G11 _Q1 D. In some embodiments, the VHH antibodies of the current invention have an improved efficacy compared to the prior art molecule 10G1 1_Q1 D. In some embodiments, the VHH antibodies of the current invention have both an improved potency and an improved efficacy compared to the prior art molecule 10G11_Q1 D.
[0267] In yet another embodiment, the invention provides methods for combating or inhibiting plant pests, which methods comprise applying an agrochemical or biological control composition according to the invention to a plant, such as a crop, or a part of a plant or a crop, for example at a concentration of 150 pM or lower. In specific embodiments, the application concentration is any of 0.3 pM, 0.5 pM, 0.7 pM, 1 .0 pM, 2.0 pM, 3.0 pM, 4.0 pM, 5.0 pM, 10 pM, 15 pM, 20 pM or higher. In a further embodiment, said lower application concentration may be combined with any one of the following upper application concentrations to provide a suitable application concentration range, namely wherein the application concentration is 150 pM, 140 pM, 130 pM, 120 pM, 1 10 pM, 100 pM, 90 pM, 80 pM, 70 pM, 60 pM, 50 pM, 40 pM, 30 pM, 20 pM or lower. A preferred lower application concentration is above 5 pM. As is evident therefrom, in a further particular embodiment, the application concentration of the VHH antibody according to the invention is from 2 to 150 pM, such as from 4 pM to 120 pM, such as between 5 pM to 110 pM.
[0268] It is understood depending on the crop and the environmental pressure of the plant pests that the farmer can vary the application rate. These application rates variances are specified in the technical sheet delivered with the specific agrochemical composition. In yet another embodiment, the invention provides the use of the agrochemical or biological control compositions of the invention in combating or inhibiting plant pests.
[0269] In yet another embodiment, the invention provides the use of the VHH antibodies of the invention in combating or inhibiting plant pests.
[0270] In yet another embodiment, the invention provides the use of the VHH antibodies of the invention in combination with at least cell wall disrupting agent of the invention in combating or inhibiting plant pests. Thus, the present invention also provides a combination comprising a VHH antibody as described herein and a cell wall disrupting agent as described herein. As is clear from the disclosures herein, the present invention thus also provides, for example, methods comprising applying a VHH antibody as described herein and a cell wall disrupting agent as described herein. The VHH antibody and cell wall disrupting agent may be applied separately or combined in one composition. The VHH antibody and cell wall disrupting agent may be applied simultaneously or consecutively. If the VHH antibody and cell wall disrupting agent are applied consecutively, the cell wall disrupting agent is preferably applied prior to the application of the VHH antibody. Preferably, the VHH antibody and cell wall disrupting agent are applied simultaneously.
[0271] Applying an agrochemical or biological control composition or VHH antibody according to the invention to a crop may be done using any suitable method for applying an agrochemical or biological control composition to a crop, including, but not limited to spraying (including high volume (HV), low volume (LV) and ultra-low volume (ULV) spraying), brushing, dressing, dripping, coating, dipping, immersing, spreading, fogging, applying as small droplets, a mist or an aerosol.
[0272] Thus, in particular embodiments, the methods for protecting or treating a plant or a part of a plant from an infection or other biological interaction with a plant pathogen as disclosed herein, comprise applying the agrochemical composition directly or indirectly to the plant or to a part of the plant for example by spraying, atomizing, foaming, fogging, culturing in hydroculture, culturing in hydroponics, coating, submerging, and / or encrusting.
[0273] In certain particular embodiments, the present invention provides methods of inhibiting, preventing, reducing or controlling the growth of a plant pathogen, comprising at least the step of applying directly or indirectly to a plant or to a part of said plant, an agrochemical composition as disclosed herein.
[0274] In certain other embodiments, the present invention provides methods for of killing a plant pathogen, comprising at least the step of applying directly or indirectly to a plant or to a part of said plant, an agrochemical composition or VHH antibody as disclosed herein.
[0275] Alternatively, the application rate of the agrochemical composition according to the invention, meaning the amount of the agrochemical composition that is applied to the crop, is such that 500g, 450g, 400g, 350g, 300g, 250g, 200g, 150g, 100g, 50g, 45 g, 40 g, 35 g, 30 g, 25 g, 20 g, 20 g, 15 g, 10 g, of the VHH antibody, comprised in the agrochemical or biological control composition according to the invention, is applied to the crop per hectare and per application.
[0276] According to the methods as disclosed herein, the agrochemical or biological control composition can be applied once to a crop, or it can be applied two or more times after each other with an interval between every two applications. According to the method of the present invention, the agrochemical or biological control composition according to the invention can be applied alone or in mixture with other materials, preferably other agrochemical or biological control compositions, to the crop; alternatively, the agrochemical or biological control composition according to the invention can be applied separately to the crop with other materials, preferably other agrochemical or biological control compositions, applied at different times to the same crop. According to the method of the present invention, the agrochemical or biological control composition according to the invention may be applied to the crop prophylactical ly, or alternatively, may be applied once target pests have been identified on the particular crop to be treated.
[0277] The agrochemical compositions as disclosed herein can be applied directly to a plant, a crop or to one or more parts of the plant by the above mentioned methods, such as directly to the entire plant or directly to one or more parts of the plant, either in a pre-harvest or in a post-harvest stage. Pre-harvest application may have an effect post-harvest. In certain further embodiments, the agrochemical compositions as disclosed herein can be applied directly to one or more parts of the plant by the above mentioned methods, such as directly to the stalks, leaves, tubers, stems, shoots, the seeds, the fruits, the roots, the flowers, grains, the buds etc. .
[0278] The method of treatment as disclosed herein can also be used in the field of protecting storage goods against attack of plant pathogens. In this method of treatment, application of a composition of the invention may be pre-harvest or post-harvest. According to the present invention, the term "storage goods" is understood to denote natural substances of vegetable or animal origin and their processed forms, which have been taken from the natural life cycle and for which long-term protection is desired. Storage goods of vegetable origin, such as plants or parts thereof, for example stalks, leaves, tubers, seeds, fruits or grains, can be protected in the freshly harvested state or in processed form, such as pre-dried, moistened, comminuted, ground, pressed or roasted. Also falling under the definition of storage goods is timber, whether in the form of crude timber, such as construction timber, electricity pylons and barriers, or in the form of finished articles, such as furniture or objects made from wood. Storage goods of animal origin are hides, leather, furs, hairs and the like. The combinations according the present invention can prevent disadvantageous effects such as decay, discoloration or mold. Preferably "storage goods" is understood to denote natural substances of vegetable origin and their processed forms, more preferably fruits and their processed forms, such as pomes, stone fruits, soft fruits and citrus fruits and their processed forms.
[0279] The agrochemical compositions as disclosed herein can also be applied indirectly to a plant, a crop or to one or more parts of the plant by the above mentioned methods, such as indirectly to the entire plant or indirectly to one or more parts of the plant, either in a pre-harvest or in a post-harvest stage. The agrochemical compositions as disclosed herein can be applied close to harvest, such as about three weeks pre-harvest, for example two weeks pre-harvest or one week prior to harvest or less than one week preharvest. Pre-harvest application may have an effect post-harvest. Thus, in certain embodiments, the agrochemical compositions as disclosed herein can be applied indirectly to a plant, a crop or to one or more parts of the plant by the above mentioned methods, such as by applying the agrochemical composition to the surroundings or to the medium in which the plant or the one or more parts of the plant are growing or are stored, such as for instance but not limited to the air, the soil, the hydroponic culture, the hydroculture, or the liquid medium, such as for instance the aqueous liquid medium or water, in which the plant or the one or more parts of the plant are growing or are stored.
[0280] The agrochemical compositions as disclosed herein can be applied directly as a component of an integrated pest management approach.
[0281] It thus should be generally understood in the context of this application that the treatment of plants and plant parts with the agrochemical compositions as disclosed herein is carried out directly or by action on their environment, habitat or storage area by means of the normal treatment methods, for example by watering (drenching), drip irrigation, spraying, vaporizing, atomizing, broadcasting, dusting, foaming, spreading-on, and as a powder. It is furthermore possible to apply the compositions by the ultra-low volume method, or to inject the active compound preparation or the active compound itself into the soil.
[0282] In particular embodiments, the methods for protecting or treating a plant or a part of a plant from an infection or other biological interaction with a plant pathogen as disclosed herein, comprise applying the agrochemical composition directly or indirectly to the plant or to a part of the plant either in a pre-harvest or in a post-harvest stage. In a particular embodiment, it is applied to a plant or a part of the plant in a postharvest stage, also referred to herein as harvested produce.
[0283] According to specific embodiments, the harvested produce is a fruit, flower, nut or vegetable, a fruit or vegetable with inedible peel, preferably selected from avocados, bananas, plantains, lemons, grapefruits, melons, oranges, pineapples, kiwi fruits, guavas, mandarins, mangoes, squash, strawberries, grapes and pumpkin, is preferred, more preferably bananas, oranges, lemons and peaches, bananas. According to further specific embodiments, the harvested produce is a cut flower from ornamental plants, preferably selected from Alstroemeria, Carnation, Chrysanthemum, Freesia, Gerbera, Gladiolus, baby's breath (Gypsophila spec), Helianthus, Hydrangea, Lilium, Lisianthus, roses and summer flowers.
[0284] The plant species to which the agrochemical compositions as disclosed herein can be applied can for example be but are not limited to maize, soya bean, alfalfa, cotton, sunflower, Brassica oil seeds such as Brassica napus (e.g. canola, rape- seed), Brassica rapa, B. juncea (e.g. (field) mustard) and Brassica carinata, Arecaceae sp. (e.g. oilpalm, coconut), rice, wheat, sugar beet, sugar cane, oats, rye, barley, millet and sorghum, triticale, flax, nuts, grapes and vine and various fruit and vegetables from various botanic taxa, e.g. Rosaceae sp. (e.g. pome fruits such as apples and pears, but also stone fruits such as apricots, cherries, almonds, plums and peaches, and berry fruits such as strawberries, raspberries, red and black currant and gooseberry), Ribesioidae sp., Juglandaceae sp., Betulaceae sp., Anacardiaceae sp., Fagaceae sp., Moraceae sp., Oleaceae sp. (e.g. olive tree), Actinidaceae sp., Lauraceae sp. (e.g. avocado, cinnamon, camphor), Musaceae sp. (e.g. banana trees and plantations), Rubiaceae sp. (e.g. coffee), Theaceae sp. (e.g. tea), Sterculiceae sp., Rutaceae sp. (e.g. lemons, oranges, mandarins and grapefruit); Solanaceae sp. (e.g. tomatoes, potatoes, peppers, capsicum, aubergines, tobacco), Liliaceae sp., Compositae sp. (e.g. lettuce, artichokes and chicory - including root chicory, endive or common chicory), Umbelliferae sp. (e.g. carrots, parsley, celery and celeriac), Cu- curbitaceae sp. (e.g. cucumbers - including gherkins, pumpkins, watermelons, calabashes and melons), Alliaceae sp. (e.g. leeks and onions), Cruciferae sp. (e.g. white cabbage, red cabbage, broccoli, cauliflow- er, Brussels sprouts, pak choi, kohlrabi, radishes, horseradish, cress and Chinese cabbage), Leguminosae sp. (e.g. peanuts, peas, lentils and beans - e.g. common beans and broad beans), Chenopodiaceae sp. (e.g. Swiss chard, fodder beet, spinach, beetroot), Linaceae sp. (e.g. hemp), Cannabeacea sp. (e g. cannabis), Malvaceae sp. (e.g. okra, cocoa), Papaveraceae (e.g. poppy), Asparagaceae (e.g. asparagus); useful plants and ornamental plants in the garden and woods including turf, lawn, grass and Stevia rebaudiana; and in each case genetically modified types of these plants.
