Dual RAF and tubulin inhibitors and methods of use thereof

Abstract

Described herein are compounds of formula l-A that are dual RAF and tubulin inhibitors and their use in the treatment of disorders such as cancers.

Description

DUAL RAF AND TUBULIN INHIBITORS AND METHODS OF USE THEREOF CROSS-REFERENCE

[0001] This application claims priority to U.S. Provisional Application Number 63 / 614,180 filedDecember 22, 2023, the contents of which are incorporated herein by reference in their entireties. BACKGROUND

[0002] The BRAF V600X (i.e., V600E) mutant form of BRAF is known to be oncogenic, andthere are multiple BRAF inhibitors now marketed to inhibit the signaling of oncogenic BRAF V600E in melanoma and other cancers. BRAF V600E signals as a monomer and is constitutively active independent of upstream control by RAS. The marketed BRAF V600E inhibitors include vemurafenib, dabrafenib, and encorafenib.

[0003] Other than BRAF V600X mutants, almost all other oncogenic forms of BRAF signalthrough the formation of homodimers (BRAF-BRAF dimer) or heterodimers (e.g., BRAF-CRAF dimer) that are refractory to BRAF V600X inhibitors such as vemurafenib, dabrafenib, and encorafenib. Such dimers are formed in cancers driven by BRAF fusions, atypical BRAF mutations, or RAS mutant cancers.

[0004] Oncogenic BRAF fusions originate from genomic rearrangements placing the 3-primeportion of the BRAF gene encoding the kinase domain behind another gene at the 5-prime position. The rearrangements result in the expression of oncoproteins that express constitutive kinase activity due to loss of the N-terminal auto-inhibitory domain of BRAF resulting from the genomic rearrangements. These BRAF fusions exhibit constitutive kinase activity due to spontaneous dimerization and as such are capable of aberrant signaling in cancer cells independent of upstream effectors or regulatory mechanisms. Additionally, some 5-prime translocated rearrangement genes contribute the N-terminal domains to be capable of further inducing dimerization, thereby enhancing activating dimerization of the BRAF fusion protein kinase domain. Since the expression of these genomic rearrangements are controlled by the promoter of the 5-prime partner, often there is overexpression of the BRAF fusion transcript due to efficient or excessive promoter activity. BRAF fusions are among the most common kinase translocations in solid tumors. Since their first description in 2005 as oncogenes in papillary thyroid carcinoma, hundreds of tumors in which the BRAF kinase domain is fused to one of more than 110 different 5-prime partner genes have beenidentified across at least 15 different tumor types. BRAF fusions are found in papillary thyroidcarcinoma, astrocytomas, melanomas, and have also been identified in drug resistant EGFR mutantlung cancers. BRAF fusion proteins signal by dimerization in a RAS-independent manner and are resistant to many BRAF inhibitors such as vemurafenib and dabrafenib, that are not capable ofinhibiting both protomers of the signaling homodimer BRAF fusions. Rare CRAF fusion proteinshave also been demonstrated to be tumor drivers. Such CRAF fusion proteins signal as CRAF- CRAF homodimers.

[0005] Other so-called atypical BRAF mutations also lead to spontaneous dimerization andsignaling independent of RAS control. Like BRAF fusions, these atypical BRAF mutants signal as aberrant homodimers.

[0006] RAS mutant cancers comprise approximately 26-30% of all human cancers. RAS mutantcancers signal through the RAS^RAF^MEK^ERK MAPK signaling pathway. In this signaling cascade, kinase-inactive RAF monomers (comprising ARAF, BRAF, CRAF isoforms) are recruited to oncogenic RAS where RAS induces the formation of kinase-active signaling RAF dimers. A predominant RAF heterodimer that is recruited to mutant RAS is the wildtype BRAF / CRAF heterodimer.

[0007] A combinatorial siRNA screening approach identified RAF as a dominant node in RASmutant cancers, and that codepletion of both BRAF and CRAF, together with depletion of the autophagy gene ATG7, gave the best synthetic lethal inhibition of RAS mutant signaling, and additionally afforded the best therapeutic window for inhibiting signaling in RAS mutant cells versus normal, RAS wildtype cells. Additionally, it has been reported that inhibition of the RAF^MEK^ERK pathway in combination with autophagy-inhibiting agents effectively blocked RAS mutant cancer growth in vitro and in vivo.

[0008] Vertical inhibition of the RAF^MEK^ERK pathway through pan inhibition of RAF(specifically BRAF + CRAF) and ERK kinase activities were shown to illicit high synergy in blocking MAPK pathway signaling in KRAS-mutant pancreatic cancer cells, organoid studies, as well as in murine models of KRAS mutant pancreatic cancer. Vertical inhibition of RAF (BRAF + CRAF) and MEK kinase activities was also shown to be synergistic in KRAS mutant tumors.

[0009] The importance of inhibiting both BRAF and CRAF isoforms, as well as the requirementof inhibitor successfully binding to and inhibiting both protomers of signaling RAF dimers, hasbeen well demonstrated. Failure of a RAF inhibitor, especially BRAF V600X inhibitors, tosuccessfully bind to and inhibit both protomers of signaling RAF dimers in RAS mutant cancersleads to paradoxical pathway stimulation rather than the desired pathway inhibition. Such BRAF V600X inhibitors are contraindicated for the treatment of RAS mutant cancers.

[0010] There is a need to identify RAF inhibitors that can inhibit multiple RAF isoforms.Particularly, there is a need to identify RAF inhibitors that can inhibit both BRAF and CRAF isoforms. Especially, there is a need to identify RAF inhibitors that can inhibit both RAF protomers present in signaling BRAF / BRAF homodimers and both protomers in BRAF / CRAF heterodimers. Such pan RAF inhibitors find utility in the treatment of BRAF V600X driven cancers, atypicalBRAF mutated cancers, BRAF fusion cancers, CRAF fusion cancers, and RAS mutant cancers.

[0011] Microtubules (MTs), major components of cytoskeletons in eukaryotic cells, playessential roles in multiple cellular functions including maintenance of cell morphology, signal transmission, organelle trafficking, cell motility, cell division and mitosis. These cytoskeletalfilaments consist of α- and β-tubulin heterodimers. Microtubule dynamics (assembly anddisassembly) are essential for proper mitotic spindle function and completion of mitosis. This highly regulated process is driven by the hydrolysis of GTP on β-tubulin subunits. Thus, disruptionof MT dynamics is useful in anti-cancer therapy. Disruption of MT dynamics has beendemonstrated to exhibit anti-cancer activity in mutant RAS and mutant RAF driven tumors.

[0012] Microtubule targeting agents (MTAs) have antiangiogenic and vascular-disruptingeffects in addition to their other effects on cellular function. By affecting the microtubule network, MTAs inhibit endothelial cell proliferation, migration, and tube formation, and cause significantchanges in endothelial cell morphology. MTAs have also been evaluated as potential vasculardisrupting agents (VDAs). VDAs are known to primarily block the blood flow in solid tumors, leaving the blood vessels in normal tissues intact.

[0013] MTAs are classified in three main classes based on their α- or β-tubulin binding site.MTAs binding to the taxane site include the taxanes and the epothilones. These microtubule stabilizing agents bind to fully formed microtubules and prevent the depolymerization of tubulin subunits. In contrast, the vinca alkaloids interact with the tubulin vinca domain found in tubulin dimers and inhibit their polymerization into microtubules (microtubule-destabilizing agents). Colchicine and colchicine binding site inhibitors (CBSIs) interact at a distinct site on tubulin (atthe interface of the α- and β- subunit of the tubulin heterodimers) and define the third class ofantimitotic agents. Like the vinca alkaloids, these agents also act as microtubule-destabilizing agents.

[0014] Compounds altering microtubule function have proven to be highly active in patientswith cancer. The taxanes and vinca alkaloids are currently administered in a large variety of indications including solid tumors and hematological malignancies. There are currently no oral CBSI(s) approved as anti-cancer agents.

[0015] The major challenges of MTAs currently used clinically (the taxanes in particular)include systemic toxicity, acquired drug resistance, mode of administration limited to the intravenous route, poor water solubility requiring the use of surfactants for intravenousadministration with an associated risk of hypersensitivity reactions, and the recurrence of diseasewhen patients are treated in the advanced setting. The MTAs approved for clinical use suffer from dose limiting neurotoxicity and hematopoietic toxicity.

[0016] A common mechanism of multidrug resistance (MDR), namely ATP binding cassette(ABC) transporter protein-mediated drug efflux, limits taxanes’ efficacy. P-glycoproteins (P-gp,encoded by the MDRl gene) are important members of the ABC superfamily. P-gp prevents the intracellular accumulation of many cancer drugs by increasing their efflux out of cancer cells. Overexpression of MDR protein, common to most solid tumors, leads to treatment failure and uncontrolled disease progression. Other resistance mechanisms include the upregulation of drug export pump, multidrug resistance-associated protein 1 (MRP1), breast cancer resistance protein (BCRP), or altered expression of tubulin isotypes, and mutations in the β-tubulin gene.

[0017] Drug combinations involving agents with distinct anti-cancer mechanisms is commonlyused to enhance tumor response and patient survival, especially in the treatment of advanced cancer patients. There is a close interplay between RAS / MAPK pathway and microtubule- dependent MYC regulation pathways. For example, a large genetic loss-of-function siRNA screen identified TUBB3 (encoding ^III-tubulin isoform) as a top pancreatic cancer vulnerability. Genetic silencing of TUBB3 sensitized KRAS mutant pancreatic ductal adenocarcinoma (PDAC) cells to ERK inhibition, indicating that pharmacologic inhibition of proteins that support MYC expression (e.g., tubulin inhibitors) could be an effective therapeutic strategy to target mutant KRAS- dependent PDAC. TUBB3 is also of clinical relevance as overexpression of this β-tubulin isoform has been linked to poor response to microtubule-targeting drugs such as taxanes. Strong TUBB3 expression was most frequently found in various brain tumors, lung cancer, renal cell carcinoma, malignant melanoma, and PDAC. In addition, expression level of TUBB3 was altered in many cancer cells, where aberrant expression of TUBB3 was associated with enhanced chemoresistanceand poor prognosis in NSCLC, ovarian cancer, gastric cancer, breast cancer, and uterine serous carcinoma.

[0018] Tubulin disrupting agents have also been demonstrated to upregulate MAPK pathwaysignaling which limits their effectiveness. A dual targeting agent that inhibits MAPK pathwaysignaling in addition to targeting tubulin would overcome this MAPK pathway reactivation mechanism of resistance.

[0019] Dual targeted agents (single molecule interacting with two distinct biological targets) canalso offer advantage over combination therapies, and in particular lower risks of drug−drug interactions, more easily predictable pharmacokinetic (PK) profiles, simplification of dosage regimens and increase in patient compliance.

[0020] With the high resistance to current MAPK targeted therapeutic agents, identifying agentsthat exhibit BRAF inhibition and tubulin disruption has the potential to overcome BRAF inhibitorsresistance and significantly benefit patients harboring various solid tumors including ovarian,colorectal, and papillary thyroid cancers. Agents which inhibit BRAF and CRAF (so-called panRAF inhibitors) which also cause tubulin disruption will also potentially benefit patients harboring mutant RAS cancers, providing deeper and more durable anti-cancer efficacy. The compounds, composition, and methods of use described herein are directed toward this need. SUMMARY

[0021] Described herein, are compounds that are dual RAF and tubulin inhibitors, and methodsof use thereof.