[0285] In a preferred embodiment of the treatment methods disclosed herein, the crop is selected from the group consisting of field crops, grasses, fruits and vegetables, lawns, trees and ornamental plants. In certain aspects, the present invention thus also provides post-harvest treatment methods for protecting or treating a harvested plant or a harvested part of the plant from an infection or other biological interaction with a plant pathogen, at least comprising the step of applying directly or indirectly to the harvested plant or to a harvested part of the plant, an agrochemical composition as disclosed herein, under conditions effective to protect or treat the harvested plant or a harvested part of the plant against the infection or biological interaction with the plant pathogen. According to specific embodiments, the harvested produce is a fruit, flower, nut or vegetable, a fruit or vegetable with inedible peel, preferably selected from avocados, bananas, plantains, lemons, grapefruits, melons, oranges, pineapples, kiwi fruits, guavas, mandarins, mangoes and pumpkin, is preferred, more preferably bananas, oranges, lemons and peaches, bananas. According to further specific embodiments, the harvested produce is a cut flower from ornamental plants, preferably selected from Alstroemeria, Carnation, Chrysanthemum, Freesia, Gerbera, Gladiolus, baby's breath (Gypsophila spec), Helianthus, Hydrangea, Lilium, Lisianthus, roses and summer flowers. According to further specific embodiments, the harvested produce is cut grass or wood.
[0286] Post-harvest disorders are e.g. lenticel spots, scorch, senescent breakdown, bitter pit, scald, water core, browning, vascular breakdown, COs injury, CO2 or O2 deficiency, and softening.
[0287] In further aspects, the present invention provides uses of the agrochemical compositions as disclosed herein as an anti-pest agent, including but not limited to a fungistatic or a fungicidal agent.
[0288] In a particular embodiment, the plant pests combated by the method according to the present invention are plant pathogenic fungi, as defined before. Lesion number, lesion size, and extent of sporulation of fungal pathogens may all be decreased as a result of the application of the method according to the present invention.
[0289] Medical applications
[0290] In certain other embodiments, the present invention provides methods for protecting or curing a human or animal from an infection by a pest and in particular a fungus, or a method of treating or preventing an infection of a human or animal by a pest and in particular a fungus. These methods comprise the step of applying or administering directly or indirectly to the human or animal or to a part of the human or animal, a composition comprising at least one VHH antibody of the invention, which specifically binds to a pest, such as but not limited to a fungus. The composition may be applied to administered under conditions effective to protect or cure the human or animal from the pest. Thus, the present invention provides the a VHH antibody or composition of the invention for use as a medicine. Furthermore, the present invention provides a VHH antibody or composition of the invention for use in the treatment and / or prevention of the diseases and disorders disclosed herein, preferably for use in the treatment and / or prevention of a fungal infection.
[0291] Accordingly, the present invention provides VHH antibodies of the invention that specifically bind to a pest target for use in a method for the prevention and / or treatment of at least one disease and / or disorder caused by a pest, such as for example a disease and / or disorder caused by a fungus in a subject. The present invention also provides compositions of the invention for use in a method for the prevention and / or treatment of at least one disease and / or disorder caused by a pest, such as for example a disease and / or disorder caused by a fungus in a subject. The present invention also provides VHH antibodies of the invention that specifically bind to at least one fungal species for use in a method for the prevention and / or treatment of an infection cause by a pest, such as a fungal infection, in a subject. The present invention also provides compositions of the invention that specifically bind to at least one fungal species for use in a method for the prevention and / or treatment of an infection cause by a pest, such as a fungal infection, in a subject. In particular embodiments, the present invention also provides methods for the prevention and / or treatment of at least one disease and / or disorder caused by a pest, comprising administering to a subject in need thereof, a pharmaceutically active amount of one or more VHH antibodies and / or pharmaceutical compositions as disclosed herein. In particular, the pharmaceutically active amount may be an amount that is sufficient (to create a level of the VHH antibody in circulation) to inhibit, prevent or decrease one or more biological activities or pathways of the pest bound thereby.
[0292] Therefore, in certain aspects the present invention provides compositions comprising at least one VHH antibody, which specifically binds to a pest for use as an anti-pest agent in a subject, such as an animal or a human being, suffering from a disease and / or disorder caused by a pest (e.g. a fungus).
[0293] In specific embodiments, the anti-pest agent is a biostatic or a pesticidal agent. In specific embodiments, the anti-pest agent is a fungistatic or a fungicidal agent.
[0294] Also, in certain aspects, the present invention provides methods for the prevention and / or treatment of a disease and / or disorder caused by a pest, which methods comprise the steps of:
[0295] (a) providing a VHH antibody or composition as disclosed herein,
[0296] (b) administering the VHH antibody or pharmaceutical composition to a patient suffering from the disease and / or disorder caused by a pest.
[0297] The efficacy of the VHH antibodies as disclosed herein, and of compositions comprising the same, can be tested using any suitable in vitro assay, cell-based assay, in vivo assay and / or animal model known per se, or any combination thereof, depending on the specific disease or disorder involved. Suitable assays and animal models will be clear to the skilled person as well as the assays and animal models used in the experimental part below and in the prior art cited herein. The skilled person will generally be able to select a suitable in vitro assay, cellular assay or animal model to test the VHH antibodies as disclosed herein for binding to at least one fungal species, and / or the biological mechanisms in which it is involved; as well as for their therapeutic and / or prophylactic effect in respect of one or more diseases and disorders that are associated with the pest antigen.
[0298] In certain other embodiments, the medical applications as described above combine the at least one VHH antibody and at least one cell wall disrupting agent as described herein in the described methods for protecting or curing a human or animal from an infection by a pest and in particular a fungus, or a method of treating or preventing an infection of a human or animal by a pest and in particular a fungus.
[0299] Pharmaceutical compositions
[0300] In yet a further aspect, the present invention provides pharmaceutical compositions comprising one or more VHH antibody as disclosed herein and optionally at least one pharmaceutically acceptable carrier (also referred to herein as pharmaceutical compositions of the invention). According to certain particular embodiments, the pharmaceutical compositions as disclosed herein may further optionally comprise at least one cell wall degrading agent as described herein and / or at least one other pharmaceutically active compound. The present invention furthermore provides the use of the VHH antibodies of the invention in the manufacture of a medicament, in particular in the manufacture of a medicament for treating the diseases as described herein, more in particular in the manufacture of a medicament to treat a fungal infection. The pharmaceutical compositions of the present invention can be used in the diagnosis, prevention and / or treatment of diseases and disorders associated with the pest, such as a fungus, of which the pest target is bound to the VHH antibodies disclosed herein.
[0301] In particular, the present invention provides pharmaceutical compositions comprising VHH antibodies that are suitable for prophylactic, therapeutic and / or diagnostic use in a warm-blooded animal, and in particular in a mammal, and more in particular in a human being.
[0302] The present invention also provides pharmaceutical compositions comprising VHH antibodies as disclosed herein that can be used for veterinary purposes in the prevention and / or treatment or diagnosis of one or more diseases, disorders or conditions associated with the pest, such as for instance a fungus, of which the pest target is bound to the VHH antibodies disclosed herein.
[0303] Generally, for pharmaceutical use, the VHH antibodies as disclosed herein may be formulated as a pharmaceutical preparation or compositions comprising at least one VHH antibody as disclosed herein and at least one pharmaceutically acceptable carrier, diluent or excipient and / or adjuvant, and optionally one or more further pharmaceutically active polypeptides and / or compounds. Such a formulation may be suitable for oral, parenteral, topical administration or for administration by inhalation. Thus, the VHH antibodies as disclosed herein and / or the compositions comprising the same can for example be administered orally, intraperitoneally (e.g. intravenously, subcutaneously, intramuscularly, transdermally, topically, by means of a suppository, by inhalation, again depending on the specific pharmaceutical formulation or composition to be used. The clinician will be able to select a suitable route of administration and a suitable pharmaceutical formulation or composition to be used in such administration.
[0304] The pharmaceutical compositions may also contain suitable binders, disintegrating agents, sweetening agents or flavoring agents. Tablets, pills, or capsules may be coated for instance with gelatin, wax or sugar and the like. In addition, the amino acid sequences and VHH antibodies as disclosed herein may be incorporated into sustained-release preparations and devices.
[0305] The pharmaceutical dosage forms suitable for injection or infusion can include sterile aqueous solutions or dispersions or sterile powders comprising the active ingredient which are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions, optionally encapsulated in liposomes. In all cases, the ultimate dosage form must be sterile, fluid and stable under the conditions of manufacture and storage. The liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example, water, ethanol, a polyol (for example, glycerol, propylene glycol, liquid polyethylene glycols, and the like), vegetable oils, nontoxic glyceryl esters, and suitable mixtures thereof. Antibacterial and antifungal agents and the like can optionally be added.
[0306] Useful dosages of the VHH antibodies as disclosed herein can be determined by comparing their in vitro activity, and in vivo activity in animal models. Methods for the extrapolation of effective dosages in mice, and other animals, to humans are known to the skilled person.
[0307] The amount of the VHH antibodies as disclosed herein required for use in prophylaxis and / or treatment may vary not only with the particular VHH antibodies selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will be ultimately at the discretion of the attendant physician or clinician. Also the dosage of the VHH antibodies as disclosed herein may vary depending on the target cell, tumor, tissue, graft, or organ. The VHH antibodies as disclosed herein and / or the compositions comprising the same are administered according to a regimen of treatment that is suitable for preventing and / or treating the disease or disorder to be prognosed, diagnosed, prevented or treated. The clinician will generally be able to determine a suitable treatment regimen. Generally, the treatment regimen will comprise the administration of one or more VHH antibodies as disclosed herein, or of one or more compositions comprising the same, in one or more pharmaceutically effective amounts or doses.
[0308] The desired dose may conveniently be presented in a single dose or as divided doses (which can again be sub-dosed) administered at appropriate intervals. An administration regimen could include longterm (i.e., at least two weeks, and for example several months or years) or daily treatment.
[0309] The VHH antibodies as disclosed herein will be administered in an amount which will be determined by the medical practitioner based inter alia on the severity of the condition and the patient to be treated. Typically, for each disease indication an optical dosage will be determined specifying the amount to be administered per kg body weight per day, either continuously (e.g. by infusion), as a single daily dose or as multiple divided doses during the day. The clinician will generally be able to determine a suitable daily dose, depending on the factors mentioned herein. It will also be clear that in specific cases, the clinician may choose to deviate from these amounts, for example on the basis of the factors cited above and his expert judgment.
[0310] In particular, the VHH antibodies as disclosed herein may be used in combination with other pharmaceutically active compounds or principles that are or can be used for the prevention and / or treatment of the diseases and disorders cited herein, as a result of which a synergistic effect may or may not be obtained. Examples of such compounds and principles, as well as routes, methods and pharmaceutical formulations or compositions for administering them will be clear to the clinician.
[0311] Compositions of the invention may be used in conjunction with known anti-fungals. Suitable anti- fungals include, but are not limited to, azoles (e.g. fluconazole, itraconazole), polyenes (e.g. amphotericin B), flucytosine, and squalene epoxidase inhibitors (e.g. terbinafine) [see also ref 57], Compositions may also be used in conjunction with known antivirals e.g. HIV protease inhibitors, a 2',3'-dideoxynucleoside (e.g. DDC, DDI), 3'-azido-2',3'-dideoxynucleosides (AZT), 3'-fluoro-2',3'-dideoxynucleosides (FLT), 2', 3'- didehydro-2',3'-dideoxynucleosides (e.g. D4C, D4T) and carbocyclic derivatives thereof (e.g. carbovir), 2'- fluoro-ara-2',3'-dideoxynucleosides, 1 ,3-dioxolane derivatives (e.g. 2',3'-dideoxyl-3'-thiacytidine), oxetanocin analogues and carbocyclic derivatives thereof (e.g. cyclobut-G) and the 9-(2- phosphonylmethoxyethyl)adenine (PMEA) and 9-(3-fluoro-2-phosphonylmethoxypropyl)adenine (FPMPA) derivatives, tetrahydro-irmidazo[4,5,1jk][1 ,4]-benzodiazepin-2(1 H)one (TIBO), 1 -[(2-hydroxyethoxy)- methyl]-6-(phenylthio)thymine (HEPT), dipyrido[3,2-b:2',3'-e]-[1 ,4]diazepin-6-one (nevirapine) and pyridin- 2(1 H)one derivatives, 3TC, etc.
[0312] The VHH antibodies and pharmaceutical compositions are particularly useful for treating infections in animals and humans of Candida species, such as C.albicans; Cryptococcus species, such as C.neoformans; Enterococcus species, such as E.faecalis; Streptococcus species, such as Spneumoniae, S.mutans, S.agalactiae and S.pyogenes; Leishmania species, such as L.major and L.infantum; Acanthamoeba species, such as A.castellani; Aspergillus species, such as A.fumigatus and A.flavus; Pneumocystis species, such as P.carinii; Mycobacterium species, such as M.tuberculosis; Pseudomonas species, such as P.aeruginosa; Staphylococcus species, such as S.aureus; Salmonella species, such as S.typhimurium; Coccidioides species such as C.iminitis; Trichophyton species such as T.verrucosum; Blastomyces species such as B.dermatidis; Histoplasma species such as H.capsulatum; Paracoccidioides species such as P.brasiliensis; Pythiumn species such as P.insidiosum; and Escherichia species, such as E.coli. The VHH antibodies and pharmaceutical compositions comprising the same as disclosed herein are particularly useful for treating diseases including, but not limited to: candidosis, aspergillosis, cryptococcosis, dermatomycoses, sporothrychosis and other subcutaneous mycoses, blastomycosis, histoplasmosis, coccidiomycosis, paracoccidiomycosis, pneumocystosis, thrush, tuberculosis, mycobacteriosis, respiratory infections, scarlet fever, pneumonia, impetigo, rheumatic fever, sepsis, septicaemia, cutaneous and visceral leishmaniasis, corneal acanthamoebiasis, keratitis, cystic fibrosis, typhoid fever, gastroenteritis and hemolytic-uremic syndrome. Anti C.albicans activity is particularly useful for treating infections in AIDS patients.
[0313] Methods of preparing or generating VHH antibodies
[0314] The invention further provides methods for preparing or generating the VHH antibodies, as well as methods for producing nucleic acids encoding these and host cells, products and compositions comprising these VHH antibodies. Some preferred but non-limiting examples of such methods will become clear from the further description herein.
[0315] As will be clear to the skilled person, one particularly useful method for preparing VHH antibodies as disclosed herein generally comprises the steps of:
[0316] (a) expressing a nucleotide sequence encoding a VHH antibody as disclosed herein or a vector or genetic construct a nucleotide sequence encoding that VHH antibody and
[0317] (b) optionally isolating and / or purifying the VHH antibody sequence.
[0318] In particular embodiments envisaged herein, the pest-specific VHH antibody sequences can be obtained by methods which involve generating a random library of amino acid sequences and screening this library for a VHH antibody capable of binding to at least one fungal species.
[0319] Accordingly, in particular embodiments, methods for preparing a VHH antibody as disclosed herein comprise the steps of a) providing a set, collection or library of VHH antibody sequences; b) screening said set, collection or library of VHH antibody sequences that can bind to and / or have affinity for at least one fungal species; c) either (i) isolating said VHH antibody sequence; or (ii) isolating from said cell a nucleic acid sequence that encodes said VHH antibody sequence, followed by expressing said VHH antibody sequence; and d) selecting the VHH antibodies of the current invention by screening the VHH antibody sequence(s) of step c for their ability to cause retardation of growth of a spore of at least one fungal species and / or lysis of a spore of at least one fungal species and where said activity is retained at elevated concentrations of salts, such as NaCI, CaCIz or MgClz at concentrations as described herein. In such a method, the set, collection or library of VHH antibody sequences may be any suitable set, collection or library of VHH antibody sequences. For example, the set, collection or library of VHH antibody sequences may be a set, collection or library of immunoglobulin fragment sequences (as described herein), such as a naive set, collection or library of immunoglobulin fragment sequences; a synthetic or semi- synthetic set, collection or library of immunoglobulin fragment sequences; and / or a set, collection or library of immunoglobulin fragment sequences that have been subjected to affinity maturation.
[0320] In particular embodiments of this method, the set, collection or library of VHH antibody sequences may be an immune set, collection or library of immunoglobulin fragment sequences, for example derived from a mammal that has been suitably immunized with a fungal species or with a suitable antigenic determinant based thereon or derived therefrom, such as an antigenic part, fragment, region, domain, loop or other epitope thereof. In one particular aspect, said antigenic determinant may be an extracellular part, region, domain, loop or other extracellular epitope(s).
[0321] In the above methods, the set, collection or library of VHH antibody sequences may be displayed on a phage, phagemid, ribosome or suitable micro-organism (such as yeast), such as to facilitate screening. Suitable methods, techniques and host organisms for displaying and screening (a set, collection or library of) amino acid sequences will be clear to the person skilled in the art, for example on the basis of the further disclosure herein. Reference is also made to the review by Hoogenboom in Nature Biotechnology, 23, 9, 1105-1116 (2005). a)
[0322] In the above methods, the pest target may be spores or mycelium either intact or homogenized. Alternatively the pest target may be a fraction of said spores or mycelium containing fraction of the plasma membrane of a fungus (for example Botrytis cinerea or other fungus). Said lipid-containing fraction may be obtainable by chromatography.
[0323] The invention also relates to VHH antibodies that are obtainable or obtained by the above methods, or alternatively by a method that comprises one of the above methods and in addition at least the steps of determining the nucleotide sequence or amino acid sequence of said immunoglobulin sequence; and of expressing or synthesizing said amino acid sequence in a manner known per se, such as by expression in a suitable host cell or host organism or by chemical synthesis.
[0324] Methods of manufacturing a VHH antibody
[0325] The present invention provides methods for the manufacturing (or production) of a VHH antibody. In some embodiments, the method comprises: culturing a microbial host cell comprising a polynucleotide capable of expressing the VHH antibody of the invention, or a microbial host cell comprising an expression cassette or vector comprising a polynucleotide capable of expressing the VHH antibody of the invention, under conditions to induce expression of the VHH antibody, and optionally isolating and / or purifying the VHH antibody from the culture medium or fermentation broth, optionally modifying the protein, and optionally formulating the protein.
[0326] “Culturing”, “cultivation”, “cell culture”, “fermentation”, “fermenting” or “microbial fermentation” as used herein means the use of a microbial host cell to produce or manufacture a protein, such as a VHH antibody, at an industrial scale, laboratory scale or during scale-up experiments. It includes suspending the microbial cell in a broth or growth medium, providing sufficient nutrients including but not limited to one or more suitable carbon source (including glucose, sucrose, fructose, lactose, avicel®, xylose, galactose, ethanol, methanol, or more complex carbon sources such as molasses or wort), nitrogen source (such as yeast extract, peptone or beef extract), trace element (such as iron, copper, magnesium, manganese or calcium), amino acid or salt (such as sodium chloride, magnesium chloride or natrium sulfate) or a suitable buffer (such as phosphate buffer, succinate buffer, HEPES buffer, MOPS buffer or Tris buffer). Optionally it includes one or more inducing agents driving expression of a VHH antibody (such as lactose, IPTG, ethanol, methanol, sophorose or sophorolipids). If can also further involve the agitation of the culture media via for example stirring of purging to allow for adequate mixing and aeration. It can further involve different operational strategies such as batch cultivation, fed-batch cultivation, semi-continuous cultivation or continuous cultivation and different starvation or induction regimes according to the requirements of the microbial cell and to allow for an efficient production of the VHH antibody. Alternatively, the microbial cell is grown on a solid substrate in an operational strategy commonly known as solid state fermentation.
[0327] Fermentation broth, culture media or cell culture media as used herein can mean the entirety of liquid or solid material of a fermentation or culture at any time during or after that fermentation or culture, including the liquid or solid material that results after optional steps taken to isolate the VHH antibody. As such, the fermentation broth or culture media as defined herein includes the surroundings of the protein after isolation of the protein, during storage and / or during use as an agrochemical or pharmaceutical composition. Fermentation broth is also referred to herein as a culture medium or cell culture medium.
[0328] “Isolating the VHH antibody “ is an optional step or series of steps taking the cell culture media or fermentation broth as an input and increasing the amount of the VHH antibody relative to the amount of culture media or fermentation broth. Isolating the VHH antibody may alternatively or additionally comprises obtaining or removing the VHH antibody form the culture media or fermentation broth. Isolating the VHH antibody can involve the use of one or multiple combinations of techniques well known in the art, such as precipitation, centrifugation, sedimentation, filtration, diafiltration, affinity purification, size exclusion chromatography and / or ion exchange chromatography. Isolating the VHH antibody may be followed by formulation of the VHH antibody into an agrochemical or pharmaceutical composition.
[0329] Isolation of VHH antibodies
[0330] In some cases, the methods for producing the VHH antibodies binding to at least one fungal species as envisaged herein may further comprise the step of isolating from the VHH antibody sequence library at least one VHH antibody having detectable binding affinity for, or detectable in vitro effect, preferably in the presence of salts, such as MgCI2 or CaCI2 as described herein, on, at least one fungal species.
[0331] These methods may further comprise the step of amplifying a sequence encoding at least one VHH antibody having detectable binding affinity for, or detectable in vitro effect, preferably in the presence of salts, such as NaCI, MgCI2 or CaCI2 as described herein, on, at least one fungal species. For example, a phage clone displaying a particular VHH antibody, obtained from a selection step of a method described herein, may be amplified by reinfection of a host bacteria and incubation in a growth medium.
[0332] In particular embodiments, these methods may encompass determining the sequence of the one or more VHH antibodies capable of binding to at least one fungal species.
[0333] Where a VHH antibody sequence, comprised in a set, collection or library of amino acid sequences, is displayed on a suitable cell or phage or particle, it is possible to isolate from said cell or phage or particle, the nucleotide sequence that encodes that VHH antibody sequence. In this way, the nucleotide sequence of the selected amino acid sequence library member(s) can be determined by a routine sequencing method.
[0334] In further particular embodiments, the methods for producing a VHH antibody as envisaged herein comprise the step of expressing said nucleotide sequence(s) in a host organism under suitable conditions, so as to obtain the actual desired amino acid sequence. This step can be performed by methods known to the person skilled in the art. In addition, the obtained VHH antibody sequences having detectable binding affinity for, or detectable in vitro effect, preferably in the presence of salts, such as NaCI, MgCI2 or CaCI2 as described herein, on, at least one fungal species, may be synthesized as soluble protein construct, optionally after their sequence has been identified.
[0335] For instance, the VHH antibody sequences obtained, obtainable or selected by the above methods can be synthesized using recombinant or chemical synthesis methods known in the art. Also, the amino acid sequences obtained, obtainable or selected by the above methods can be produced by genetic engineering techniques. Thus, methods for synthesizing the VHH antibody sequences obtained, obtainable or selected by the above methods may comprise transforming or infecting a host cell with a nucleic acid or a vector encoding an VHH antibody sequence having detectable binding affinity for, or detectable in vitro effect on the activity of a pest target. Accordingly, VHH antibody sequences having detectable binding affinity for, or detectable in vitro effect on the activity of a pest target can be made by recombinant DNA methods. DNA encoding the VHH antibody can be readily synthesized using conventional procedures. Once prepared, the DNA can be introduced into expression vectors, which can then be transformed or transfected into host cells such as E. coli or any suitable expression system, in order to obtain the expression of VHH antibodies in the recombinant host cells and / or in the medium in which these recombinant host cells reside.
[0336] The term "vector” or “expression vector” as used herein in the context of recombinant expression or cloning of nucleotide sequences means a DNA molecule used as a vehicle to transfer, replicate, or express specific genes or DNA sequences in a host organisms (such as E. coli or P. pastoris). Vectors may be designed to carry genes of interest and may be equipped with regulatory elements like promoters, terminators, start and stop codons, and also a multiple cloning site, selection markers and typically have an origin of replication that allows the vector to be replicated in the host organisms. Where such origin of replication is absent or non-functional in the host organism, such a vector is commonly described as a suicide vector. In general a vector can be seen as a genetic carriers for introducing foreign DNA into host cells, facilitating the production of recombinant proteins or other genetic manipulations. Vectors can be plasmids (typically a small, circular, double-stranded DNA molecule), viruses, or other genetic elements.
[0337] It should be understood, as known by someone skilled in the art of protein expression and purification, that the VHH antibody produced from an expression vector using a suitable expression system may be tagged (typically at the N-terminal or C-terminal end of the amino acid sequence) with e.g. a His- tag, strep-tag or other sequence tag for easy purification.
[0338] Transformation or transfection of nucleic acids or vectors into host cells may be accomplished by a variety of means known to the person skilled in the art including calcium phosphate-DNA co-precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, electroporation, microinjection, liposome fusion, lipofection, protoplast fusion, retroviral infection, and biolistics.