[0022] In an embodiment, the present disclosure provides a compound represented by FormulaI-A:or a pharmaceuticallyp , , , omer thereof, wherein: X1and X4 are each independently selected from the group consisting of CH and N; X2 is selectedfrom the group consisting of N, CH, C-N(R4)-L-E, and N-L-E; X3 is selected from the groupconsisting of N, CH, C-Q-L-E, C-L-E, and N-L-E; Q is selected from the group consisting of Oand N(R4); X5 and X6 are each independently selected from the group consisting of CH, CF, andN; X7 and X9 are each independently selected from the group consisting of CH and N; X8 isselected from the group consisting of CR5 and N; provided that not more than two of X1, X2, X3,and X4 is N; provided that not more than one of X5 and X6 is N; provided that not more than oneof X7, X8, and X9 is N; provided that when X2 is N, X3 is C-Q-L-E, C-L-E, N, or CH; providedthat when X3 is N, X2 is N, CH, or C-N(R4)-L-E; R1 is selected from the group consisting of alkyl,H, halogen, and alkoxy; R2 is selected from the group consisting of H, halogen, haloalkyl, alkyl,cycloalkyl, and amine; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy,haloalkoxy, and halogen, or wherein two occurrences of R3are optionally taken together with the carbon atoms to which they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in the ring structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at each occurrence, with a substituent selected from the group consisting of alkyl,haloalkyl, alkoxy, CN, and halogen; R4 is selected from the group consisting of H and alkyl; R5 isselected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy,amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; L is selected from the groupconsisting of a direct bond and optionally substituted C1-C6alkyl; E is selected from the groupconsisting of H, alkyl, hydroxy, cycloalkyl, alkoxy, haloalkoxy, alkoxyalkyl, amine, heteroaryl,and optionally substituted heterocyclyl wherein the optionally substituted substituent, at eachoccurrence, is independently selected from the group consisting of alkyl, halogen, amine, hydroxy,and cyano; and m is 0, 1, 2, 3, or 4, provided that when X2 is N, X8 is CR5, and X7 and X9 are CH,R5is not N(CH3)2; when X2is N, X1, X3, and X4are CH, one of X7, X8, and X9is N and the other two remaining of X7, X8, and X9are CH, R2is not H; and when X7and X9are CH, X8is CR5, R2is H, R5 is CF3, X2 is N, and X1 and X4 are CH, X3 is no.

[0023] In another embodiment, described herein is a pharmaceutical composition comprising acompound described herein (e.g., a compound of the disclosure as described herein), or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, and a pharmaceutically acceptable carrier or excipient.

[0024] In another embodiment, described herein is a method of treating a cancer in a patient inneed thereof, comprising administering to the patient a therapeutically effective amount of a compound described herein (e.g., a compound of the disclosure as described herein), or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, or a composition described herein.

[0025] In another embodiment, described herein is a method of treating a disorder selected fromthe group consisting of histiocytosis, melanoma, multiple myeloma, thyroid cancer, ovarian cancer, colorectal cancer, colon cancer, pancreatic cancer, lung cancer, bladder cancer, gastrointestinal stromal tumors, solid tumors, brain cancers, gliomas, glioblastomas, astrocytomas, blood-borne cancers, hairy cell leukemia, acute myelogenous leukemia (AML), and other cancers caused by activation of the RAS^RAF^MEK^ERK signaling pathway in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound described herein (e.g., a compound of the disclosure as described herein), or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, or a composition described herein. BRIEF DESCRIPTION OF THE FIGURES

[0026] FIG.1 is a graph showing the maximum velocity of tubulin polymerization in the presenceof increasing concentrations of the known tubulin depolymerizer plinabulin.

[0027] FIG.2 is a graph showing the ratio of pellet (polymerized tubulin) to supernatant (tubulindimers) compared to the DMSO control for increasing concentrations of the known tubulindepolymerizer plinabulin. DETAILED DESCRIPTION

[0028] The features and other details of the disclosure will now be more particularly described.Certain terms employed in the specification, examples and appended claims are collected here. These definitions should be read in light of the remainder of the disclosure and as understood by a person of skill in the art. Unless defined otherwise, all technical and scientific terms used hereinhave the same meaning as commonly understood by a person of ordinary skill in the art.Definitions

[0029] The definitions set forth in this application are intended to clarify terms used throughoutthis application.

[0030] Unless defined otherwise, all technical and scientific terms used herein have the samemeaning as is commonly understood by one of skill in the art to which the subject matter hereinbelongs. As used in the specification and the appended claims, unless specified to the contrary, the following terms have the meaning indicated in order to facilitate the understanding of the present disclosure.

[0031] When a bond to a substituent is shown to cross a bond connecting two atoms in a ring,then such substituent may be bonded to any atom on the ring. When a substituent is listed withoutindicating the atom via which such substituent is bonded to the rest of the compound of a givenformula, then such substituent may be bonded via any atom in such substituent. Combinations of substituents, positions of substituents and / or variables are permissible only if such combinations result in stable compounds.

[0032] As used herein, the singular forms “a”, “an”, and “the” encompass plural references unlessthe context clearly indicates otherwise.

[0033] As used herein, the term “herein” means the entire application.

[0034] As used herein, “deuterated” mean that at least one hydrogen atom is replaced bydeuterium. In any sample of a deuterated compound, some discrete molecules of the compound will likely have hydrogen, rather than deuterium, at the specified position. However, the percent of molecules of the deuterated compound which have deuterium at the specified position will be much greater than would naturally occur. The deuterium at the deuterated position is enriched.

[0035] As used herein, the terms “optional” or “optionally” mean that the subsequently describedevent or circumstance may occur or may not occur, and that the description includes instanceswhere the event or circumstance occurs as well as instances in which it does not. For example, “optionally substituted alkyl” refers to the alkyl may be substituted as well as where the alkyl is not substituted.

[0036] It is understood that substituents and substitution patterns on the disclosed compoundscan be selected by one of ordinary skilled person in the art to result chemically stable compounds which can be readily synthesized by techniques known in the art, as well as those methods set forth below, from readily available starting materials. If a substituent is itself substituted with more than one group, it is understood that these multiple groups may be on the same carbon or on different carbons, so long as a stable structure result.

[0037] As used herein, the term “optionally substituted” refers to the replacement of one to sixhydrogen atoms in a given structure with the radical of a specified substituent including, but not limited to: hydroxyl, hydroxyalkyl, alkoxy, halogen, alkyl, aryl, cycloalkyl, heterocyclyl, amino, aminoalkyl, cyano, haloalkyl, haloalkoxy, -OC(=O)-CH2-Oalkyl. Preferably, “optionally substituted” refers to the replacement of one to four hydrogen atoms in a given structure with the substituents mentioned above. More preferably, one to three hydrogen atoms are replaced by the substituents as mentioned above. It is understood that the substituent can be further substituted.

[0038] As used herein, the term “substituted” refers to moieties having substituents replacing ahydrogen on one or more carbons of the backbone. It will be understood that “substitution” or “substituted with” includes the implicit proviso that such substitution is in accordance with permitted valence of the substituted atom and the substituent, and that the substitution results in a stable compound, e.g., which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, etc. As used herein, the term “substituted” is contemplated to include all permissible substituents of organic compounds. In a broad aspect, the permissible substituents include acyclic and cyclic, branched, and unbranched, carbocyclic and heterocyclic, aromatic and non-aromatic substituents of organic compounds. The permissible substituents can be one or more and the same or different for appropriate organic compounds. For purposes of this application, the heteroatoms such as nitrogen may have hydrogen substituents and / or any permissible substituents of organic compounds described herein which satisfy the valences of the heteroatoms.

[0039] Substituents can include any substituents described herein, for example, such substituents,if not otherwise specified, can include, for example, a halogen, a hydroxyl, a carbonyl (such as a carboxyl, an alkoxycarbonyl, a formyl, or an acyl), a thiocarbonyl (such as a thioester, a thioacetate, or a thioformate), an alkoxyl, a phosphoryl, a phosphate, a phosphonate, a phosphinate, an amino, an amido, an amidine, an imine, a cyano, a nitro, an azido, a sulfhydryl, an alkylthio, a sulfate, a sulfonate, a sulfamoyl, a sulfonamido, a sulfonyl, a heterocyclyl, an aralkyl, a heteroaralkyl, or an aromatic or heteroaromatic moiety. It will be understood by those skilled in the art that substituents can themselves be substituted, if appropriate. For instance, the substituents of a substituted alkyl may include substituted and unsubstituted forms of amino, azido, imino, amido, phosphoryl (including phosphonate and phosphinate), sulfonyl (including sulfate,sulfonamido, sulfamoyl and sulfonate), and silyl groups, as well as ethers, alkylthios, carbonyls(including ketones, aldehydes, carboxylates, and esters), -CF3, -CN, and the like. Unless specifically stated as “unsubstituted,” references to chemical moieties herein are understood to include substituted variants. For example, reference to an “aryl” group or moiety implicitly includes both substituted and unsubstituted variants.

[0040] As used herein, the term “alkyl” refers to a straight chained or branched non-aromatichydrocarbon which is completely saturated. Typically, a straight chained or branched alkyl group has from 1 to about 20 carbon atoms, preferably from 1 to about 10, e.g., may be C1-C10alkyl or e.g., C1-C6alkyl unless otherwise defined. Examples of straight chained and branched alkyl groups include, but are not limited to, methyl, ethyl, 1-propyl (n-propyl), 2-propyl, n-butyl, sec-butyl, tertbutyl, 1-pentyl, 2-pentyl, 3-pentyl, neo-pentyl, 1-hexyl, 2-hexyl, 3-hexyl, 1-heptyl, 2-heptyl, 3- heptyl, 4-heptyl, 1-octyl, 2-octyl, 3-octyl or 4-octyl and the like. Moreover, the term “alkyl” used throughout the specification, examples, and claims is intended to include both “unsubstituted alkyls” and “substituted alkyls”, the latter of which refers to alkyl moieties having substituents replacing a hydrogen on one or more carbons of the hydrocarbon backbone. The “alkyl” group may be optionally substituted.

[0041] The term “Cx-Cy” when used in conjunction with a chemical moiety, such as, acyl,acyloxy, alkyl, alkenyl, alkynyl, or alkoxy is meant to include groups that contain from x to y carbons in the chain. For example, the term “Cx-Cy” refers to substituted or unsubstituted saturated hydrocarbon groups, including straight-chain alkyl and branched-chain alkyl groups that contain from x to y carbons in the chain, including haloalkyl groups such as trifluoromethyl and 2,2,2- trifluoroethyl, etc. C0alkyl indicates a hydrogen where the group is in a terminal position, a bond if internal.

[0042] As used herein, the term “hydrocarbyl” refers to a group that is bonded through a carbonatom that does not have a =O or =S substituent, and typically has at least one carbon-hydrogen bond and a primarily carbon backbone but may optionally include heteroatoms. Thus, groups like methyl, ethoxyethyl, 2-pyridyl, and trifluoromethyl are considered to be hydrocarbyl for the purposes of this application, but substituents such as acetyl (which has a =O substituent on thelinking carbon) and ethoxy (which is linked through oxygen, not carbon) are not. Hydrocarbylgroups include, but are not limited to aryl, heteroaryl, carbocycle, heterocyclyl, alkyl, alkenyl, alkynyl, and combinations thereof. The “hydrocarbyl” group may be optionally substituted.

[0043] As used herein, the term “alkoxy” refers to a straight or branched, saturated aliphatic(alkyl) hydrocarbon radical bonded to an oxygen atom that is attached to a core structure. Preferably, alkoxy groups have one to six carbon atoms, i.e., may be C1-C6 alkoxy. Examples of alkoxy groups include but are not limited to methoxy, ethoxy, propoxy, isopropoxy, butoxy, isobutoxy, tert-butoxy, pentoxy, 3-methyl butoxy and the like. The “alkoxy” group may be optionally substituted.

[0044] As used herein, the term “alkoxyalkyl” refers to an alkyl group (as defined above)substituted with an alkoxy group and may be represented by the general formula alkyl-O-alkyl.Examples of alkoxyalkyl groups include but are not limited to methyl-O-ethylene-, ethyl-O- ethylene-. The “alkoxyalkyl” group may be optionally substituted.

[0045] As used herein, the term “haloalkyl” refers to alkyl group (as defined above) is substitutedwith one or more halogens. A monohaloalkyl radical, for example, may have a chlorine, bromine,iodine, or fluorine atom. Dihalo and polyhaloalkyl radicals may have two or more of the same ordifferent halogen atoms. Examples of haloalkyl include, but are not limited to, chloromethyl, dichloromethyl, trichloromethyl, dichloroethyl, dichloropropyl, fluoromethyl, difluoromethyl, trifluoromethyl, pentafluoroethyl, heptafluoropropyl, difluorochloromethyl, dichlorofluoromethyl, difluoroethyl, difluoropropyl, and the like. The “haloalkyl” group may be optionally substituted.