[0339] Suitable host cells for the expression of the desired VHH antibody sequences may be any eukaryotic or prokaryotic cell (e.g., bacterial cells such as E. coli, yeast cells, mammalian cells, avian cells, amphibian cells, plant cells, fish cells, and insect cells), whether located in vitro or in vivo. For example, host cells may be located in a transgenic plant or animal. More specific examples of suitable host cells for expression of the desired VHH antibody sequences are selected from the group of Komagataella sp., Trichoderma sp., Aspergillus sp. and Bacillus sp. More specifically from the group of Komagataella phaffii, Trichoderma reesei, Asprergillus niger, Bacillus subtilis, and Bacillus licheniformis.
[0340] Nucleic acid sequences
[0341] In a further aspect, the present invention provides nucleic acid sequences encoding the VHH antibody sequences as disclosed herein (or suitable fragments thereof). These nucleic acid sequences can also be in the form of a vector or a genetic construct or polynucleotide. The nucleic acid sequences as disclosed herein may be synthetic or semi-synthetic sequences, nucleotide sequences that have been isolated from a library (and in particular, an expression library), nucleotide sequences that have been prepared by PCR using overlapping primers, or nucleotide sequences that have been prepared using techniques for DNA synthesis known per se.
[0342] The present invention includes a nucleic acid sequence encoding any VHH antibody disclosed herein. For example, the present invention includes a nucleic acid sequence encoding a VHH antibody comprising or consisting of the amino acid sequence set out in SEQ ID NO: 1 , as well as variants thereof, such as those having amino acid substitutions or certain percent identity thereto.
[0343] The VHH antibody sequences may be encoded by a nucleic acid that is optimized for expression in certain micro-organisms. For example, the codon-usage bias (i.e. the preferential bias an organism has for a codon triplet matching a certain amino acid) may differ between organisms, therefor selecting the correct codon to encode a protein of interest for a given organism may improve the expression levels of said protein of interest. The chosen nucleotide sequences can therefore differ whilst still encoding the same VHH antibody. Several online algorithms are available for generating a codon optimized nucleotide sequences encoding the VHH antibody sequence as presented here. For example, the skilled person may choose from several online available tools to perform codon optimization specifically suited for the pro- or eukaryotic host cell for expressing the VHH antibodies of the current invention. For example GeneArt (available on https: / / www.thermofisher.com / be / en / home / life-science / cloning / gene- synthesis.html), ATUM (available on https: / / www.atum.bio / ), Vector Builder (available on https: / / en.vectorbuilder.com / tool / codon-optimization.html) all provide tools for optimizing the codon-usage bias for a given recombinant protein. In some embodiments the nucleotide sequence encoding the VHH antibody as retrieved after selection from a library of VHH antibody sequences, for example after phage display selection, (i.e. the original sequence obtained from for example an immunised lama) will be codon optimized by optimizing the sequence for improved expression in E. coli. The VHH antibody of the current invention may for instance be coded by a nucleotide sequence selected from SEQ ID NOs: 10 to 12 or SEQ ID NO: 250 to 252 for expression in Komagataella phaffii (aka Pichia pastoris), or SEQ ID NOs: 13 or 14 or 253 or 254 for expression in Trichoderma reesei or Aspergillus niger, or SEQ ID NO: 15 or 255 for expression in Bacillus subtilis or Bacillus licheniformis. The skilled person will know that one is often required to assess several possible codon optimization strategies to find the most efficient codon usage for the specific host cell and the specific recombinant protein of interest. Therefore, the current invention provides a nucleic acid according to SEQ ID NO: 1 encoding the VHH antibody according to SEQ ID NO: 2 and a nucleic acid according to SEQ ID NO: 241 encoding the VHH antibody according to SEQ ID NO: 242 and a nucleic acid according to SEQ ID NO: 16 to 40 encoding the VHH antibody according to SEQ ID NO: 41 to 65 respectively. The current invention further provides codon-optimized nucleic acids encoding the VHH antibody according to SEQ ID NO: 2 and SEQ ID NO: 242. More specifically, the current invention provides codon-optimized nucleic acid selected from the group of SEQ ID NOs: 10 to 15 encoding SEQ ID NO: 2 or SEQ ID NOs: 250 to 255 encoding SEQ ID NO: 242 or a codon-optimized nucleic acid with at least 60% identity to SEQ ID NO: 1 encoding SEQ ID NO: 2 or with at least 60% identity to SEQ ID NO: 241 encoding SEQ ID NO: 242. More specifically the current invention provides codon optimized nucleic acids with between 60% and 90% identity to SEQ ID NO: 1 encoding SEQ ID NO: 2 or with between 60% and 90% identity to SEQ ID NO: 241 encoding SEQ ID NO: 242, more specifically between 65 and 85% identity to SEQ ID NO: 1 encoding SEQ ID NO: 2 or between 65 and 85% identity to SEQ ID NO: 241 encoding SEQ ID NO: 242, more specifically between 70% and 80% identity to SEQ ID NO: 1 encoding SEQ ID NO: 2 or between 70% and 80% identity to SEQ ID NO: 241 encoding SEQ ID NO: 242.
[0344] Constructs, vectors, host cells
[0345] The genetic constructs as disclosed herein may be DNA or RNA, and are preferably double-stranded DNA. The genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism in a form suitable for integration into the genomic DNA of the intended host cell or in a form suitable for independent replication, maintenance and / or inheritance in the intended host organism. For instance, the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral vector or transposon. In particular, the vector may be an expression vector, i.e., a vector that can provide for expression in vitro and / or in vivo (e.g. in a suitable host cell, host organism and / or expression system).
[0346] Accordingly, in another further aspect, the present invention also provides vectors comprising one or more nucleic acid sequences encoding the VHH antibodies of the invention.
[0347] In still a further aspect, the present invention provides hosts or host cells that express or are capable of expressing one or more VHH antibodies as disclosed herein.
[0348] In yet another embodiment, for use in the methods disclosed herein, the application discloses nucleic acid sequences encoding a VHH antibodies, wherein VHH antibodies are obtained by affinity selection to a specific plant pathogenic target, which VHH antibody is able to inhibit the growth and / or the activity of a crop pest at a minimum inhibitory concentration of about 0.00001 to 1 pM.
[0349] Also disclosed are chimeric genes comprising the following operably linked DNA elements: a) a plant expressible promoter, b) a DNA region which when transcribed yields a mRNA molecule capable of being translated into a VHH antibody and c) a 3’ end region comprising transcription termination and polyadenylation signals functioning in cells of said plant.
[0350] A “chimeric gene” or "chimeric construct" is a recombinant nucleic acid sequence in which a promoter (e.g. a plant expressible promoter) or regulatory nucleic acid sequence is operatively linked to, or associated with, a nucleic acid sequence that codes for an mRNA, such that the regulatory nucleic acid sequence is able to regulate transcription or expression of the associated nucleic acid coding sequence when introduced into a cell such as a plant cell. The regulatory nucleic acid sequence of the chimeric gene is not normally operatively linked to the associated nucleic acid sequence as found in nature.
[0351] In the present invention, a "plant promoter" comprises regulatory elements, which mediate the expression of a coding sequence segment in plant cells. For expression in plants, the nucleic acid molecule must be linked operably to or comprise a suitable promoter which expresses the gene at the right point in time and with the required spatial expression pattern. The term "operably linked" as used herein refers to a functional linkage between the promoter sequence and the gene of interest, such that the promoter sequence is able to initiate transcription of the gene of interest.
[0352] Plant expressible promoters comprise nucleic acid sequences which are able to direct the expression of a transgene in a plant. Examples of plant expressible promoters are constitutive promoters which are transcriptionally active during most, but not necessarily all, phases of growth and development and under most environmental conditions, in at least one cell, tissue or organ, other promoters are inducible promoters, other examples are tissue specific promoters, still other examples are abiotic stress inducible promoters.
[0353] The chimeric gene (or the expression cassette) when transformed in a plant expresses a nucleic acid which results in expression of a protein.
[0354] Also disclosed is a recombinant vector which comprises an expression cassette (or a chimeric gene) as herein described before.
[0355] The term "terminator" encompasses a control sequence which is a DNA sequence at the end of a transcriptional unit which signals 3' processing and polyadenylation of a primary transcript and termination of transcription. The terminator can be derived from the natural gene, from a variety of other plant genes, or from T-DNA. The terminator to be added may be derived from, for example, the nopaline synthase or octopine synthase genes, or alternatively from another plant gene, or less preferably from any other eukaryotic gene.
[0356] In certain embodiments the nucleic acid encoding the VHH antibody of the invention is present in a chimeric gene, where the chimeric gene is suitable for expression in a plant, part of a plant, plant cell or specific organelle or compartment of a plant cell. The current invention therefore also encompasses a transgenic plant, part of a transgenic plant, transgenic plant cell or specific organelle or compartment of a plant cell where said transgenic plant, part of a transgenic plant, transgenic plant cell or specific organelle or compartment of a plant cell expresses a nucleic acid sequence encoding the VHH antibody of the current invention. The chimeric gene or the expression cassette may comprise a suitable (plant) expressible promoter, a terminator a selectable marker and / or any other genetic building blocks to allow for successful expression, translation and localisation of the VHH antibody of the current invention in a transgenic plant, part of a transgenic plant, transgenic plant cell or specific organelle or compartment of a plant cell. In the context of a nucleotide encoding the VHH antibody of the invention or in the context of a chimeric gene suitable for expression in plants the term “cleavable leader peptide” as used above may also mean an N- terminal transit peptide or nuclear localisation signal. The VHH antibody of the current invention may be present in a chimeric gene and whereby the chimeric gene comprises an N-terminal transit peptide whereby the N-terminal transit peptide allows the VHH antibody to be translocated from the cytosol into specific organelles such as chloroplasts and mitochondria. In some embodiments, the N-terminal transit peptide is a nuclear localisation signal.
[0357] "Selectable marker", "selectable marker gene" or "reporter gene" includes any gene that confers a phenotype on a cell in which it is expressed to facilitate the identification and / or selection of cells that are transfected or transformed with a nucleic acid construct of the invention. These marker genes enable the identification of a successful transfer of the nucleic acid molecules via a series of different principles. Suitable markers may be selected from markers that confer antibiotic or herbicide resistance, that introduce a new metabolic trait or that allow visual selection. Examples of selectable marker genes include genes conferring resistance to antibiotics (such as nptll that phosphorylates neomycin and kanamycin, or hpt, phosphorylating hygromycin, or genes conferring resistance to, for example, bleomycin, streptomycin, tetracyclin, chloramphenicol, ampicillin, gentamycin, geneticin (G418), spectinomycin or blasticidin), to herbicides (for example bar which provides resistance to Basta®; aroA or gox providing resistance against glyphosate, or the genes conferring resistance to, for example, imidazolinone, phosphinothricin or sulfonylurea), or genes that provide a metabolic trait (such as manA that allows plants to use mannose as sole carbon source or xylose isomerase for the utilisation of xylose, or antinutritive markers such as the resistance to 2-deoxyglucose). Expression of visual marker genes results in the formation of colour (for example p-glucuronidase, GUS or p- galactosidase with its coloured substrates, for example X-Gal), luminescence (such as the luciferin / luceferase system) or fluorescence (Green Fluorescent Protein, GFP, and derivatives thereof). This list represents only a small number of possible markers. The skilled worker is familiar with such markers. Different markers are preferred, depending on the organism and the selection method.
[0358] It is known that upon stable or transient integration of nucleic acids into plant cells, only a minority of the cells takes up the foreign DNA and, if desired, integrates it into its genome, depending on the expression vector used and the transfection technique used. To identify and select these integrants, a gene coding for a selectable marker (such as the ones described above) is usually introduced into the host cells together with the gene of interest. These markers can for example be used in mutants in which these genes are not functional by, for example, deletion by conventional methods. Furthermore, nucleic acid molecules encoding a selectable marker can be introduced into a host cell on the same vector that comprises the sequence encoding the VHH antibodies of the invention or used in the methods of the invention, or else in a separate vector. Cells which have been stably transfected with the introduced nucleic acid can be identified for example by selection (for example, cells which have integrated the selectable marker survive whereas the other cells die).
[0359] Since the marker genes, particularly genes for resistance to antibiotics and herbicides, are no longer required or are undesired in the transgenic host cell once the nucleic acids have been introduced successfully, the process according to the invention for introducing the nucleic acids advantageously employs techniques which enable the removal or excision of these marker genes. One such a method is what is known as co-transformation. The co- transformation method employs two vectors simultaneously for the transformation, one vector bearing the nucleic acid according to the invention and a second bearing the marker gene(s). A large proportion of transformants receives or, in the case of plants, comprises (up to 40% or more of the transformants), both vectors. In case of transformation with Agrobacteria, the transformants usually receive only a part of the vector, i.e. the sequence flanked by the T-DNA, which usually represents the expression cassette. The marker genes can subsequently be removed from the transformed plant by performing crosses. In another method, marker genes integrated into a transposon are used for the transformation together with desired nucleic acid (known as the Ac / Ds technology). The transformants can be crossed with a transposase source or the transformants are transformed with a nucleic acid construct conferring expression of a transposase, transiently or stable. In some cases (approx. 10%), the transposon jumps out of the genome of the host cell once transformation has taken place successfully and is lost. In a further number of cases, the transposon jumps to a different location. In these cases the marker gene must be eliminated by performing crosses. In microbiology, techniques were developed which make possible, or facilitate, the detection of such events. A further advantageous method relies on what is known as recombination systems; whose advantage is that elimination by crossing can be dispensed with. The best-known system of this type is what is known as the Cre / lox system. Cre1 is a recombinase that removes the sequences located between the loxP sequences. If the marker gene is integrated between the loxP sequences, it is removed once transformation has taken place successfully, by expression of the recombinase. Further recombination systems are the HIN / HIX, FLP / FRT and REP / STB system (Tribble et al., J. Biol. Chem., 275, 2000: 22255-22267; Velmurugan et al., J. Cell Biol., 149, 2000: 553-566). A site-specific integration into the plant genome of the nucleic acid sequences according to the invention is possible.
[0360] For the purposes of the invention, "transgenic", "transgene" or "recombinant" means with regard to, for example, a nucleic acid sequence, an expression cassette, gene construct or a vector comprising the nucleic acid sequence or an organism transformed with the nucleic acid sequences encoding the VHH antibodies, expression cassettes or vectors according to the invention.
[0361] A transgenic plant for the purposes of the invention is thus understood as meaning, as above, that the nucleic acids used in the method of the invention are not present in, or originating from, the genome of said plant, or are present in the genome of said plant but not at their natural locus in the genome of said plant, it being possible for the nucleic acids to be expressed homologously or heterologously. However, as mentioned, transgenic also means that, while the nucleic acids according to the invention or used in the inventive method are at their natural position in the genome of a plant, the sequence has been modified with regard to the natural sequence, and / or that the regulatory sequences of the natural sequences have been modified. Transgenic is preferably understood as meaning the expression of the nucleic acids according to the invention at an unnatural locus in the genome, i.e. homologous or, heterologous expression of the nucleic acids takes place. Preferred transgenic plants are mentioned herein.
[0362] The term "expression" or "gene expression" means the transcription of a specific gene or specific genes or specific genetic construct. The term "expression" or "gene expression" in particular means the transcription of a gene or genes or genetic construct into structural RNA (rRNA, tRNA) or mRNA with or without subsequent translation of the latter into a protein. The process includes transcription of DNA and processing of the resulting mRNA product.
[0363] The term "increased expression" or "overexpression" as used herein means any form of expression that is additional to the original wild-type expression level. For the purposes of this invention, the original wild-type expression level might also be zero, i.e. absence of expression or immeasurable expression.
[0364] Methods for increasing expression of genes or gene products are well documented in the art and include, for example, overexpression driven by appropriate promoters (as described herein before), the use of transcription enhancers or translation enhancers. Isolated nucleic acids which serve as promoter or enhancer elements may be introduced in an appropriate position (typically upstream) of a non-heterologous form of a polynucleotide so as to upregulate expression of a nucleic acid encoding the polypeptide of interest. If polypeptide expression is desired, it is generally desirable to include a polyadenylation region at the 3'-end of a polynucleotide coding region. The polyadenylation region can be derived from the natural gene, from a variety of other plant genes, or from T-DNA. The 3' end sequence to be added may be derived from, for example, the nopaline synthase or octopine synthase genes, or alternatively from another plant gene, or less preferably from any other eukaryotic gene.
[0365] An intron sequence may also be added to the 5' untranslated region (UTR) or the coding sequence of the partial coding sequence to increase the amount of the mature message that accumulates in the cytosol. Inclusion of a spliceable intron in the transcription unit in both plant and animal expression constructs has been shown to increase gene expression at both the mRNA and protein levels up to 1000- fold (Buchman and Berg (1988) Mol. Cell biol. 8: 4395-4405; Callis et al. (1987) Genes Dev 1 :1 183-1200). Such intron enhancement of gene expression is typically greatest when placed near the 5' end of the transcription unit. Use of the maize introns Adh1 -S intron 1 , 2, and 6, the Bronze-1 intron are known in the art. For general information see: The Maize Handbook, Chapter 1 16, Freeling and Walbot, Eds., Springer, N.Y. (1994).
[0366] The term "introduction" or "transformation" as referred to herein encompass the transfer of an exogenous polynucleotide or chimeric gene (or expression cassette) into a host cell, irrespective of the method used for transfer. Plant tissue capable of subsequent clonal propagation, whether by organogenesis or embryogenesis, may be transformed with a genetic construct of the present invention and a whole plant regenerated there from. The particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed. Exemplary tissue targets include leaf disks, pollen, embryos, cotyledons, hypocotyls, megagametophytes, callus tissue, existing meristematic tissue (e.g., apical meristem, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyl meristem). The polynucleotide may be transiently or stably introduced into a host cell and may be maintained non-integrated, for example, as a plasmid. Alternatively, it may be integrated into the host genome. The resulting transformed plant cell may then be used to regenerate a transformed plant in a manner known to persons skilled in the art.
[0367] The transfer of foreign genes into the genome of a plant is called transformation. Transformation of plant species is now a fairly routine technique. Advantageously, any of several transformation methods may be used to introduce the gene of interest into a suitable ancestor cell. The methods described for the transformation and regeneration of plants from plant tissues or plant cells may be utilized for transient or for stable transformation. Transformation methods include the use of liposomes, electroporation, chemicals that increase free DNA uptake, injection of the DNA directly into the plant, particle gun bombardment, transformation using viruses or pollen and microprojection. Methods may be selected from the calcium / polyethylene glycol method for protoplasts (Krens, F.A. et al., (1982) Nature 296, 72-74; Negrutiu I et al. (1987) Plant Mol Biol 8: 363- 373); electroporation of protoplasts (Shillito R.D. et al. (1985) Bio / Technol 3, 1099-1 102); microinjection into plant material (Crossway A et al., (1986) Mol. Gen Genet 202: 179-185); DNA or RNA-coated particle bombardment (Klein TM et al., (1987) Nature 327: 70) infection with (non-integrative) viruses and the like. Transgenic plants, including transgenic crop plants, are preferably produced via Agrobacterium-mediated transformation. An advantageous transformation method is the transformation in planta. To this end, it is possible, for example, to allow the agrobacteria to act on plant seeds or to inoculate the plant meristem with agrobacteria. It has proved particularly expedient in accordance with the invention to allow a suspension of transformed agrobacteria to act on the intact plant or at least on the flower primordia. The plant is subsequently grown on until the seeds of the treated plant are obtained (Clough and Bent, Plant J. (1998) 16, 735-743). Methods for Agrobacterium-mediated transformation of rice include well known methods for rice transformation, such as those described in any of the following: European patent application EP1198985, Aldemita and Hodges (Planta 199: 612-617, 1996); Chan et al. (Plant Mol Biol 22 (3): 491 -506, 1993), Hiei et al. (Plant J 6 (2): 271 -282, 1994), which disclosures are incorporated by reference herein as if fully set forth. In the case of corn transformation, the preferred method is as described in either Ishida et al. (Nat. Biotechnol 14(6): 745-50, 1996) or Frame et al. (Plant Physiol 129(1 ): 13-22, 2002), which disclosures are incorporated by reference herein as if fully set forth. Said methods are further described by way of example in B. Jenes et al., Techniques for Gene Transfer, in: Transgenic Plants, Vol. 1 , Engineering and Utilization, eds. S.D. Kung and R. Wu, Academic Press (1993) 128-143 and in Potrykus Annu. Rev. Plant Physiol. Plant Molec. Biol. 42 (1991 ) 205-225). The nucleic acids or the construct to be expressed is preferably cloned into a vector, which is suitable for transforming Agrobacterium tumefaciens, for example pBin19 (Bevan et al (1984) Nucl. Acids Res. 12- 8711 ). Agrobacteria transformed by such a vector can then be used in known manner for the transformation of plants, such as plants used as a model, like Arabidopsis (Arabidopsis thaliana is within the scope of the present invention not considered as a crop plant), or crop plants such as, by way of example, tobacco plants, for example by immersing bruised leaves or chopped leaves in an agrobacterial solution and then culturing them in suitable media. The transformation of plants by means of Agrobacterium tumefaciens is described, for example, by Hofgen and Willmitzer in Nucl. Acid Res. (1988) 16, 9877 or is known inter alia from F.F. White, Vectors for Gene Transfer in Higher Plants; in Transgenic Plants, Vol. 1 , Engineering and Utilization, eds. S.D. Kung and R. Wu, Academic Press, 1993, pp. 15-38.
[0368] In addition to the transformation of somatic cells, which then have to be regenerated into intact plants, it is also possible to transform the cells of plant meristems and in particular those cells which develop into gametes. In this case, the transformed gametes follow the natural plant development, giving rise to transgenic plants. Thus, for example, seeds of Arabidopsis are treated with agrobacteria and seeds are obtained from the developing plants of which a certain proportion is transformed and thus transgenic [Feldman, KA and Marks MD (1987). Mol Gen Genet 208:1 -9; Feldmann K (1992). In: C Koncz, N-H Chua and J Shell, eds, Methods in Arabidopsis Research. Word Scientific, Singapore, pp. 274-289]. Alternative methods are based on the repeated removal of the inflorescences and incubation of the excision site in the center of the rosette with transformed agrobacteria, whereby transformed seeds can likewise be obtained at a later point in time (Chang (1994). Plant J. 5: 551 -558; Katavic (1994). Mol Gen Genet, 245: 363-370). However, an especially effective method is the vacuum infiltration method with its modifications such as the "floral dip" method. In the case of vacuum infiltration of Arabidopsis, intact plants under reduced pressure are treated with an agrobacterial suspension [Bechthold, N (1993). CR Acad Sci Paris Life Sci, 316: 1 194- 1 199], while in the case of the "floral dip" method the developing floral tissue is incubated briefly with a surfactant-treated agrobacterial suspension [Clough, SJ and Bent AF (1998) The Plant J. 16, 735-743]. A certain proportion of transgenic seeds are harvested in both cases, and these seeds can be distinguished from non-transgenic seeds by growing under the above-described selective conditions. In addition the stable transformation of plastids is of advantages because plastids are inherited maternally is most crops reducing or eliminating the risk of transgene flow through pollen. The transformation of the chloroplast genome is generally achieved by a process which has been schematically displayed in Klaus et al., 2004 [Nature Biotechnology 22 (2), 225-229]. Briefly the sequences to be transformed are cloned together with a selectable marker gene between flanking sequences homologous to the chloroplast genome. These homologous flanking sequences direct site specific integration into the plastome. Plastidal transformation has been described for many different plant species and an overview is given in Bock (2001 ) Transgenic plastids in basic research and plant biotechnology. J Mol Biol. 2001 Sep 21 ; 312 (3):425-38 or Maliga, P (2003) Progress towards commercialization of plastid transformation technology. Trends Biotechnol. 21 , 20-28. Further biotechnological progress has recently been reported in form of marker free plastid transformants, which can be produced by a transient co-integrated maker gene (Klaus et al., 2004, Nature Biotechnology 22(2), 225-229).
[0369] The genetically modified plant cells can be regenerated via all methods with which the skilled worker is familiar. Suitable methods can be found in the abovementioned publications by S.D. Kung and R. Wu, Potrykus or Hofgen and Willmitzer.