[0046] As used herein, the term “haloalkoxy” refers to radicals wherein one or more of thehydrogen atoms of the alkoxy group are substituted with one or more halogens. Representativeexamples of “haloalkoxy” groups include, but not limited to, difluoromethoxy (-OCHF2), trifluoromethoxy (-OCF3), or trifluoroethoxy (-OCH2CF3). The “haloalkoxy” group may be optionally substituted.

[0047] As used herein, the term “aryl” includes substituted or unsubstituted single-ring aromaticgroups in which each atom of the ring is carbon. Preferably the ring is a 5- to 7-membered ring,more preferably a 6-membered ring. The term “aryl” also includes polycyclic ring systems having two or more cyclic rings in which two or more carbons are common to two adjoining rings (fused rings) wherein at least one of the rings is aromatic. e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and / or heterocyclyls. The term “fused” means that the second ring is attached or formed by having two adjacent atoms in common with the first ring.The term “fused” is equivalent to the term “condensed”. Examples of aryl groups include but arenot limited to phenyl, naphthyl, phenanthryl, phenol, aniline, or indanyl and the like. Unless otherwise specified, all aryl groups described herein may be optionally substituted.

[0048] As used herein, the terms “polycyclyl”, “polycycle”, and “polycyclic” refer to two or morerings (e.g., cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and / or heterocyclyls) in which one or more atoms are common to two adjoining rings, e.g., the rings are “fused rings”. Each of the rings of the polycycle can be substituted or unsubstituted. In certain embodiments, each ring of the polycycle contains from 3 to 10 atoms in the ring, preferably from 5 to 7.

[0049] As used herein, the term “acyl” refers to a group -C(=O)-Rw wherein Rw is optionallysubstituted alkyl. Examples of “acyl” include, but are not limited to, instances where Rwis C1- C10alkyl (C1-C10acyl) or C1-C6-alkyl (C1-C6acyl). In some embodiments, each occurrence of the optionally substituted substituent is independently selected from the group consisting of H, OH, alkoxy, cyano, F, and amino. Additional examples of “acyl” include -C(=O)-CH3, -C(=O)-CH2- CH3, -C(=O)-CH2-CH2-CH3, or -C(=O)-CH(CH3)2.

[0050] As used herein, the term “formyl” refers to a group –C(=O)H.

[0051] As used herein, the term “sulfonamide” and “sulfonamido” is represented by:wherein Rx, Ryand Rz, at presents a hydrogen, optionallysubstituted hydrocarbyl group, or Rzgroups taken together with the N atom to which they areattached complete a heterocycle having from 4 to 8 atoms in the ring structure which may beoptionally substituted.

[0052] As used herein, the terms “amine” and “amino” refer to both unsubstituted and substitutedamines and salts thereof, e.g., a moiety that can be represented by: wherein Rzindependently repres bstituted hydrocarbyl group, orzR groups are taken together with the N atom to which they are attached complete a heterocyclehaving from 4 to 8 atoms in the ring structure which may be optionally substituted.

[0053] As used herein, the terms “amide” and “amido” each refer to a group represented by:wherein Rx, Ry, and Rzeac drogen or optionally substituted hydrocarbyl group, or Ryandg atom to which they are attached complete a heterocycle having from 4 to 8 atoms in the ring structure which may be optionally substituted.

[0054] As used herein, the term “amidine” refers to a group represented bywherein Rx, Ry, and Rzeach indepen ents a hydrogen or optionally substituted hydrocarbyl group, or Ry, and Rzgroups are taken together with the N atom to which they are attached complete a heterocycle having from 4 to 8 atoms in the ring structure which may be optionally substituted.

[0055] As used herein, the term “phosphine oxide” refers to a group represented by:wherein Rzeach independently repre ents a hydrogen or optionally substitutedhydrocarbyl group.

[0056] As used herein, the term “aminoalkyl” refers to an alkyl group substituted with an aminogroup.

[0057] As used herein, the term “amidoalkyl” refers to an alkyl group substituted with an amidogroup.

[0058] As used herein, the term “cyanoalkyl” refers to an alkyl group substituted with a cyanogroup.

[0059] As used herein, the term “alkylthio” refers to a thiol group substituted with an alkyl groupand may be represented by the general formula alkyl-S-.

[0060] As used herein, the term “thioalkyl” refers to an alkyl group substituted with a thiol group.

[0061] As used herein, the term “hydroxyalkyl” refers to an alkyl group substituted with ahydroxy group.

[0062] As used herein, the term “cycloalkyl” alone or in combination with other term(s) refers toa cyclic hydrocarbon which is completely saturated. “Cycloalkyl” includes monocyclic, bicyclic, and tricyclic rings. Typically, a monocyclic cycloalkyl group has from 3 to about 10 carbon atoms, more typically 3 to 8 carbon atoms (e.g., C3-C10cycloalkyl or e.g, C3-C6cycloalkyl unless otherwise defined. Examples of monocyclic cycloalkyls include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl and the like. The second ring of a bicyclic cycloalkyl or, the second or third rings of a tricyclic cycloalkyl, may be selected from saturated, unsaturated andaromatic rings. Cycloalkyl includes bicyclic and tricyclic molecules in which one, two or three ormore atoms are shared between the two rings. The term “fused cycloalkyl” refers to a bicyclic or tricyclic cycloalkyl in which each of the rings shares two adjacent atoms with the other ring. Thesecond ring of a fused bicyclic cycloalkyl or, the second or third rings of a fused tricycliccycloalkyl, may be selected from saturated, unsaturated, and aromatic rings. A “cycloalkenyl” group is a cyclic hydrocarbon containing one or more double bonds. Cycloalkyls can be furthersubstituted with alkyls, alkenyls, alkoxys, alkylthios, aminoalkyls, carbonyl-substituted alkyls, -CF3, -CN, and the like. A cycloalkyl may alternatively be polycyclic with more than two rings. Examples of polycyclic cycloalkyls include bridged, fused, and spirocyclic carbocyclyls.

[0063] As used herein, the term “cycloalkylalkyl” refers to an alkyl group substituted with acycloalkyl group.

[0064] As used herein, the terms “carbocycle,” or “carbocyclic” include bicyclic molecules inwhich one, two or three or more atoms are shared between the two rings. The term “fusedcarbocycle” refers to a bicyclic carbocycle in which each of the rings shares two adjacent atomswith the other ring. Each ring of a fused carbocycle may be selected from saturated, unsaturatedand aromatic rings. In an exemplary embodiment, an aromatic ring, e.g, phenyl, may be fused to a saturated or unsaturated ring, e.g, cyclohexane, cyclopentane, or cyclohexene. Any combination of saturated, unsaturated and aromatic bicyclic rings, as valence permits, is included in the definition of carbocyclic. Exemplary “carbocycles” include cyclopentane, cyclohexane, bicyclo[2.2.1]heptane, 1,5-cyclooctadiene, 1,2,3,4-tetrahydronaphthalene, bicyclo[4.2.0]oct-3-ene, naphthalene and adamantane. Exemplary fused carbocycles include decalin, 4,5- naphthalene,1,2,3,4-tetrahydronaphthalene, bicyclo[4.2.0]octane, 4,5,6,7-tetrahydro-lH-indene andbicyclo[4.1.0]hept-3-ene. “Carbocycles” may be substituted at any one or more positions capable of bearing a hydrogen atom.

[0065] As used herein, the term “cyano” refers to -CN group.

[0066] As used herein, the term “hydroxy” or “hydroxyl” refers to -OH group.

[0067] As used herein, the term “halo” or “halogen” alone or in combination with other term(s)means chloro, fluoro, bromo, and iodo.

[0068] As used herein, the term “heteroatom” refers an atom of any element other than carbon orhydrogen. Exemplary heteroatoms are nitrogen (N), oxygen (O), sulfur (S), and silicon (Si).

[0069] As used herein, the terms “heterocyclyl”, “heterocycloalkyl”, “heterocycle”, and“heterocyclic” refer to a non-aromatic, saturated or partially saturated, including monocyclic,polycyclic (e.g, bicyclic, tricyclic) bridged, or fused, ring system of 3 to 15 member having at leastone heteroatom or heterogroup selected from O, N, S, S(O), S(O)2, NH or C(O) with the remainingring atoms being independently selected from the group consisting of carbon, oxygen, nitrogen, and sulfur. Examples of “heterocyclyl” include, but are not limited to azetidinyl, oxetanyl, imidazolidinyl, pyrrolidinyl, oxazolidinyl, thiazolidinyl, pyrazolidinyl, tetrahydrofuranyl, piperidinyl, piperazinyl, tetrahydropyranyl, morpholinyl, thiomorpholinyl, 1,4-dioxanyl, dioxidothiomorpholinyl, oxapiperazinyl, oxapiperidinyl, tetrahydrofuryl, tetrahydropyranyl, tetrahydrothiophenyl, dihydropyranyl, indolinyl, indolinylmethyl, 2-azabicyclo[2.2.2]octanyl, azocinyl, chromanyl, xanthenyl and N-oxides thereof. Attachment of a heterocycloalkyl substituent can occur via either a carbon atom or a heteroatom. A heterocycloalkyl group can be optionally substituted with one or more suitable groups by one or more aforesaid groups.Preferably “heterocyclyl” refers to 5- to 6-membered ring selected from the group consisting ofazetidinyl, oxetanyl, imidazolidinyl, pyrrolidinyl, oxazolidinyl, thiazolidinyl, pyrazolidinyl, tetrahydrofuranyl, piperidinyl, piperazinyl, tetrahydropyranyl, morpholinyl, thiomorpholinyl, 1,4- dioxanyl and N-oxides thereof. More preferably, “heterocyclyl” includes azetidinyl, pyrrolidinyl, morpholinyl and piperidinyl. All heterocyclyl are optionally substituted by one or more aforesaid groups.

[0070] As used herein, the term “heteroaryl” refers to substituted or unsubstituted aromatic singlering structures, preferably 5- to 7-membered rings, more preferably 5- to 6-membered rings, whosering structures include at least one heteroatom, preferably one to four heteroatoms, more preferably one or two heteroatoms. The term “heteroaryl” also refers to substituted or unsubstituted aromaticor partly aromatic ring systems containing at least one heteroatom and having two or more cyclic rings (bicyclic, tricyclic, or polycyclic), containing 8 to 20 ring atoms, suitably 5 to 10 ring atoms, which may be linked covalently, or fused in which two or more atoms are common to two adjoining rings wherein at least one of the rings is heteroaromatic, e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and / or heterocyclyls. The rings maycontain an N or S atom, wherein the N or S atom is optionally oxidized, or the N atom is optionallyquaternized. All heteroaryls are optionally substituted. Any suitable ring position of the heteroaryl moiety may be covalently linked to a defined chemical structure. Examples of heteroaryl include, but are not limited to: furanyl, thienyl, pyrrolyl, pyrazolyl, imidazolyl, oxazolyl, cinnolinyl, isoxazolyl, thiazolyl, isothiazolyl, 1H-tetrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, pyridyl, pyrimidinyl, pyrazinyl, pyridazinyl, triazinyl, benzoxazolyl, benzisoxazolyl, benzothiazolyl, benzofuranyl, benzothienyl, benzotriazinyl, phthalazinyl, thianthrene, dibenzofuranyl, dibenzothienyl, benzimidazolyl, indolyl, isoindolyl, indazolyl, quinolinyl, isoquinolinyl, quinazolinyl, quinoxalinyl, purinyl, pteridinyl, 9H-carbazolyl, alpha-carboline, indolizinyl, benzoisothiazolyl, benzoxazolyl, pyrrolopyridyl, furopyridinyl, purinyl, benzothiadiazolyl, benzoxadiazolyl, benzotriazolyl, benzotriadiazolyl, 7-azaindolyl, 7-azaindazolyl, pyrrolopyridinyl, pyrrolopyrimidinyl, oxazolonepyridinyl, oxazolonepyrimidinyl, imidazolonepyridinyl, imidazolonepyrimidinyl, pyrazolopyridinyl, pyrazolopyrimidinyl, tetrahydronaphthyridinyl, tetrahydropyridolpyriminyl, dihydronaphthyridinonyl, naphthyridinonyl, oxazinanonepyridinyl, oxazinanonepyrimidinyl, carbazolyl, dibenzothienyl, acridinyl and the like.