[0370] Generally after transformation, plant cells or cell groupings are selected for the presence of one or more markers which are encoded by plant-expressible genes co-transferred with the gene of interest, following which the transformed material is regenerated into a whole plant. To select transformed plants, the plant material obtained in the transformation is, as a rule, subjected to selective conditions so that transformed plants can be distinguished from untransformed plants. For example, the seeds obtained in the above-described manner can be planted and, after an initial growing period, subjected to a suitable selection by spraying. A further possibility consists in growing the seeds, if appropriate after sterilization, on agar plates using a suitable selection agent so that only the transformed seeds can grow into plants. Alternatively, the transformed plants are screened for the presence of a selectable marker such as the ones described above.
[0371] Following DNA transfer and regeneration, putatively transformed plants may also be evaluated, for instance using Southern analysis, for the presence of the gene of interest, copy number and / or genomic organisation. Alternatively or additionally, expression levels of the newly introduced DNA may be monitored using Northern and / or Western analysis, both techniques being well known to persons having ordinary skill in the art.
[0372] The generated transformed plants may be propagated by a variety of means, such as by clonal propagation or classical breeding techniques. For example, a first generation (or T1 ) transformed plant may be selfed and homozygous second-generation (or T2) transformants selected, and the T2 plants may then further be propagated through classical breeding techniques. The generated transformed organisms may take a variety of forms. For example, they may be chimeras of transformed cells and non-transformed cells; clonal transformants (e.g., all cells transformed to contain the expression cassette); grafts of transformed and untransformed tissues (e.g., in plants, a transformed rootstock grafted to an untransformed scion).
[0373] Cell Wall Disrupting agents
[0374] The compositions or agrochemical compositions disclosed herein may next to containing at least one VHH, additionally contain a cell wall disrupting agent. The cell wall disrupting agent disclosed herein may be any agent capable of disrupting the integrity of the cell wall. More specifically, the cell wall disrupting agent may be a fungal cell wall disrupting agent. In some embodiments, the cell wall disrupting agent is an enzyme. In some preferred embodiments, the cell wall disrupting agent is a cell wall degrading enzyme (CWDE). Therefore, the invention provides for compositions comprising at least one VHH and a cell wall degrading enzyme, and methods and uses thereof. In some embodiments, the cell wall disrupting agent is active against a bacterial cell wall. In some embodiments, the cell wall disrupting agent is active against a plant cell wall. In a preferred embodiment, the cell wall disrupting agent is active against a fungal cell wall. In some embodiments, the cell wall disrupting agent is active against a fungal cell wall but is not active against a plant cell wall.
[0375] In some embodiments, the cell wall disrupting agent reduces the integrity of the cell wall. The reduction in cell wall integrity may allow molecules to permeate through the cell wall to the cell membrane. In some embodiments, the molecules that permeate through the cell wall are proteins. In preferred embodiments, the proteins that permeate through the cell wall comprise heavy chain variable domains of a heavy chain antibody (VHH) or a functional fragment thereof. In preferred embodiments, the molecules that permeate the cell wall are polypeptides of the composition disclosed herein. In some embodiments the cell wall disrupting agent alone, acts as an anti-pest agent, such as for instance a biostatic agent or a pesticidal agent, including but not limited to a fungistatic or a fungicidal agent.
[0376] The cell wall disrupting agent may be a cell wall degrading enzyme. In some embodiments, the composition disclosed herein comprises a mixture of cell wall degrading enzymes. In some embodiments, the composition comprises at least one, at least two, at least 3, at least 4 or at least 5 cell wall degrading enzymes. In some embodiments, the composition comprises multiple cell wall degrading enzymes. In some embodiments, the composition may comprise a cocktail of cell wall disrupting agents. The term “cocktail” relates to a composition comprising one or more enzymes. The cocktail may contain additional agents not directed to cell wall disruption, such as one or more proteases or one or more arabinanases. In some embodiments, the composition may comprise one or more protease inhibitors.
[0377] The cell wall degrading enzyme may be a carbohydrolase. The cell wall degrading enzyme may be a cellulase. In some embodiments the cell wall degrading enzyme is selected from the group consisting of glucanases, chitinases, mannanases, xyloglucanases, pectinases, glycosidases and xylanases. In some embodiments the cell wall degrading enzyme is selected from the group consisting of glucanases and chitinases. The invention also contemplates a composition comprising a mixture of enzymes comprising at least one enzyme selected from the group consisting of glucanases, chitinases, mannanases, xyloglucanases, pectinases, glycosidases and xylanases. In some embodiments, the mixture of enzymes in the composition comprises at least one chitinase and at least one glucanase. In some embodiments, the mixture of enzymes in the composition comprises at least two chitinases and at least two glucanases. In some embodiments, the mixture of enzymes in the composition comprises at least one chitinase and at least two different glucanases, or at least two different chitinases and at least one glucanase.
[0378] In some embodiments, the cell wall degrading enzyme has chitinolytic activity. The chitinase may be endo-chitinase or exo-chitinase. The exo-chitinase may target the reducing or non-reducing end of the chitin.
[0379] In some embodiments the cell wall degrading enzyme is a glucanase. Glucanases are also referred to as lichenases, hydrolases, glycosidases, glycosyl hydrolases, and / or laminarinases. In some embodiments the glucanase is a beta-glucanase, such as beta-1 ,3-glucanase, and / or beta-1 ,6-glucanase. The glucanase may be an endo-glucanase or an exo-glucanase. In some embodiments, the glucanase is selected from the group consisting of exo-p-1 ,3-glucanase (also known as glucan 1 ,3-beta-glucosidase), endo-p-1 ,3-glucanase (also known as glucan endo-1 ,3-beta-D-glucosidase), exo-p-1 , 6-glucanase (also known as glucan 1 ,6-alpha-glucosidase), endo-p-1 ,6-glucanase (also known as glucan endo-1 ,6-beta- glucosidase) and endo-p-1 ,3(4)-glucanase. In some embodiments, the composition disclosed herein comprises a glucanase selected from the group consisting of exo-p-1 ,3-glucanase (also known as glucan 1 ,3-beta-glucosidase), endo-p-1 ,3-glucanase (also known as glucan endo-1 ,3-beta-D-glucosidase), exo-p- 1 ,6-glucanase (also known as glucan 1 ,6-alpha-glucosidase), and endo-p-1 ,6-glucanase (also known as glucan endo-1 ,6-beta-glucosidase), and endo-p-1 ,3(4)-glucanase and / or any combination thereof.
[0380] In some embodiments, the composition disclosed herein does not contain an agent capable of degrading plant cell walls. In some embodiments, the composition does not contain p-1 ,4-glucanases.
[0381] The cell wall degrading enzymes disclosed herein may be naturally occurring or synthetic. The cell wall degrading enzyme may be derived from filamentous fungi, yeasts, viruses, bacteria, archaea, and plants. The cell wall degrading enzymes may be derived from an organism selected from the group consisting of Abracris flavolineata, Acanthocheilonema viteae, Acetivibrio thermocellus, Achlya bisexualis, Achromobacter sp., Acinetobacter sp., Acremonium blochii, Acremonium persicinum, Acremonium sp., Aeromonas caviae, Aeromonas caviae, Aeromonas hydrophila, Aeromonas schubertii, Aeromonas sp., Agaricus bisporus enzyme, Agaricus brasiliensis, Agrius convolvuli, Al icyclobacillus sp., Alkalihalobacil lus clausii, Alkalihalobaci llus clausii, Alternaria bataticola, Alternaria tenuissima, Alteromonas sp., Amanita muscaria, Amycolatopsis orientalis, Amylomyces rouxii, Anadara broughtonii, Anaeromyces mucronatus, Ananas comosus, Annona cherimola, Antheraea pernyi, Apium graveolens, Aplysia kurodai, Apriona germari, Arabidopsis thaliana, Arcopilus cupreus, Arthrobacter globiformis, Arthrobacter sp., Aspergillus flavus, Aspergillus fumigatus, Aspergillus griseoaurantiacus, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Aspergillus phoenicis, Aspergillus versicolor, Aspergillus sp., Aspergillus usamii, Astragalus membranaceus, Atriplex littoralis, Autographa californica, Avena sativa, Bacillus amyloliquefaciens, Bacillus cereus, Bacillus licheniformis, Bacillus pumilus, Bacillus sp., Bacillus subtilis, Bacillus tequilensis, Bacillus thuringiensis, Bacteroides fragilis, Bacteroides thetaiotaomicron, Basidiomycota, Bambusa oldhamii, Beauveria bassiana, Benincasa hispida, Bipolaris zeicola, Bombyx mori, Bos Taurus, Boscia senegalensis, Botrytis cinerea, Brassica juncea, Brassica oleracea, Brevibacillus formosus, Brevibacillus formosus, Brevibacterium fuscum var. dextranlyticum, Bromus inermis, Brugia malayi, Burkholderia cepacian, Caldicellulosiruptor sp., Calvatia cyanthiformis, Candida albicans, Capra hircus, Carica papaya, Carnobacterium divergens, Carnobacterium maltaromaticum, Casuarina glauca, Cellulomonas fimi, Cellulosimicrobium cellulans, Cellulosimicrobium funkei, Chaetomium globosum, Chaetomium sp., Chaetomium thermophilum, Chelonus sp., Cherax destructor, Chitiniphilus shinanonensis, Chlamys albidus, Chondrus verrucosus, Chromobacterium sp., Cicer arietinum, Citrobacter freundii, Citrus aurantiifolia, Citrus sinensis, Clonostachys rosea, Clostridium paraputrificum, Clostridium sp., Coccidioides immitis, Coprinopsis cinerea, Coprinellus congregates, Corallococcus sp., Cordyceps javanica, Crithidia fasciculata, Crocus sativus, Crocus vernus, Cryptococcus neoformans, Cryptopygus antarcticus, Cucumis melo, Cucumis sativus, Cucurbita maxima, Cupiennius salei, Cyberlindnera jadinii, Cyberlindnera saturnus, Cycas revolute, Daucus carota, Debaryomyces hansenii, Delftia tsuruhatensis, Dichotomopilus indicus, Dioscorea oppositifolia, Dioscorea polystachya, Diversispora versiformis, Drosera rotundifolia, Entamoeba dispar, Entamoeba histolytica, Enterobacter sp., Euglena gracilis, Eulota maakii, Euphorbia characias, Fibrobacter succinogenes, Ficus pumila, Fibrobacter succinogenes, Flavobacterium dormitator, Flavobacterium sp., Formosa algae, Francisella tularensis, Fraxinus excelsior, Fungi imperfect!, Fusarium chlamydosporum, Fusarium fujikuroi, Fusarium oxysporum, Fusarium sambucinum, Gallus gallus, Ganoderma lucidum, Gastrophysa atrocyanea, Gecarcoidea natalis, Gemmabryum coronatum, Geotrichum lactis, Glaciozyma Antarctica, Gladiolus x gandavensis, Glycine max, Gossypium hirsutum, Haemaphysalis longicornis, Haliotis discus hannai, Haliotis tuberculate, Halobacterium salinarum, Helix pomatia, Helminthosporium sesamum, Herpetomonas muscarum, Hevea brasiliensis, Hexagrammos otakii, Homo sapiens, Hordeum vulgare, Humicola insolens, Hydrogenophilus hirschii, Ipomoea carnea, Isoptericola jiangsuensis, Irpex lacteus, Jatropha curcas, Kluyveromyces aestuarii, Kluyveromyces phaseolosporus, Kluyveromyces lactis, Komagataella pastoris, Laccaria laccata, Laceyella putida, Lactiplantibacillus plantarum, Lactobacillus acidophilus, Lactococcus lactis, Lecanicillium fungicola, Leishmania braziliensis, Leishmania donovani, Leishmania infantum, Leishmania major, Leishmania Mexicana, Lemna minor, Lentinula edodes, Leptomonas seymouri, Leucaena leucocephala, Leucoagaricus gongylophorus, Limonium bicolor, Lipomyces lipofer, Littorina kurila, Listeria innocua, Listeria monocytogenes, Listeria seeligeri, Listeria welshimeri, Lotus japonicus, Lysobacter enzymogenes, Macaca fascicularis, Malbranchea chrysosporioidea, Malus domestica, Manduca sexta, Massilia timonae, Melgh iribacil lus thermohalophilus, Metarhizium anisopliae, Meyerozyma caribbica, Microbispora sp., Mizuhopecten yessoensis, Monascus purpureus, Moritella marina, Mucor hiemalis, Mucor mucedo, Mus musculus, Musa acuminate, Musa sp., Musa x paradisiaca, Mycobacterium tuberculosis, Mythimna separate, Naganishia diffluens, Neotyphodium sp., Nepenthes alata, Neurospora crassa, Niallia circulans, Nicotiana glutinosa, Nicotiana tabacum, Nocardiopsis prasina, Nocardiopsis sp., Oreochromis niloticus, Orpinomyces sp., Orpinomyces sp., Oryza sativa, Ostrinia furnacalis, Ovis aries, Paenibacillus barengoltzii, Paenibacillus ehimensis, Paenibacillus macerans, Paenibacillus sp., Paenibacillus thermoaerophilus, Panax ginseng, Parabacteroides distasonis, Paracoccidioides brasiliensis, Paraphaeosphaeria minitans, Pedobacter sp., Penaeus japonicus, Penaeus vannamei, Penicillium brefeldianum, Penicillium italicum, Penicillium multicolor, Penicillium ochrochloron, Penicillium sp., Pennahia argentata, Periconia byssoides, Perna viridis, Periplaneta Americana, Petroselinum crispum, Phanerodontia chrysosporium, Phaseolus lunatus, Phaseolus vulgaris, Phlebotomus papatasi, Phytolacca Americana, Phytophthora infestans, Picea abies, Pinus pinaster, Piper colubrinum, Piromyces communis, Pisum sativum, Plasmodium gallinaceum, Plasmodium vivax, Pneumocystis carinii, Pneumocystis murina, Pochonia chlamydosporia, Populus trichocarpa, Porodisculus pendulus, Porodisculus pendulus, Prevotella oralis, Prunus avium, Pseudoalteromonas tunicate, Pseudocardium sachalinense, Pseudomonas aeruginosa, Pseudomonas sp., Pseudotsuga menziesii, Pteris ryukyuensis, Pyrenophora tritici-repentis, Pyrococcus furiosus, Pythium insidiosum, Quercus robur, Ralstonia sp., Ralstonia sp, Rasamsonia emersonii, Rattus norvegicus, Rhizoctonia solani, Rhizomucor miehei, Rhizopus microsporus, Rhizopus sp., Rhodothermus marinus, Saccharolobus solfataricus, Saccharomyces cerevisiae, Saccharomycopsis fibuligera, Saccharum hybrid cultivar Yacheng, Saccharophagus degradans, Saccharopolyspora erythraea, Salmonella enterica typhimurium, Sarnia Cynthia, Sceloporus undulatus garmani, Schizophyllum commune, Schizosaccharomyces japonicus, Schizosaccharomyces pombe, Sclerotium glucanicum, Scomber japonicus, Scorpaena scrota, Secale cereale, Serratia liquefaciens, Serratia marcescens, Serratia sp., Setaria cervi, Silene vulgaris, Solanum lycopersicum, Solanum tuberosum, Spodoptera frugiperda, Stachybotrys elegans, Stenotrophomonas maltophilia, Stomoxys calcitrans, Streptococcus mitis, Streptococcus mutans, Streptomyces antibioticus, Streptomyces atrovirens, Streptomyces coelicolor, Streptomyces cyaneus, Streptomyces cyanocolor, Streptomyces murinus, Streptomyces rochei, Streptomyces sioyaensis, Streptomyces sp., Streptococcus equinus, Streptomyces eurythermus, Streptomyces fradiae, Streptomyces griseus, Streptomyces ipomoeae, Streptomyces lividans, Streptomyces lydicus, Streptomyces plicatus, Streptomyces prasinopilosus, Streptomyces scabiei, Streptomyces thermoviolaceus, Streptomyces venezuelae, Strongylocentrotus intermedius, Strongylocentrotus purpuratus, Suillus bovinus, Suillus luteus, Sulfurisphaera tokodaii, Sus scrota, Synechocystis sp., Tamarindus indica, Tenebrio molitor, Theobroma cacao, Thermoascus aurantiacus, Thermobifida fusca, Thermoclostridium stercorarium, Thermococcus chitonophagus, Thermococcus kodakarensis, Thermothelomyces heterothallicus, Thermothelomyces thermophilus, Thermotoga maritima, Thermotoga neapolitana, Thermotoga petrophila, Trametes cinnabarina, Tribolium castaneum, Trichoderma asperellum, Trichoderma atroviride, Trichocladium griseum, Trichoderma harzianum, Trichoderma koningii, Trichoderma longibrachiatum, Trichoderma reesei, Trichoderma sp., Trichoderma virens, Trichoderma viride, Trichoderma sp., Trichosanthes dioica, Triticum aestivum, Trypanosoma lewisi, Valerianella locusta, Verticillium albo-atrum, Verticillium dahlia, Vibrio , Iginolyticus, Vibrio harveyi, Vibrio parahaemolyticus, Vibrio proteolyticus, Vibrio sp., Vicia faba, Vitis inifera, Vitis vinifera, Wickerhamomyces anomalus, Wolfiporia cocos, Xylella fastidiosa, Yarrowia lipolytica, Zea mays, and Zobellia galactanivorans. The cell wall degrading enzymes may be derived from filamentous fungi such as Trichoderma species or Aspergillus species.
[0382] In some embodiments, the cell wall disrupting agent is active against a fungal cell wall. The fungal cell wall is composed of chitin (acetylglucosamine polymers), glucans, polysaccharides and mucopolysaccharides, waxes and pigments. The cell wall disrupting agent may act against any component of the cell wall. The cell wall disrupting agent may act against multiple components of the cell wall. Preferably, the cell wall disrupting agent is active against chitin and / or glucans in the fungal cell wall.
[0383] The fungus may be a pathogenic fungus, or a fungal pest. The fungus may be a plant pathogenic fungus. The genus of said plant pathogenic fungus may be chosen from the group of plant pathogenic fungi as defined before.
[0384] A cocktail of enzymes
[0385] In some embodiments, the cell wall disrupting agent is obtained or obtainable from a fermentation of one or more microbial species. “Culturing”, “cell culture”, “fermentation”, “fermenting” or “microbial fermentation” as used herein includes suspending the microbial cell in a broth or growth medium, providing sufficient nutrients including but not limited to one or more suitable carbon source (including glucose, sucrose, fructose, lactose, avicel®, xylose, galactose, ethanol, methanol, or more complex carbon sources such as molasses or wort), nitrogen source (such as yeast extract, peptone or beef extract), trace element (such as iron, copper, magnesium, manganese or calcium), amino acid or salt (such as sodium chloride, magnesium chloride or natrium sulfate) or a suitable buffer (such as phosphate buffer, succinate buffer, HEPES buffer, MOPS buffer or Tris buffer). It can also further involve the agitation of the culture media via for example stirring of purging to allow for adequate mixing and aeration. It can further involve different operational strategies such as batch cultivation, semi-continuous cultivation or continuous cultivation and different starvation or induction regimes according to the requirements of the microbial cell and to allow for an efficient production of the compound of interest or a compound involved in the production of the compound of interest. Alternatively, the microbial cell is grown on a solid substrate in an operational strategy commonly known as solid state fermentation. In a typical fermentation reaction, a microbial cell is propagated in a nutrient rich broth providing the necessary nutrients, salts, minerals, oxygen etc... for the microbial cell to grow and multiply to reach a certain density of cells in the fermentation broth. Generally, the broth will comprise any and all nutrients required for the microbial organism to grow. The skilled person will be aware of the required components of the culture broth or fermentation broth, which may differ depending on the species of microbial cell being cultured. In some embodiments, the culture broth or fermentation broth may comprise a nitrogen source, such as ammonium or peptone. At the end of a fermentation reaction, the fermentation broths may be clarified by removing the cellular material and as such obtaining a microbial fermentation broth that is clarified. Clarification can be achieved in many ways such as commonly known filtration, centrifugation, or precipitation techniques. In some embodiments further downstream processing steps are applied to for instance further concentrate the protein content in the clarified broth by purification. Where the fermentation broth contain one or more cell wall degrading enzymes, the further downstream processing steps may be optimized to increase the concentration of said cell wall degrading enzymes. Common downstream process steps for concentrating or purifying the protein content include filtration, chromatography steps or a combination thereof. When concentrating the protein content of a clarified broth by purification , it is understood that such a purification does not necessarily need to be complete i.e. reaching for example 90% or higher purity. For instance a single filtration step may be use with a molecular weight cut-off lower than the molecular weight of the cell wall degrading enzymes to be concentrated and whereby the retentate, comprising the cell wall degrading enzymes and other larger or similar sized components, is maintained. In some embodiments, the cell wall degrading agent is obtained or obtainable from a method comprising the steps of: a) culturing or fermenting one or more fungal or bacterial species, together or separately, under conditions to allow growth of the fungal or bacterial species; b) obtaining the fermentation broth or broths from step a); c) clarifying the fermentation broth or broths obtained from step b) to remove cellular material; d) optionally purifying the clarified broth or broths from step c) to increase the protein concentration of the broth or broths; and e) combining the broths if the fungal or bacterial species were cultured or fermented separately; thereby providing the cell wall degrading agent. The conditions to allow growth of the species will be known to the skilled person, dependent on what species of fungus or bacteria is being cultured or fermented. Generally it may comprise culturing or fermenting in a broth or growth medium that comprises sufficient nutrients to allow growth (including but not limited to one or more suitable carbon source, nitrogen source, amino acid or salt, or a suitable buffer) under conditions that further provide sufficient heat, light and atmosphere (e.g. oxygen or a lack thereof).
[0386] In a preferred embodiment the cell wall disrupting agent is obtained or obtainable from a fermentation of one or more of a fungal species. The fungal species for obtaining cell wall degrading enzymes may preferably be from the division Ascomycota, subdivision Pezizomycotina. In some embodiments, the fungal species may preferably from the Class Sordariomycetes, optionally the Subclass Hypocreomycetidae. In some embodiments, the fungal species may be from an Order selected from the group consisting of Hypocreales, Microascales, Eurotiales, Onygenales and Sordariales. In some embodiments, the fungal species may be from a Family selected from the group consisting of Hypocreaceae, Nectriaceae, Clavicipitaceae and Microascaceae. In some more specific embodiments, the fungal species may be from a Genus selected from the group consisting of Trichoderma (anamorph of Hypocrea), Myceliophthora, Fusarium, Gibberella, Nectria, Stachybotrys, Claviceps, Metarhizium, Villosiclava, Ophiocordyceps, Cephalosporium, , Rasamsonia, Neurospora, and Scedosporium. In some further and more specific embodiments, the fungal species may be selected from the group consisting of Trichoderma reesei (Hypocrea jecorina), T. citrinoviridae, T. longibrachiatum, T. virens, T. harzianum, T. asperellum, T. atroviridae, T. parareesei, , Fusarium oxysporum, F. gramineanum, F. pseudograminearum, F. venenatum, Gibberella fujikuroi, G. moniliformis, G. zeaea, Nectria (Haematonectria) haematococca, Stachybotrys chartarum, S. chlorohalonata, Claviceps purpurea, Metarhizium acridum, M. anisopliae, Villosiclava virens, Ophiocordyceps sinensis, Neurospora crassa, Rasamsonia emersonii, Acremonium (Cephalosporium) chrysogenum, Scedosporium apiospermum, Aspergillus niger, A. awamori, A. oryzae, Chrysosporium lucknowense, Myceliophthora thermophila, Myceliophthora heterothallica, Humicola insolens, Trichoderma harzianum, and Humicola grisea. In one embodiment the cell wall disrupting agent is obtained or obtainable from a fermentation of one or more of a fungal species and where the fungal species is Trichoderma harzianum. In another embodiment the cell wall disrupting agent is obtained or obtainable from a fermentation of one or more of a fungal species and where the fungal species is Aspergillus niger. In a preferred embodiment the cell wall disrupting agent is obtained or obtainable from a fermentation of one or more of a fungal species and where the fungal species are Trichoderma harzianum and Aspergillus niger. In some embodiments, the cell wall degrading agent is obtained or obtainable from a method comprising the steps of: a) culturing or fermenting Trichoderma harzianum and Aspergillus niger, together or separately, under conditions to allow growth of the fungal species; b) obtaining the fermentation broth or broths from step a); c) clarifying the fermentation broth or broths obtained from step b) to remove cellular material; d) optionally purifying the clarified broth or broths from step c) to increase the protein concentration of the broth or broths; and e) combining the broths if the fungal species were cultured or fermented separately; thereby providing the cell wall degrading agent. Such cell wall degrading agents may comprise a mixture (cocktail) of one or more glucanases. Cell wall degrading agents obtained or obtainable from such a method may be referred to herein as VinoTaste Pro.