[0071] As used herein, the terms “sulfone” or “sulfonyl” refer to the group -S(O)2-R6d whereinR6drepresents an optionally substituted hydrocarbyl.

[0072] As used herein, within a ring, refers to a single or double bond, as valency permitsand which results in the formation of a stable ring moiety.

[0073] A “combination therapy” is a treatment that includes the administration of two or moretherapeutic agents, e.g., a compound of the disclosure and a MAPK pathway inhibitor, to a patient in need thereof.

[0074] “Disease,” “disorder,” and “condition” are used interchangeably herein.

[0075] “Individual,” “patient,” or “subject” are used interchangeably and include any animal,including mammals, preferably mice, rats, other rodents, rabbits, dogs, cats, swine, cattle, sheep,horses, or primates, and most preferably humans. The compounds described herein can be administered to a mammal, such as a human, but can also be administered to other mammals such as an animal in need of veterinary treatment, e.g., domestic animals (e.g., dogs, cats, and the like), farm animals (e.g., cows, sheep, pigs, horses, and the like) and laboratory animals (e.g., rats, mice, guinea pigs, and the like).

[0076] The MAPK pathway as used herein is the signal transduction pathway comprisingRAS^RAF^MEK^ERK.

[0077] A “MAPK pathway inhibitor” is an inhibitor of the MAP kinase signaling pathway.Inhibitors of this pathway include RAS inhibitors (e.g., AMG-510, MRTX 849), RAF inhibitors (e.g., dabrafenib, vemurafenib, LY3009120, encorafenib), MEK inhibitors (e.g., trametinib, binimetinib, selumetinib, cobimetinib), and ERK inhibitors (e.g., ulixertinib, SCH772984, LY3214996, ERAS-007). The terms “MAPK pathway inhibitor” and “MAPK kinase inhibitor” are used interchangeably herein.

[0078] “Pharmaceutically or pharmacologically acceptable” include molecular entities andcompositions that do not produce an adverse, allergic, or other untoward reaction when administered to an animal, or a human, as appropriate. For human administration, preparations should meet sterility, pyrogenicity, and general safety and purity standards as required by FDA Office of Biologics standards.

[0079] The term “pharmaceutically acceptable carrier” or “pharmaceutically acceptableexcipient” as used herein refers to any and all solvents, dispersion media, coatings, isotonic andabsorption delaying agents, and the like, that are compatible with pharmaceutical administration.The use of such media and agents for pharmaceutically active substances is well known in the art. The compositions may also contain other active compounds providing supplemental, additional, or enhanced therapeutic functions.

[0080] The term “pharmaceutical composition” as used herein refers to a composition comprisingat least one compound as disclosed herein formulated together with one or more pharmaceutically acceptable carriers.

[0081] The term “pharmaceutically acceptable salt(s)” as used herein refers to salts of acidic orbasic groups that may be present in compounds used in the compositions. Compounds included in the present compositions that are basic in nature are capable of forming a wide variety of salts with various inorganic and organic acids. The acids that may be used to prepare pharmaceuticallyacceptable acid addition salts of such basic compounds are those that form non-toxic acid addition salts, i.e., salts containing pharmacologically acceptable anions, including, but not limited to, malate, oxalate, chloride, bromide, iodide, nitrate, sulfate, bisulfate, phosphate, acid phosphate, isonicotinate, acetate, lactate, salicylate, citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonateand pamoate (i.e., 1,1'-methylene-bis-(2- hydroxy-3-naphthoate)) salts. Compounds included inthe present compositions that are acidic in nature are capable of forming base salts with various pharmacologically acceptable cations. Examples of such salts include alkali metal or alkaline earth metal salts, particularly calcium, magnesium, sodium, lithium, zinc, potassium, and iron salts. Compounds included in the present compositions that include a basic or acidic moiety may also form pharmaceutically acceptable salts with various amino acids. The compounds of the disclosure may contain both acidic and basic groups; for example, one amino and one carboxylic acid group. In such a case, the compound can exist as an acid addition salt, a zwitterion, or a base salt.

[0082] The compounds of the disclosure may contain one or more chiral centers and, therefore,exist as stereoisomers. The term “stereoisomers” when used herein consist of all enantiomers or diastereomers. These compounds may be designated by the symbol “R” or “S,” depending on the configuration of substituents around the stereogenic carbon atom, but the skilled artisan will recognize that a structure may denote a chiral center implicitly. These compounds may also be designated by “(+)” and “(-)” based on their optical rotation properties. The presently described compounds encompasses various stereoisomers of these compounds and mixtures thereof.Mixtures of enantiomers or diastereomers may be designated by the symbol “(±)” in nomenclature,but the skilled artisan will recognize that a structure may denote a chiral center implicitly.

[0083] In the present specification, the term “therapeutically effective amount” means the amountof the subject compound that will elicit the biological or medical response of a tissue, system or animal, (e.g., mammal or human) that is being sought by the researcher, veterinarian, medical doctor or other clinician. The compounds described herein are administered in therapeutically effective amounts to treat a disorder.

[0084] “Treating” includes any effect, e.g., lessening, reducing, modulating, or eliminating, thatresults in the improvement of the condition, disease, disorder, and the like.

[0085] The disclosure also embraces isotopically labeled compounds which are identical to thoserecited herein, except that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature. Examples of isotopes that can be incorporated into the disclosed compounds include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine, and chlorine, such as2H,3H,13C,14C,15N,18O, 17O, 31P, 32P, 35S, 18F, and 36Cl, respectively. For example, a compound of the disclosure mayhave one or more H atom replaced with deuterium.

[0086] Individual enantiomers and diastereomers of the disclosed compounds can be preparedsynthetically from commercially available starting materials that contain asymmetric or stereogenic centers, or by preparation of racemic mixtures followed by resolution methods well known to those of ordinary skill in the art. These methods of resolution are exemplified by (1) attachment of a mixture of enantiomers to a chiral auxiliary, separation of the resulting mixture of diastereomers by recrystallization or chromatography and liberation of the optically pure product from the auxiliary, (2) salt formation employing an optically active resolving agent, (3) direct separation of the mixture of optical enantiomers on chiral liquid chromatographic columns or (4) kinetic resolution using stereoselective chemical or enzymatic reagents. Racemic mixtures can also be resolved into their component enantiomers by well-known methods, such as chiral-phase liquid chromatography or crystallizing the compound in a chiral solvent. Stereoselective syntheses, a chemical or enzymatic reaction in which a single reactant forms an unequal mixture of stereoisomers during the creation of a new stereocenter or during the transformation of a pre-existing one, are well known in the art. Stereoselective syntheses encompass both enantio- anddiastereoselective transformations and may involve the use of chiral auxiliaries. For examples, see Carreira and Kvaerno, Classics in Stereoselective Synthesis, Wiley-VCH: Weinheim, 2009.

[0087] As used herein, “compounds of the disclosure”, comprise compounds of Formula I-A,Formula I-B, Formula I-C, Formula I-D, Formula I-E, Formula I-F, Formula I-G, Formula I-H,Formula I-J, Formula I-K, Formula I-L, Formula I-M, or a pharmaceutically acceptable salt,enantiomer, stereoisomer, or tautomer thereof. Compounds

[0088] In some embodiments, provided herein is a compound represented by Formula I-A:or a pharmaceuticallyacceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:X1 and X4 are each independently selected from the group consisting of CH and N;X2 is selected from the group consisting of N, CH, C-N(R4)-L-E, and N-L-E;X3 is selected from the group consisting of N, CH, C-Q-L-E, C-L-E, and N-L-E;Q is selected from the group consisting of O and N(R4);X5and X6are each independently selected from the group consisting of CH, CF, and N; X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than two of X1, X2, X3, and X4is N; provided that not more than one of X5and X6is N; provided that not more than one of X7, X8, and X9is N; provided that when X2is N, X3is C-Q-L-E, C-L-E, N, or CH; provided that when X3is N, X2is N, CH, or C-N(R4)-L-E; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R2 is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, andamine; R3is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, and halogen, or wherein two occurrences of R3are optionally taken together with the carbon atoms to which they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in the ring structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at each occurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN, and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl;L is selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, and cyano; andm is 0, 1, 2, 3, or 4, provided that when X2is N, X8is CR5, and X7and X9are CH, R5is not N(CH3)2; when X2is N, X1, X3, and X4are CH, one of X7, X8, and X9is N and the other two remaining of X7, X8, and X9are CH, R2is not H; and when X7and X9are CH, X8is CR5, R2is H, R5is CF3, X2is N, and X1and X4are CH, X3.in is a compound represented by Formula I-B:(R3)mR1R2or a pharmaceuticallymer thereof, wherein:X1 and X4 are each independently selected from the group consisting of CH and N;X2 is selected from the group consisting of N, CH, C-N(R4)-L-E, and N-L-E;X3 is selected from the group consisting of N, CH, C-Q-L-E, C-L-E, and N-L-E;Q is selected from the group consisting of O and N(R4);X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than one of X3 and X4 is N;provided that not more than one of X7, X8, and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy;R2is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, and amine; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X2is N, X8is CR5, and X7and X9are CH, R5is not N(CH3)2; when X2is N, X1, X3, and X4are CH, one of X7, X8, and X9is N and the other two remaining of X7, X8, and X9are CH, R2is not H; and when X7and X9are CH, X8is CR5, R2is H, R5is CF3, X2is N, and X1and X4are CH, X3is not .[0009in is a compound represented by Formula I-C:Formula I-Cor a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:X3 is selected from the group consisting of N, CH, C-Q-L-E, C-L-E, and N-L-E;Q is selected from the group consisting of O and N(R4);X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than one of X7, X8, and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R2is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, and amine; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X8is CR5and X7and X9are CH, R5is not N(CH3)2; when X1, X3, and X4are CH, one of X7, X8, and X9is N and the other two remaining of X7, X8, and X9are CH, R2is not H; andwhen X7and X9are CH, X8is CR5, R2is H, R5is CF3, and X1and X4are CH, X3is not r.d herein is a compound represented by Formula I-D:or a pharmaceuticaler thereof, wherein:Q is selected from the group consisting of O and N(R4);X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than one of X7, X8, and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R2is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, and amine; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl;E is selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X8is CR5and X7and X9are CH, R5is not N(CH3)2; and when X7and X9are CH, X8is CR5, R2is H, R5is CF3, and X1and X4are CH, Q-L-E is not .ovided herein is a compound represented by Formula I-E:or a pharmaceuticaller thereof, wherein:X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than one of X7, X8, and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R2is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, and amine; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen;R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; andm is 0, 1, 2, 3, or 4; provided that when X8is CR5and X7and X9are CH, R5is not N(CH3)2; and when one of X7, X8, and X9is N and the other two remaining of X7, X8, and X9are CH, R2is not H.

[0093] In some embodiments, provided herein is a compound represented by Formula I-F:or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:X1 and X4 are each independently selected from the group consisting of CH and N;X2 is selected from the group consisting of N, CH, C-N(R4)-L-E, and N-L-E;X3 is selected from the group consisting of N, CH, C-Q-L-E, C-L-E, and N-L-E;Q is selected from the group consisting of O and N(R4);X5and X6are each independently selected from the group consisting of CH, CF, and N; X7 and X9 are each independently selected from the group consisting of CH and N;provided that not more than two of X1, X2, X3, and X4is N; provided that not more than one of X5and X6is N; provided that not more than one of X7and X9is N; provided that when X2is N, X3is C-Q-L-E, C-L-E, N, or CH; provided that when X3is N, X2is N, CH, or C-N(R4)-L-E; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X2is N, and X7and X9are CH, R5is not N(CH3)2; when X2is N, X1, X3, and X4are CH, one of X7and X9is N and the other of X7and X9isCH, R5 is not H; andwhen X7and X9are CH, R5is CF3, X2is N, and X1and X4are CH, X3is n ,.ents, provided herein is a compound represented by Formula I-G:or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:X3 is selected from the group consisting of N, CH, C-Q-L-E, C-L-E, and N-L-E;Q is selected from the group consisting of O and N(R4);X7 and X9 are each independently selected from the group consisting of CH and N;provided that not more than one of X7and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5 is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl;L is selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X2is N, and X7and X9are CH, R5is not N(CH3)2; when X2is N, X1, X3, and X4are CH, one of X7and X9is N and the other of X7and X9is CH, R5is not H; and when X7 and X9 are CH, and R5 is CF3, X3 is n.

[0095] In some embodiments, provided herein is a compound represented by Formula I-H:or a pharmaceuticall mer thereof, wherein:Qis selected from the group consisting of O and N(R4);X7 and X9 are each independently selected from the group consisting of CH and N;provided that not more than one of X7and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X7and X9are CH, R5is not N(CH3)2;when X7 and X9 are CH and R5 is CF3, Q-L-E is not or.

[0096] In some embodiments, provided herein is a compound represented by Formula I-J:or a pharmaceutically mer thereof, wherein:X7 and X9 areeach independently selected from the group consisting of CH and N;provided that not more than one of X7and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; andm is 0, 1, 2, 3, or 4; provided that when X7and X9are CH, R5is not N(CH3)2; and when one of X7and X9is N and the other of X7and X9is CH, R5is not H.

[0097] In some embodiments, provided herein is a compound represented by Formula I-K:or a pharmaceuticall er thereof, wherein:Q is selectedrom t e group cons st ng o O and N( );R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4.

[0098] In some embodiments, provided herein is a compound represented by Formula I-L:or a pharmaceuticall er thereof, wherein:R1is selectedrom t e group cons st ng o a y , , a ogen, an alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms inthe ring structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, ateach occurrence, with a substituent selected from the group consisting of alkyl, haloalkyl,alkoxy, CN, and halogen; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; andm is 0, 1, 2, 3, or 4.