[0387] In some embodiments, the cell wall disrupting agent is obtained or obtainable from a fermentation of one or more microbial species and where microbial species is selected from the kingdom Bacteria. In particular, the Bacteria may be selected from the group consisting of Escherichia coli (E. coli), Bacillus species, Pseudomonas species, Corynebacterium species, Streptomyces species, Lactococcus species, Shigella species, Streptococcus species, Neisseria species, Geobacillus species, Bifidobacterium species, Azotobacter species, Arthobacter species, Bordetella species, Lactobacillus species, Staphylococcus species. In a preferred embodiments, the cell wall disrupting agent is obtained from a fermentation of one or more bacterial species and where said bacterial species is Arthobacter luteus. In some embodiments, the cell wall degrading agent is obtained or obtainable from a method comprising the steps of: a) culturing or fermenting Arthobacter luteus, under conditions to allow growth of the bacterial species; b) obtaining the fermentation broth from step a); c) clarifying the fermentation broth obtained from step b) to remove cellular material; and d) optionally purifying the clarified broth from step c) to increase the protein concentration of the broth; thereby providing the cell wall degrading agent. Cell wall degrading agents obtained or obtainable from such a method may be referred to herein as Zymolyase.
[0388] Where the cell wall disrupting agent is obtained or obtainable from a fermentation of one or more microbial species, the resulting cell wall disrupting agent may be a cocktail (i.e. a mixture) of enzymes or where further purification steps, such as chromatograph steps, are performed a pure or essentially pure cell wall disrupting enzyme may be obtained. In a preferred embodiment, the cell wall disrupting agent is a cocktail. In some embodiments the cell wall disrupting agent may be a cocktail (i.e. mixture) of enzymes, such as VinoTaste™ Pro (Novozymes) or Zymolyase (amsbio or zymo research). The disclosure also explicitly covers the use of VinoTaste Pro as a cell wall disrupting agent. In some embodiments, VinoTaste Pro is the only active ingredient in the composition.
[0389] The cocktail may contain at least one cell wall disrupting agent selected from glucanase and chitinase. The cocktail may comprise at least one, at least 2, at least 3, at least 4 or at least 5 glucanases and / or chitinases. The cocktail may comprise at least one glucanase, such as a p-glucanase, endo-p-1 ,3- glucanase, endo-1 ,3(4)-p-glucanase, endo-1 ,3(4)-p-D-glucanase, exo-1 ,3-p-D-glucanase, or any combination thereof. In some embodiments, the cocktail does not comprise a pectinase and / or a protease.
[0390] The disclosure also covers a composition comprising cell wall disrupting agents that do not contain a polypeptide. In some embodiments, the composition comprises only a cell wall disruption agent as the active ingredient. In some embodiments, the invention relates to uses of cell wall disrupting agents, or a cocktail thereof, such as VinoTaste Pro, in methods for protecting or treating a plant or a part of said plant from an infection with a plant pathogenic fungus, a post-harvest treatment method for protecting or treating a harvested plant or a harvested part of said plant from an infection with a plant pathogenic fungus and a method of inhibiting the growth of, or killing, a plant pathogenic fungus. In some embodiments, the methods comprise at least the step of applying to a plant or to a part of said plant the composition disclosed herein. In some embodiments the cell wall disrupting agent is VinoTaste™ Pro. In some embodiments, the cell wall disrupting agent comprises one or more p glucanase and one optionally one or more additional components that do not act on the cell wall, for example one or more pectinase, one or more proteinase and one or more arabinose.
[0391] Testing cell wall disrupting agents
[0392] A cell wall disrupting agent, either an individual cell wall disrupting enzyme or a cocktail or mixture of two or more cell wall disrupting enzymes, may be identified by subjecting a fungal species, such as a plant pathogenic species, to increasing amounts of the cell wall disrupting agent and observing said fungal species using standard brightfield or phase contrast microscopy with a magnification factor of 200x or more. A cell wall disrupting agent may lead at a sufficiently high concentration to the formation of protoplasts, indicating that the cell wall has been removed, protoplasts may be maintained in a correct buffer solution with a isotonic osmotic pressure (as opposed to a hypotonic buffer solution leading to collapse of the protoplasts or a hypertonic buffer solution leading to the rupture of protoplasts). A specific example of a buffer solution that may be used is the FF1 buffer consisting of 29.58 g MgSO4.7H2O, 1.37 g NaH2PO4.2H2O, 100 ml MQ water (pH 5.8). This buffer may for example be used to assess protoplasts formation of Botrytis cinerea, but the skilled person will know that many other buffers may be used as long as they are isotonic relative to the interior of the protoplasts and allow for the cell wall disrupting enzyme to be active. This assay is exemplified in Example 1 1 for Botrytis cinerea. The concentration required to obtain protoplasts may not be the concentration that is required i...
Claims
Claims1 . A VHH antibody that binds to at least one fungal species, comprising: a complementarity determining region 1 (CDR1 ) region having the amino acid sequence set out in any one of SEQ ID NO: 3, 66 to 90, 243, 256 and 263; a CDR2 region having the amino acid sequence set out in any one of SEQ ID NO: 4, 91 to 115, 244, 257 and 264; and a CDR3 region having the amino acid sequence set out in any one of SEQ ID NO: 5, 116 to 140, 245, 258 and 265.
2. The VHH antibody according to claim 1 where the VHH antibody further comprises: a framework region 1 (FR1 ) sequence having the amino acid sequence set out in any one of SEQ ID NO: 6, 141 to 165, 246, 259 and 266, a FR2 sequence having the amino acid sequence set out in any one of SEQ ID NO: 7, 166 to 190, 247, 260 and 267, a FR3 sequence having the amino acid sequence set out in any one of SEQ ID NO: 8, 191 to 215, 248, 261 and 268, and a FR4 sequence having the amino acid sequence set out in any one of SEQ ID NO: 9, 216 to 240, 249, 262 and 269.
3. The VHH antibody according to claims 1 or 2, where the VHH antibody is derived from a precursor polypeptide consisting of a cleavable leader peptide fused to the N-terminus of the VHH antibody.
4. A method for obtaining a variant of the VHH antibody according to any of claims 1 to 3, comprising the steps of: a. selecting a nucleic acid sequence encoding the VHH antibody according to any of claims 1 to 3; b. modifying the selected nucleic acid sequence encoding the VHH antibody to obtain, when expressed, at least one variant VHH antibody; c. transforming host cells or unicellular organisms with the modified nucleic acid sequence to express a variant VHH antibody encoded by the modified nucleic acid sequence; d. assessing the ability of the variant VHH antibody to bind to at least one fungal species; e. where the variant VHH antibody is not capable of binding to at least one fungal species, repeating the process of steps (a) to (d) until a variant VHH antibody capable of binding to at least one fungal species; f. where the variant VHH antibody capable of binding to at least one fungal species was identified in step (d), isolating the corresponding modified nucleic acid sequence obtained in step (b) and expressing said nucleic acid to prepare a variant VHH antibody which binds to the at least one fungal species; g. optionally, isolating and / or purifying the variant VHH antibody; h. optionally, further manufacturing, isolating and purifying the variant VHH antibody.
5. A transgenic plant, plant part, seed, or plant cell comprising a nucleic acid sequence encoding a VHH antibody as defined in any one of claims 1 to 3 or a nucleic acid according to any one of SEQ ID NOs: 1 , 10 to 40, 241 and 250 to 255.
6. An agrochemical composition comprising at least one of the VHH antibody according to any one of claims 1 to 3.
7. The agrochemical composition according to claim 6, further comprising at least one agrochemically suitable additive selected from the group consisting off diluents, solvents, adjuvants, surfactants, wetting agents, spreading agents, oils, stickers, thickeners, penetrants, buffering agents, acidifiers, anti-settling agents, anti-freeze agents, photo-protectors, defoaming agents, biocides and drift control agents.
8. A method for protecting or treating a plant or a part of said plant from an infection with a plant pathogenic fungus, at least comprising the step of applying directly or indirectly to said plant or to a part of said plant, a VHH antibody according to any one of claims 1 to 3, or a composition according to claims 6 or 7, in an amount and under conditions effective to protect or treat said plant or a part of said plant against said infection with said plant pathogenic fungus.
9. A method of inhibiting growth of a plant pathogenic fungus, comprising at least the step of applying directly or indirectly to a plant or to a part of said plant, a VHH antibody according to any one of claims 1 to 3 or a composition according to claims 6 or 7.
10. The VHH antibody, composition or method according to any one of claims 1 to 9, wherein said at least one fungal species is a plant pathogenic fungus.
11. The VHH antibody, composition or method according to claim 10, wherein the genus of said plant pathogenic fungus is chosen from the group comprising Alternaria, Ascochyta, Botrytis, Cercospora, Colletotrichum, Diplodia, Erysiphe, Fusarium, Leptosphaeria, Gaeumanomyces, Helminthosporium, Macrophomina, Nectria, Penicillium, Peronospora, Phoma, Phymatotrichum, Phytophthora, Plasmopara, Podosphaera, Puccinia, Pyrenophora, Pyricularia, Pythium, Rhizoctonia, Scerotium, Sclerotinia, Septoria, Thielaviopsis, Uncinula, Venturia, Verticillium, Magnaporthe, Blumeria, Mycosphaerella, Ustilago, Melampsora, Phakospora, Monilinia, Mucor, Rhizopus, and Aspergillus.
12. The VHH antibody, composition or method according to claims 10 or 1 1 , where the plant pathogenic fungus is Botrytis cinerea.
13. A nucleic acid encoding the VHH antibody according to any one of claims 1 to 3, or the variant VHH antibody according to claim 4, or a nucleic acid according to any one of SEQ ID NOs: 1 , 10 to 40, 241 and 250 to 255, wherein preferably the codons are optimized for expression in a microorganism selected from the group consisting of Komagataella sp., Trichoderma sp., Aspergillus sp. and Bacillus sp.
14. A vector comprising the nucleic acid according to claim 13.
15. A host cell comprising a nucleic acid according to claim 13 or a vector according to claim 14.
16. A method for the manufacturing of a VHH antibody, comprising culturing the host cell according to claim 15 under conditions to induce expression of the VHH antibody, and optionally isolating and / or purifying the VHH antibody from the culture medium or fermentation broth.
17. A method for treating a plant comprising the step of applying a VHH antibody according to any one of claims 1 to 3 or 10 to 12, or an agrochemical composition according to any one of claims 6, 7 or 10 to 12, to the plant .
18. The method of claim 17, wherein the VHH antibody is applied at a concentration from 5 to 1 10 piM .
19. The method of claim 17 or 18, wherein said method comprises treating a plant field.
20. The method of claim 19, wherein the VHH antibody is applied at a concentration from 100g / ha to 400g / ha.
21. A method comprising applying a VHH antibody according to any one of claims 1 to 3 or 10 to 12, or an composition according to any one of claims 6, 7 or 10 to 12, to a surface.
22. The method of claim 21 , wherein said surface is the leaf of a plant.
23. The composition according to any one of claim 6, 7 or 10 to 12, further comprising at least one cell wall disrupting agent.
24. The composition according to claim 23, wherein at least one cell wall disrupting agent is an enzyme.
25. The composition according to claim 24, wherein the enzyme is a cell wall degrading enzyme.
26. The composition according to claim 24 or 25, wherein the enzyme is a glucanase and / or a chitinase.
Citation Information
Patent Citations
Cloning immunoglobulin variable domain sequences.
EP0368684A1
Antibody heavy chain variable domains against human dietary enzymes, and their uses
EP1134231A1
Method for superrapid transformation of monocotyledon
EP1198985A1
Method of constructing camel antibody library
EP1433793A1
Immunoglobulins devoid of light chains
WO1994004678A1
Cited By
Antifungal combinations
WO2026153969A1