[0099] In some embodiments, provided herein is a compound represented by Formula I-M:or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen;R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; andm is 0, 1, 2, 3, or 4.[000100] In some embodiments, X1 is CH.[000101] In some embodiments, X2 is N.[000102] In some embodiments, X3 is selected from the group consisting of N, CH, C-O-L-E,and C-N(R4)-L-E.[000103] In some embodiments, X3 is selected from the group consisting of N and CH.[000104] In some embodiments, X3 is selected from the group consisting of C-O-CH(R4)-CH2-OH and C-NH-CH(R4)-CH2-OH.[000105] In some embodiments, X5 is CH.[000106] In some embodiments, the ring containing X2, X3, X4, and X5 is selected from thegroup consisting of:s1 s2 s1 s2 s1 N s2 s1 s2 s1 s2N 2 , s2,indicates attachment to the ring comprising X5and X6.[000107] In some embodiments, X5 is CH.[000108] In some embodiments, X6 is CH.[000109] In some embodiments, X7 is N.[000110] In some embodiments, X8 is CR5.[000111] In some embodiments, R5 is selected from the group consisting of alkyl, cycloalkyl,haloalkyl and halogen.[000112] In some embodiments, X9 is CH.[000113] In some embodiments, R1 is selected from the group consisting of alkyl and halogen.[000114] In some embodiments, R1 is selected from the group consisting of methyl.[000115] In some embodiments, R2 is selected from the group consisting of H, halogen, alkyl,alkoxy, amine, and haloalkyl.[000116] In some embodiments, R2 is selected from the group consisting of trifluoromethyl andH.[000117] In some embodiments, R3 is selected from the group consisting of H, alkyl, haloalkyl,alkoxy, haloalkoxy, and halogen, or wherein two occurrences of R3are optionally taken together with the carbon atoms to which they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in the ring structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at each occurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN, and halogen.[000118] In some embodiments, the ring containing (R3)m is selected the group consisting of:., g g g isting of:.[000120] In some embodiments, the ring containing (R3)m .[000121] In some embodiments, R4 is H.[000122] In some embodiments, R5 is selected from the group consisting of H, alkyl, alkenyl,alkoxy, amine, amide, haloalkyl, cycloalkyl, phosphine oxide, halogen, haloalkoxy, cyano, and cyanoalkyl.[000123] In some embodiments, R5 is selected from the group consisting of H, trifluoromethyl,isopropyl, cyclopropyl, cyclobutyl, alkenyl, cyano, chloro, brom ,., m the group consisting of trifluoromethyl,cyclopropyl, .[000125] Indiments, R5 is trifluoromethyl.[000126] In some embodiments, L is optionally substituted C1-C6alkyl.[000127] In some embodiments, L is selected from the group consisting of[000128] In some embodiments, L is selected from the group consisting of.[000129] In some embodiments, E selected from the group consisting of H, methyl, cyclopropyl,and hydroxy.[000130] In some embodiments, the compound is selected from the group consisting of:Methods of Treatment[000131] Compounds described herein (e.g., compounds of Formula I-A, Formula I-B, FormulaI-C, Formula I-D, Formula I-E, Formula I-F, Formula I-G, Formula I-H, Formula I-J, Formula I- K, Formula I-L, Formula I-M, or a pharmaceutically acceptable salt, enantiomer, stereoisomer, ortautomer thereof) can act as dual RAF and tubulin inhibitors and are therefore useful in thetreatment of diseases and disorders in patients in need thereof, such as cancer. Exemplary cancersinclude, but are not limited to, melanoma, multiple myeloma, thyroid cancer, ovarian cancer, colorectal cancer, colon cancer, pancreatic cancer, lung cancer, bladder cancer, gastrointestinal stromal tumors, solid tumors, blood-borne cancers, acute myelogenous leukemia (AML), or othercancers caused by activation of the RAS^RAF^MEK^ERK signaling pathway. In someembodiments, a cancer described herein is a BRAF V600X driven cancer, an atypical BRAFmutated cancer, a BRAF fusion cancer, a CRAF fusion cancer, or a RAS mutant cancer. In someembodiments, the cancer has a BRAF oncogenic mutation. In some embodiments, the cancer hasa RAS oncogenic mutation. In some embodiments, the cancer has an NRAS oncogenic mutation.In some embodiments, the NRAS oncogenic mutation is RAS Q61R or Q61K mutation. In some embodiments, the cancer has a KRAS oncogenic mutation. In some embodiments, the KRAS oncogenic mutation is KRAS G12D, KRAS G12V, KRAS G12C, KRAS G12R, or KRAS G13D.In some embodiments, the cancer has a NF1 oncogenic mutation. In some embodiments, the lungcancer is non-small lung cancer (NSCL). In some embodiments, the colorectal cancer is colon cancer. In some embodiments, the colorectal cancer is rectal cancer.[000132] The compounds provided herein may be administered to patients (animals and humans)in need of such treatment in dosages that will provide optimal pharmaceutical efficacy. It will be appreciated that the dose required for use in any particular application will vary from patient to patient, not only with the particular compound or composition selected, but also with the route of administration, the nature of the condition being treated, the age and condition of the patient, concurrent medication or special diets then being followed by the patient, and other factors which those skilled in the art will recognize, with the appropriate dosage ultimately being at the discretionof the attendant physician. For treating clinical conditions and diseases noted above, a compoundprovided herein may be administered orally, subcutaneously, topically, parenterally, by inhalation spray or rectally in dosage unit formulations containing conventional non-toxic pharmaceuticallyacceptable carriers, adjuvants and vehicles. Parenteral administration may include subcutaneousinjections, intravenous or intramuscular injections or infusion techniques.[000133] Treatment can be continued for as long or as short a period as desired. The compositionsmay be administered on a regimen of, for example, one to four or more times per day. A suitabletreatment period can be, for example, at least about one week, at least about two weeks, at leastabout one month, at least about six months, at least about 1 year, or indefinitely. A treatment periodcan terminate when a desired result is achieved. Combination Therapy[000134] Compounds described herein, e.g., a compound of Formula I-A, Formula I-B, FormulaI-C, Formula I-D, Formula I-E, Formula I-F, Formula I-G, Formula I-H, Formula I-J, Formula I-K, Formula I-L, Formula I-M, or a pharmaceutically acceptable salt, enantiomer, stereoisomer, ortautomer thereof, can be administered in combination with one or more additional therapeuticagents to treat a disorder described herein, such as a cancer described herein. For example,provided in the present disclosure is a pharmaceutical composition comprising a compounddescribed herein, e.g., a compound of Formula I-A, Formula I-B, Formula I-C, Formula I-D,Formula I-E, Formula I-F, Formula I-G, Formula I-H, Formula I-J, Formula I-K, Formula I-L,Formula I-M, or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, one or more additional therapeutic agents, and a pharmaceutically acceptable excipient. In some embodiments, a compound of Formula I-A, Formula I-B, Formula I-C, Formula I-D, Formula I-E, Formula I-F, Formula I-G, Formula I-H, Formula I-J, Formula I-K, Formula I-L, Formula I-M,or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, and one additional therapeutic agent is administered. In some embodiments, a compound of Formula I-A, Formula I-B, Formula I-C, Formula I-D, Formula I-E, Formula I-F, Formula I-G, Formula I-H,Formula I-J, Formula I-K, Formula I-L, Formula I-M, or a pharmaceutically acceptable salt,enantiomer, stereoisomer, or tautomer thereof, and two additional therapeutic agents are administered. In some embodiments, a compound of Formula I-A, Formula I-B, Formula I-C, Formula I-D, Formula I-E, Formula I-F, Formula I-G, Formula I-H, Formula I-J, Formula I-K, Formula I-L, Formula I-M, or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, and three additional therapeutic agents are administered. Combination therapy can be achieved by administering two or more therapeutic agents, each of which is formulated and administered separately. For example, a compound of Formula I-A, Formula I-B, Formula I-C, Formula I-D, Formula I-E, Formula I-F, Formula I-G, Formula I-H, Formula I-J, Formula I-K, Formula I-L, Formula I-M, or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, and an additional therapeutic agent can be formulated and administered separately. Combination therapy can also be achieved by administering two or more therapeutic agents in a single formulation, for example a pharmaceutical composition comprising a compound of Formula I-A, Formula I-B, Formula I-C, Formula I-D, Formula I-E, Formula I-F, Formula I-G,Formula I-H, Formula I-J, Formula I-K, Formula I-L, Formula I-M, or a pharmaceuticallyacceptable salt, enantiomer, stereoisomer, or tautomer thereof, as one therapeutic agent and one or more additional therapeutic agents such as a MAPK pathway inhibitor or chemotherapeutic agent. For example, a compound of Formula I-A, Formula I-B, Formula I-C, Formula I-D, Formula I-E,Formula I-F, Formula I-G, Formula I-H, Formula I-J, Formula I-K, Formula I-L, Formula I-M, ora pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, and anadditional therapeutic agent can be administered in a single formulation. Other combinations arealso encompassed by combination therapy. While the two or more agents in the combinationtherapy can be administered simultaneously, they need not be. For example, administration of afirst agent (or combination of agents) can precede administration of a second agent (or combinationof agents) by minutes, hours, days, or weeks. Thus, the two or more agents can be administeredwithin minutes of each other or within 1, 2, 3, 6, 9, 12, 15, 18, or 24 hours of each other or within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14 days of each other or within 2, 3, 4, 5, 6, 7, 8, 9, or weeks of each other. In some cases, even longer intervals are possible. While in many cases it is desirable that the two or more agents used in a combination therapy be present in within the patient's body at the same time, this need not be so.[000135] Combination therapy can also include two or more administrations of one or more of theagents used in the combination using different sequencing of the component agents. For example, if agent X and agent Y are used in a combination, one could administer them sequentially in any combination one or more times, e.g., in the order X-Y-X, X-X-Y, Y-X-Y, Y-Y-X, X-X-Y-Y, etc.[000136] In some embodiments, compounds described herein are combined with other agentsincluding MAPK pathway inhibitors. In some embodiments, the other agent is an inhibitor of RAS.In some embodiments, the other agent is an inhibitor of RAS. In some embodiments, the otheragent is an inhibitor of oncogenic KRAS. In some embodiments, the other agent is an inhibitor ofKRAS G12C. In some embodiments, the other agent is an inhibitor of RAS. In some embodiments,the other agent is an inhibitor of KRAS G12D. In some embodiments, the other agent is a MEKinhibitor. In some embodiments the other agent is an ERK inhibitor.[000137] In some embodiments, compounds described herein are combined with animmunomodulatory agent. In some embodiments, the immunomodulatory enhances the adaptiveimmune response. In some embodiments, the immunomodulatory enhances the activity of antigen-presenting cells. In some embodiments, the immunomodulatory agent enhances the anti-tumoractivity of myeloid cells including macrophages. In some embodiments, the immunomodulatory enhances the anti-tumor activity of Natural Killer cells. In some embodiments, the immunomodulatory agent enhances the activity of effector T Cells, including cytotoxic T Cells.[000138] In some embodiments, the one or more additional therapeutic agents that may beadministered in combination with a compound provided herein can be a MAPK pathway inhibitor. Such MAPK pathway inhibitors include, for example, MEK inhibitors, ERK inhibitors, and Ras inhibitors.[000139] Exemplary MEK inhibitors include, but are not limited to, trametinib, selumetinib,cobimetinib, binimetinib, and pharmaceutically acceptable salts thereof. Exemplary ERKinhibitors include, but are not limited to, include, but are not limited to, ulixertinib, SCH772984, LY3214996, ravoxertinib, VX-11e, ASN-007, GDC-0994, MK-8353, ASTX-029, LTT462, KO-947, and pharmaceutically acceptable salts thereof. Exemplary Ras inhibitors include, but are notlimited to, AMG-510, MRTX849, ARS-1620, ARS-3248, LY3499446, and pharmaceutically acceptable salts thereof.[000140] In some embodiments, the additional therapeutic agents can be immunomodulatoryagents including but not limited to anti-PD-1 or anti-PD-L1 therapeutics including pembrolizumab, nivolumab, pidilizumab, cemiplimab, atezolizumab, durvalumab, BMS-936559,or avelumab. In some embodiments, the additional therapeutic agents can be anti-TIM3 (anti-HAVcr2) therapeutics including but not limited to TSR-022 or MBG453, anti-LAG3 therapeuticsincluding but not limited to relatlimab, LAG525, or TSR-033, anti-4-1BB (anti-CD37, anti-TNFRSF9), CD40 agonist therapeutics including but not limited to SGN-40, CP-870,893 orRO7009789, anti-CD47 therapeutics including but not limited to Hu5F9-G4, anti-CD20 therapeutics, anti-CD38 therapeutics, STING agonists including but not limited to ADU-S100,MK-1454, ASA404, or amidobenzimidazoles. In some embodiments, the additional therapeuticagents can be anti-CTLA4 agents including ipilimumab, tremelimumab. In some embodiments,the additional therapeutic agents can be hypomethylating agents including but not limited to azacytidine or decitabine, other immunomodulatory therapeutics including but not limited to epidermal growth factor inhibitors, statins, metformin, angiotensin receptor blockers, thalidomide, lenalidomide, pomalidomide, prednisone, or dexamethasone. In some embodiments, the additional therapeutic agents can be immunotherapeutic agents including targeted therapeutic agents, cancer vaccines, and CAR-T cell therapy.[000141] The compounds described herein may be administered in combination with othertherapeutic agents known to treat cancers. Such other therapeutic agents include radiation therapy,anti-tubulin agents, DNA alkylating agents, DNA synthesis-inhibiting agents, DNA intercalating agents, anti-estrogen agents, anti-androgens, steroids, anti-EGFR agents, kinase inhibitors, mTOR inhibitors, PI3 kinase inhibitors, cyclin-dependent kinase inhibitors, CDK4 / CDK6 kinase inhibitors, topoisomerase inhibitors, Histone Deacetylase (HDAC) inhibitors, DNA methylation inhibitors, anti-HER2 agents, anti-angiogenic agents, proteasome inhibitors, PARP (poly ADP ribose polymerase) inhibitors, cell cycle regulating kinase inhibitors, thalidomide, lenalidomide, antibody-drug-conjugates (ADCs).[000142] In an embodiment, the additional therapeutic agents can be chemotherapeutic agentsincluding but not limited to an anti-tubulin agents (for example, paclitaxel, paclitaxel protein- bound particles for injectable suspension including but not limited to nab-paclitaxel, eribulin, docetaxel, ixabepilone, vincristine, auristatins, or maytansinoids), vinorelbine, DNA-alkylating agents (including but not limited to cisplatin, carboplatin, oxaliplatin, cyclophosphamide, ifosfamide, temozolomide), DNA intercalating agents or DNA topoisomerase inhibitors (including but not limited to anthracyclines such as doxorubicin, pegylated liposomal doxorubicin, daunorubicin, idarubicin, mitoxantrone, or epirubicin, camptothecins such as topotecan, irinotecan, or exatecan), 5-fluorouracil, capecitabine, cytarabine, decitabine, 5-aza cytadine, gemcitabine and methotrexate.[000143] In some embodiments, the additional therapeutic agents can be kinase inhibitorsincluding but not limited to erlotinib, gefitinib, neratinib, afatinib, osimertinib, lapatanib, crizotinib, brigatinib, ceritinib, alectinib, lorlatinib, everolimus, temsirolimus, abemaciclib, LEE011, palbociclib, cabozantinib, ripretinib, sunitinib, pazopanib, sorafenib, regorafenib,sunitinib, axitinib, dasatinib, imatinib, nilotinib, idelalisib, ibrutinib, BLU-667, Loxo 292,larotrectinib, and quizartinib,[000144] In some embodiments, the additional therapeutic agents can be anti-estrogen agentsincluding but not limited to tamoxifen, fulvestrant, anastrozole, letrozole, and exemestane, anti- androgen agents including but not limited to abiraterone acetate, enzalutamide, nilutamide, bicalutamide, flutamide, cyproterone acetate, steroid agents including but not limited to prednisone and dexamethasone, PARP inhibitors including but not limited to neraparib, olaparib, talazoparib, and rucaparib, topoisomerase I inhibitors including but not limited to irinotecan, camptothecin, exatecan, and topotecan, topoisomerase II inhibitors including but not limited to anthracyclines, etoposide, etoposide phosphate, and mitoxantrone, Histone Deacetylase (HDAC) inhibitorsincluding but not limited to vorinostat, romidepsin, panobinostat, valproic acid, and belinostat,DNA methylation inhibitors including but not limited to DZNep and 5-aza-2′-deoxycytidine, proteasome inhibitors including but not limited to bortezomib and carfilzomib, biological agents including but not limited to trastuzumab, ado-trastuzumab, pertuzumab, cetuximab, and panitumumab.[000145] In some embodiments, the additional therapeutic agents can be anti-angiogenic agentsincluding but not limited to bevacizumab, rebastinib, aflibercept, and AMG386.[000146] In some embodiments, the additional therapeutic agents can be antibody-drug-conjugates (ADCs) including but not limited to ADCs containing DM1, DM4, MMAE, MMAF,or camptothecin payloads, brentuximab vedotin and trastuzumab emtansine, radiotherapy, therapeutic vaccines including but not limited to sipuleucel-T.[000147] In some embodiments, the additional therapeutic agent can be autophagy inhibitors,inhibitors of vesicular trafficking, including but not limited to ULK inhibitors such as ULK1 inhibitors, ULK2 inhibitors, ULK1 / ULK2 inhibitors, VPS34 inhibitors, PPT1 inhibitors, orlysosomal blocking agents. In some embodiments, the additional therapeutic agent can be DCC-3116, SAR405, SB02024, hydroxychloroquine, chloroquine, and LYS05.[000148] In some embodiments, the additional therapeutic agent can be EGFR inhibitorsincluding, but not limited to, cetuximab, osimertinib, and afatinib, and pharmaceutically acceptable salts thereof.[000149] In some embodiments, the additional therapeutic agent is selected from a luteinizinghormone-releasing hormone (LHRH) analog, including goserelin and leuprolide.[000150] In some embodiments, the additional therapeutic agent is selected from the groupconsisting of selected from the group consisting of everolimus, trabectedin, abraxane, TLK 286, AV-299, DN-101, pazopanib, GSK690693, RTA 744, ON 0910.Na, AZD 6244 (ARRY-142886), AMN-107, TKI-258, GSK461364, AZD 1152, enzastaurin, vandetanib, ARQ-197, MK-0457,MLN8054, PHA-739358, R-763, AT-9263, pemetrexed, erlotinib, dasatanib, nilotinib, decatanib,panitumumab, amrubicin, oregovomab, Lep-etu, nolatrexed, AZD 2171, batabulin, of atumtunab,zanolimumab, edotecarin, tetrandrine, rubitecan, tesmilifene, oblimersen, ticilimumab, ipilimumab, gossypol, Bio 111, 131-I-TM-601, ALT-110, BIO 140, CC 8490, cilengitide, gimatecan, IL13-PE38QQR, INO 1001, IPdR1 KRX-0402, lucanthone, LY 317615, neuradiab,vitespan, RTA 744, alanosine (SDX 102), talampanel, atrasentan, XR 311, romidepsin, ADS-100380, sunitinib, 5-fluorouracil, vorinostat, etoposide, gemcitabine, doxorubicin, irinotecan, liposomal doxorubicin, 5'-deoxy-5-fluorouridine, vincristine, temozolomide, ZK-304709,seliciclib, PD0325901, AZD-6244, capecitabine, L-Glutamic acid, N-[4-[2-(2-amino-4,7-dihydro-4-oxo-1H-pyrrolo[2,3-d]pyrimidin-5-yl)- ethyl]benzoyl]-, disodium salt, heptahydrate,camptothecin, PEG-labeled irinotecan, tamoxifen, toremifene citrate, anastrazole, exemestane, letrozole, DES(diethylstilbestrol), estradiol, estrogen, conjugated estrogen, bevacizumab, IMC- 1C11, CHIR-258, 3-[5-(methylsulfonylpiperadinemethyl)-indolylj-quinolone, vatalanib, AG-013736, AVE-0005, goserelin acetate, leuprolide acetate, triptorelin pamoate, medroxyprogesterone acetate, hydroxyprogesterone caproate, megestrol acetate, raloxifene,bicalutamide, flutanide, nilutamide, megestrol acetate, CP-724714, TAK-165, HKI-272, erlotinib,lapatanib, canertinib, ABX-EGF antibody, erbitux, EKB-569, PKI-166, GW-572016, ionafarnib,BMS-214662, tipifarnib, amifostine, NVP-LAQ824, suberoyl analide hydroxamic acid, valproicacid, trichostatin A, FK-228, SU11248, sorafenib, KRN951, aminoglutethimide, arnsacrine, anagrelide, L-asparaginase, Bacillus Calmette-Guerin (BCG) vaccine, bleomycin, buserelin, busulfan, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, diethylstilbestrol, epirubicin, fludarabine, fludrocortisone, fluoxymesterone, flutamide, gemcitabine, gleevac, hydroxyurea, idarubicin, ifosfamide, imatinib, leuprolide, levamisole, lomustine, mechlorethamine, melphalan, 6- mercaptopurine, mesna, methotrexate, mitomycin, mitotane, mitoxantrone, nilutamide, octreotide, oxaliplatin, pamidronate, pentostatin, plicamycin, porfimer, procarbazine, raltitrexed, rituximab,streptozocin, teniposide, testosterone, thalidomide, thioguanine, thiotepa, tretinoin, vindesine, 13-cis-retinoic acid, phenylalanine mustard, uracil mustard, estramustine, altretamine, floxuridine, 5- deooxyuridine, cytosine arabinoside, 6-mecaptopurine, deoxycoformycin, calcitriol, valrubicin, mithramycin, vinblastine, vinorelbine, topotecan, razoxin, marimastat, COL-3, neovastat, BMS- 275291, squalamine, endostatin, SU5416, SU6668, EMD121974, interleukin-12, IM862, angiostatin, vitaxin, droloxifene, idoxyfene, spironolactone, finasteride, cimitidine, trastuzumab, denileukin diftitox, gefitinib, bortezimib, irinotecan, topotecan, doxorubicin, docetaxel, vinorelbine, bevacizumab (monoclonal antibody) and erbitux, cremophor-free paclitaxel, epithilone B, BMS-247550, BMS-310705, droloxifene, 4-hydroxytamoxifen, pipendoxifene, ERA-923, arzoxifene, fulvestrant, acolbifene, lasofoxifene, idoxifene, TSE-424, HMR-3339, ZK186619, PTK787 / ZK 222584, VX-745, PD 184352, rapamycin, 40-O-(2-hydroxyethyl)- rapamycin, temsirolimus, AP-23573, RAD001, ABT-578, BC-210, LY294002, LY292223, LY292696, LY293684, LY293646, wortmannin, ZM336372, L-779450, PEG-filgrastim, darbepoetin, erythropoietin, granulocyte colony-stimulating factor, zolendronate, prednisone, cetuximab, granulocyte macrophage colony-stimulating factor, histrelin, pegylated interferon alfa- 2a, interferon alfa-2a, pegylated interferon alfa-2b, interferon alfa-2b, azacitidine, PEG-L- asparaginase, lenalidomide, gemtuzumab, hydrocortisone, interleukin-11, dexrazoxane, alemtuzumab, all-transretinoic acid, ketoconazole, interleukin-2, megestrol, immune globulin,nitrogen mustard, methylprednisolone, ibritgumomab tiuxetan, androgens, decitabine, hexamethylmelamine, bexarotene, tositumomab, arsenic trioxide, cortisone, editronate, mitotane, cyclosporine, liposomal daunorubicin, Edwina-asparaginase, strontium 89, casopitant, netupitant, an NK-1 receptor antagonist, palonosetron, aprepitant, diphenhydramine, hydroxyzine, metoclopramide, lorazepam, alprazolam, haloperidol, droperidol, dronabinol, dexamethasone, methylprednisolone, prochlorperazine, granisetron, ondansetron, dolasetron, tropisetron, pegfilgrastim, erythropoietin, epoetin alfa and darbepoetin alfa, ipilumumab, and mixtures thereof.Pharmaceutical Compositions and Kits[000151] Another aspect of this disclosure provides pharmaceutical compositions comprisingcompounds as disclosed herein formulated together with a pharmaceutically acceptable carrier. In particular, the present disclosure provides pharmaceutical compositions comprising a compoundas disclosed herein (e.g., a compound of Formula I-A, Formula I-B, Formula I-C, Formula I-D,Formula I-E, Formula I-F, Formula I-G, Formula I-H, and Formula I-J, Formula I-K, Formula I-L, Formula I-M, or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomerthereof) formulated together with one or more pharmaceutically acceptable carriers. These formulations include those suitable for oral, rectal, topical, buccal, parenteral (e.g., subcutaneous, intramuscular, intradermal, or intravenous) rectal, vaginal, or aerosol administration, although the most suitable form of administration in any given case will depend on the degree and severity of the condition being treated and on the nature of the particular compound being used. For example, disclosed compositions may be formulated as a unit dose, and / or may be formulated for oral or subcutaneous administration.[000152] Exemplary pharmaceutical compositions may be used in the form of a pharmaceuticalpreparation, for example, in solid, semisolid or liquid form, which contains one or more of the compounds described herein, as an active ingredient, in admixture with an organic or inorganic carrier or excipient suitable for external, enteral or parenteral applications. The active ingredient may be compounded, for example, with the usual non-toxic, pharmaceutically acceptable carriers for tablets, pellets, capsules, suppositories, solutions, emulsions, suspensions, and any other form suitable for use. The active object compound is included in the pharmaceutical composition in an amount sufficient to produce the desired effect upon the process or condition of the disease.[000153] For preparing solid compositions such as tablets, the principal active ingredient may bemixed with a pharmaceutical carrier, e.g., conventional tableting ingredients such as corn starch,lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound provided herein, or a non-toxic pharmaceutically acceptable salt thereof. When referring to these preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that thecomposition may be readily subdivided into equally effective unit dosage forms such as tablets,pills, and capsules.[000154] In solid dosage forms for oral administration (capsules, tablets, pills, dragees, powders,granules and the like), the subject composition is mixed with one or more pharmaceuticallyacceptable carriers, such as sodium citrate or dicalcium phosphate, and / or any of the following:(1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and / or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose and / or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar- agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodiumcarbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such asquaternary ammonium compounds; (7) wetting agents, such as, for example, acetyl alcohol and glycerol monostearate; (8) absorbents, such as kaolin and bentonite clay; (9) lubricants, such a talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof; and (10) coloring agents. In the case of capsules, tablets and pills, the compositions may also comprise buffering agents. Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.[000155] A tablet may be made by compression or molding, optionally with one or more accessoryingredients. Compressed tablets may be prepared using binder (for example, gelatin orhydroxypropylmethyl cellulose), lubricant, inert diluent, preservative, disintegrant (for example,sodium starch glycolate or cross-linked sodium carboxymethyl cellulose), surface-active or dispersing agent. Molded tablets may be made by molding in a suitable machine a mixture of the subject composition moistened with an inert liquid diluent. Tablets, and other solid dosage forms, such as dragees, capsules, pills and granules, may optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the pharmaceutical- formulating art.[000156] Compositions for inhalation or insufflation include solutions and suspensions inpharmaceutically acceptable, aqueous, or organic solvents, or mixtures thereof, and powders. Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs. In addition to the subject composition, the liquid dosage forms may contain inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3- butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, cyclodextrins and mixtures thereof.[000157] Suspensions, in addition to the subject composition, may contain suspending agents as,for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.[000158] Formulations for rectal or vaginal administration may be presented as a suppository,which may be prepared by mixing a subject composition with one or more suitable non-irritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the body cavity and release the active agent.[000159] Dosage forms for transdermal administration of a subject composition include powders,sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants. The active component may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants which may be required.[000160] The ointments, pastes, creams and gels may contain, in addition to a subject composition,excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulosederivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixturesthereof.[000161] Powders and sprays may contain, in addition to a subject composition, excipients suchas lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances. Sprays may additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.[000162] Compositions and compounds of the present disclosure may alternatively beadministered by aerosol. This is accomplished by preparing an aqueous aerosol, liposomal preparation or solid particles containing the compound. A non-aqueous (e.g., fluorocarbon propellant) suspension could be used. Sonic nebulizers may be used because they minimize exposing the agent to shear, which may result in degradation of the compounds contained in thesubject compositions. Ordinarily, an aqueous aerosol is made by formulating an aqueous solutionor suspension of a subject composition together with conventional pharmaceutically acceptable carriers and stabilizers. The carriers and stabilizers vary with the requirements of the particular subject composition, but typically include non-ionic surfactants (Tweens, Pluronics, or polyethylene glycol), innocuous proteins like serum albumin, sorbitan esters, oleic acid, lecithin, amino acids such as glycine, buffers, salts, sugars or sugar alcohols. Aerosols generally are prepared from isotonic solutions.[000163] Pharmaceutical compositions of the present disclosure suitable for parenteraladministration comprise a subject composition in combination with one or more pharmaceutically- acceptable sterile isotonic aqueous or non-aqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.[000164] Examples of suitable aqueous and non-aqueous carriers which may be employed in thepharmaceutical compositions provided herein include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate and cyclodextrins. Proper fluidity may be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.[000165] In another embodiment, provided are enteral pharmaceutical formulations including adisclosed compound and an enteric material, and a pharmaceutically acceptable carrier or excipient thereof. Enteric materials refer to polymers that are substantially insoluble in the acidic environment of the stomach, and that are predominantly soluble in intestinal fluids at specific pHs. The small intestine is the part of the gastrointestinal tract (gut) between the stomach and the largeintestine, and includes the duodenum, jejunum, and ileum. The pH of the duodenum is about 5.5, the pH of the jejunum is about 6.5 and the pH of the distal ileum is about 7.5.[000166] Accordingly, enteric materials are not soluble, for example, until a pH of about 5.0, ofabout 5.2, of about 5.4, of about 5.6, of about 5.8, of about 6.0, of about 6.2, of about 6.4, of about6.6, of about 6.8, of about 7.0, of about 7.2, of about 7.4, of about 7.6, of about 7.8, of about 8.0,of about 8.2, of about 8.4, of about 8.6, of about 8.8, of about 9.0, of about 9.2, of about 9.4, of about 9.6, of about 9.8, or of about 10.0. Exemplary enteric materials include cellulose acetate phthalate (CAP), hydroxypropyl methylcellulose phthalate (HPMCP), polyvinyl acetate phthalate (PVAP), hydroxypropyl methylcellulose acetate succinate (HPMCAS), cellulose acetate trimellitate, hydroxypropyl methylcellulose succinate, cellulose acetate succinate, cellulose acetate hexahydrophthalate, cellulose propionate phthalate, cellulose acetate maleate, cellulose acetate butyrate, cellulose acetate propionate, copolymer of methylmethacrylic acid and methylmethacrylate, copolymer of methyl acrylate, methylmethacrylate and methacrylic acid, copolymerof methylvinyl ether and maleic anhydride (Gantrez ES series), ethyl methyacrylate- methylmethacrylate-chlorotrimethylammonium ethyl acrylate copolymer, natural resins such as zein, shellac and copal collophorium, and several commercially available enteric dispersion systems (e.g., Eudragit L30D55, Eudragit FS30D, Eudragit L100, Eudragit S100, Kollicoat EMM30D, Estacryl 30D, Coateric, and Aquateric). The solubility of each of the above materials is either known or is readily determinable in vitro. The foregoing is a list of possible materials, but one of skill in the art with the benefit of the disclosure would recognize that it is not comprehensive and that there are other enteric materials that would meet the objectives described herein.[000167] Advantageously, provided herein are kits for use by a e.g., a consumer in need oftreatment of cancer. Such kits include a suitable dosage form such as those described above and instructions describing the method of using such dosage form to mediate, reduce or prevent inflammation. The instructions would direct the consumer or medical personnel to administer the dosage form according to administration modes known to those skilled in the art. Such kits could advantageously be packaged and sold in single or multiple kit units. An example of such a kit is a so-called blister pack. Blister packs are well known in the packaging industry and are being widely used for the packaging of pharmaceutical unit dosage forms (tablets, capsules, and the like). Blisterpacks generally consist of a sheet of relatively stiff material covered with a foil of a preferablytransparent plastic material. During the packaging process recesses are formed in the plastic foil.The recesses have the size and shape of the tablets or capsules to be packed. Next, the tablets or capsules are placed in the recesses and the sheet of relatively stiff material is sealed against the plastic foil at the face of the foil which is opposite from the direction in which the recesses were formed. As a result, the tablets or capsules are sealed in the recesses between the plastic foil and the sheet. Preferably the strength of the sheet is such that the tablets or capsules can be removed from the blister pack by manually applying pressure on the recesses whereby an opening is formed in the sheet at the place of the recess. The tablet or capsule can then be removed via said opening.[000168] It may be desirable to provide a memory aid on the kit, e.g., in the form of numbers nextto the tablets or capsules whereby the numbers correspond with the days of the regimen which the tablets or capsules so specified should be ingested. Another example of such a memory aid is a calendar printed on the card, e.g., as follows “First Week, Monday, Tuesday, ... etc.... Second Week, Monday, Tuesday, ... ” etc. Other variations of memory aids will be readily apparent. A “daily dose” can be a single tablet or capsule or several pills or capsules to be taken on a givenday. Also, a daily dose of a first compound can consist of one tablet or capsule while a daily doseof the second compound can consist of several tablets or capsules and vice versa. The memory aid should reflect this. EXAMPLES[000169] The compounds described herein can be prepared in a number of ways based on theteachings contained herein and synthetic procedures known in the art. In the description of the synthetic methods described below it is to be understood that all proposed reaction conditions, including choice of solvent, reaction atmosphere, reaction temperature, duration of the experimentand workup procedures, can be chosen to be the conditions standard for that reaction, unlessotherwise indicated. It is understood by one skilled in the art of organic synthesis that the functionality present on various portions of the molecule should be compatible with the reagents and reactions proposed. Substituents not compatible with the reaction conditions will be apparent to one skilled in the art, and alternate methods are therefore indicated. The starting materials for the examples are either commercially available or are readily prepared by standard methods from known materials.[000170] The following abbreviation are used in this disclosure and have the following definitions:“ADP” is adenosine diphosphate, “ AgNO3” is silver nitrate, “aq” is aqueous, “ATP” is adenosinetriphosphate, “Ar” is argon gas, “B2pin2” is 4,4,4',4',5,5,5',5'-octamethyl-2,2'-bi(1,3,2-dioxaborolane), “BAST” is bis(2-metoxyethyl)aminosulfur trifluorides, “BINAP” is 2,2′-bis(diphenylphosphino)-1,1′-binaphthyl, “Boc” is tert-butylcarbonate, “BSA” is bovine serumalbumin, “CaCl2” is calcium chloride, “cataCXium A-Pd-G2” is chloro[(di(1-adamantyl)-N-butylphosphine)-2-(2-aminobiphenyl)]palladium(II), “CDCl3” is chloroform-deuterium,“Cs2CO3” is cesium carbonate, “DAST” is diethylaminosulfur trifluoride, “DCE” is 1,2- dichloroethane, “DCM” is dichloromethane, “DIEA” is N,N-diisopropylethylamine, “DMF” is N,N-dimethylformamide, “dppf” is 1,1′-bis(diphenylphosphino)ferrocene, “DMSO-d6” isdimethylsulfoxide-deuterium, “DSC” is N,N′-Disuccinimidyl carbonate, “DTT” is dithiothreitol,“EDC” is 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide, “ESI” is electrospray ionization,“EtOAc” is ethyl acetate, “EtOH” is ethanol, “GST” is glutathione S-transferase, “h” is hour or hours, “HATU” is hexafluorophosphate azabenzotriazole tetramethyl uronium, “H2” is hydrogengas, “HCl” is hydrochloric acid, “H2O” is water, “H2O2” is hydrogen peroxide, “HOBT” is 1H-benzo[d][1,2,3]triazol-1-ol, “HPLC” is high performance liquid chromatography, “IC50” is halfmaximal inhibitory concentration, “iso-PrOH” is isopropyl alcohol, “K2CO3” is potassiumcarbonate, “LiHMDS” is lithium bis(trimethylsilyl)amide, “LiOH” is lithium hydroxide, “MeCN”is acetonitrile, “MeOH” is methanol, “MgSO4” is magnesium sulfate, “MHz” is megahertz, “min” is minute or minutes, “MS” is mass spectrometry, “m / z” is mass / charge number, “NADH” is nicotinamide adenine dinucleotide, “NaH” is sodium hydride, “NaHCO3” is sodium bicarbonate, “Na2CO3” is sodium carbonate, “NaOAc” is sodium acetate, “Na2SO4” is sodium sulfate, “NH4Cl”is ammonium chloride, “NH4OH” is ammonium hydroxide, “NMP” is N-methylpyrrolidone,“NMR” is nuclear magnetic resonance, “PBS” is phosphate buffered saline, “Pd” is palladium,“Pd-C” is palladium on carbon, “Pd2(dba)3” is Tris(dibenzylideneacetone)dipalladium(0), “pet-ether” is Petroleum ether, “PPh3” is triphenyl phosphine, “rt” is room temperature which is alsoknown as “ambient temp,” which will be understood to consist of a range of normal laboratorytemperatures ranging from 15-25 °C, “sat’d.” is saturated, “SFC” is supercritical fluidchromatography, “SM” is starting material, “SNAr” is nucleophilic aromatic substitution, “T3P” is1-propanephosphonic acid anhydride, “TBDMS” is tert-butyldimethylsilyl, “TCFH” is N,N,N',N'-tetramethylchloroformamidinium hexafluorophosphate, “TEA” is triethylamine, “tert-BuONa” issodium tert-butoxide, “TFA” is trifluoroacetic acid, “THF” is tetrahydrofuran, “TLC’ is thin layerchromatography, “Tris” is tris(hydroxymethyl)aminomethane, and “Xantphos” is 4,5-bis(diphenylphosphino)-9,9-dimethylxanthene. General Chemistry[000171] Exemplary compounds described herein are available by the general synthetic methodsillustrated in the Schemes below, intermediate preparations, and the accompanying Examples. Synthetic Schemes Scheme 11-1(commercially available or synthesized by those skilled in the art) react with carboxylic acids 1-5(commercially available or synthesized by those skilled in the art) to afford amides 1-2.Compounds 1-2 upon borylation provide boronates 1-4. Borylation is a well-documented reactionto those skilled in the art (for example, Pd (0) catalyzed reaction with B2pin2). Alternatively,boronates 1-4 can be prepared by an amide coupling reaction of 1-3 (commercially available orsynthesized by Pd-catalyzed borylation from 1-1) with carboxylic acids 1-5 in the presence ofcoupling reagents such as HATU, T3P, and EDC. Scheme 2, , , d 2-7d. Commercially available compounds 2-1 react with various morpholines (commerciallyavailable or synthesized by those skilled in the art) by SNAr reaction in the presence of base toobtain 2-2. Compounds 2-2 (Y = F) react with alcohols E-L-OH or amines E-L-N(R4)H by SNArreaction in the presence of base to afford 2-4 (Q = O, N(R4)). In another embodiment, compounds2-1 react with alcohols E-L-OH or amines E-L-N(R4)H by SNAr reaction in the presence of basesuch as DIEA, K2CO3, or NaH to afford 2-3 (Q = O, N(R4)). In a similar manner, SNAr reaction of2-3 with various morpholines (commercially available or synthesized by those skilled in the art)affords 2-4 (Q = O, N(R4)). Finally, treatment of iodides 2-4 with boronates 1-3 in the presence ofa palladium catalyst (Suzuki reaction) affords 2-7a (X3 = C-O-L-E), 2-7b (X3 = C-N(R4)-L-E),respectively. Intermediates 2-7c (X3 = CH) and 2-7d (X3 = C-alkyl) can be prepared by Suzukireaction of 2-2 (Y = H, alkyl) with boronates 1-3. In another embodiment, boronates 2-5 react withbromides 1-1 under Suzuki conditions to afford 2-6 which can be reacted with various morpholines(commercially available or synthesized by those skilled in the art) by SNAr reaction in the presenceof base to obtain 2-7c (X3 = CH) and 2-7d (X3 = C-alkyl).Scheme 3. entof 2,6-difluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine, 3-1 with bromides 1-1 inthe presence of a palladium catalyst (Suzuki coupling) affords 3-2. Compounds 3-2 react withvarious morpholines (commercially available or synthesized by those skilled in the art) by SNArreaction in the presence of base to provide 3-3. Nitro reduction of 3-3 under mild reducingconditions (zinc or iron metal with ammonium chloride) affords 3-5. In another embodiment, SNArreaction of 3-2 with alcohols E-L-OH or amines E-L-N(R4)H in the presence of base such as DIEA,K2CO3, or NaH provides 3-4. Nitro reduction of 3-4 under mild reducing conditions (zinc or ironmetal with ammonium chloride) affords 3-6. Finally, amide coupling reaction of each 3-5 and 3-6with carboxylic acids 1-5 (commercially available or synthesized by those skilled in the art) affords3-7 and 3-8, respectively.Scheme 4NArreaction of 2,4,6-trichloropyridine 4-1 with various morpholines (commercially available orsynthesized by those skilled in the art) affords 4-2. Chlorides 4-2 react with Molander salts,boronates or boronic acids Y-B(OR)2 under Suzuki conditions to afford 4-3 which can be reducedif needed. Finally, Suzuki reaction of 4-3 with boronates 1-3 affords 4-4.Scheme 5ofintermediates 5-3. 4,6-Dichloropyrimidine 5-1 reacts with various morpholines (commerciallyavailable or synthesized by those skilled in the art) in the presence of base to afford 5-2. Treatmentof 5-2 with boronates 1-3 in the presence of a palladium catalyst (Suzuki reaction) affords 5-3.Scheme 6[ ] c eme us ra es an exemp ary prepara on o pyr m ne n erme a es - (Q = O,N(R4)).2,4,6-Trichloropyrimidine 6-1 reacts with various morpholines (commercially available orsynthesized by those skilled in the art) in the presence of a base (SNAr reaction) to afford a mixtureof intermediates 6-2a and 6-2b, which can be separated by SFC purification, crystallization, orchromatography. Compounds 6-2a react with alcohols (E-L-OH) or amines (E-L-N(R4)H) bySNAr reaction to obtain 6-3 (Q= O, N(R4)). Intermediates 6-3 react with boronates 1-3 in thepresence of a palladium catalyst (Suzuki reaction) to afford 6-4 (Q = O, N(R4)).Scheme 7d 7-2b. SNAr reaction of 6-2b (scheme 6) with alcohols (E-L-OH) or amines (E-L-N(R4)H) affords amixture of 7-1a (Q = O, N(R4)), and 7-1b (Q = O, N(R4)), which can be separated by a suitablemethod (for example: SFC purification, column chromatography or recrystallization. Finally, eachintermediate 7-1a, and 7-1b reacts with boronates 1-3 in the presence of a palladium catalyst(Suzuki reaction) to afford 7-2a, and 7-2b, respectively.Scheme 8[] n a s m ar manner as sc eme , sc eme ustrates an exemp ary preparat on ofintermediates 8-3. 5-Bromo-3-chloropyridazine 8-1 reacts with various morpholines(commercially available or synthesized by those skilled in the art) in the presence of base to afford8-2. Treatment of 8-2 with boronates 1-3 in the presence of a palladium catalyst (Suzuki reaction)affords 8-3. Scheme 9. 1-Bromo-3-iodobenzene, 9-1 (X1, X3 = CH, and Y = I) reacts with various morpholines(commercially available or synthesized by those skilled in the art) by Buchwald-Hartwigamination (Pd-catalyzed coupling conditions: Pd2(dba)3, BINAP, tert-BuONa) to provide 9-2a. Ina similar manner, Buchwald-Hartwig amination of 3-bromo-5-iodopyridine 9-1 (X1 = CH, X3 =N, and Y = I) with various morpholines (commercially available or synthesized by those skilled inthe art) affords 9-2b. SNAr reaction of 2,6-dibromopyrazine, 9-1 (X1, X3 = N, and Y = Br) withvarious morpholines (commercially available or synthesized by those skilled in the art) affords 9-2c. Each intermediate 9-2a, 9-2b, and 9-2c reacts with boronates 1-3 in the presence of a palladiumcatalyst (Suzuki reaction) to afford intermediates 9-3a (X1, X3 = CH), 9-3b (X1 = CH, X3 = N),and 9-3c (X1, X3 = N), respectively.Scheme 1010-4b, 10-4c, and 10-4d. SNAr reaction of 2-bromo-4,6-dichloropyrimidine 10-1 with alcohols (E-L-OH) or amines (E-L-N(R4)H) affords 10-3 (Q = O, N(R4)) which can be reacted with boronates 1-4 in the presence of a palladium catalyst (Suzuki reaction) to afford 10-4a (-O-L-E) and 10-4b (-N(R4)-L-E), respectively. In another embodiment, 2,6-dichloro-N-methylpyrimidin-4-amine 10-2reacts with boronates 1-4 under Suzuki reaction conditions to afford a mixture of 10-4c and 10-4dwhich can be separated by a suitable method (for example: SFC purification, columnchromatography or recrystallization. Scheme 11ndsof Formula I can be prepared by (1) Suzuki reaction of A (2-2, 2-4, 4-2a, 4-2b, 4-2c, 5-2, 6-3, 7-1a, 7-1b, 8-2, 9-2a, 9-2b, and 9-2c) with boronates 1-4, and (2) a typical amide coupling reactionof B (2-7a, 2-7b, 2-7c, 2-7d, 4-3a, 4-3b, 4-3c, 5-3, 6-4, 7-2a, 7-2b, 8-3, 9-3a, 9-3b, and 9-3c) withcarboxylic acids 1-5 (commercially available or synthesized by those skilled in the art), (3) SNArof 3-7 with alcohols E-L-OH or amines E-L-N(R4)H (commercially available or synthesized bythose skilled in the art), (4) SNAr of 3-8 with various morpholines (commercially available orsynthesized by those skilled in the art). In another embodiment, Suzuki reaction of 5-bromo-3-chloropyridazine 11-1 with boronates 1-4 affords 11-2. SNAr reaction of each chloride 10-4a, 10-4b, 10-4c, 10-4d, and 11-2 with various morpholines (commercially available or synthesized bythose skilled in the art) provides compounds of Formula I.Preparation of intermediates[000183] Using the synthetic procedures and methods described herein and methods known tothose skilled in the art, the following compounds were made:Preparation of intermediate A1: 4-(4-bromopyridin-2-yl)morpholinelution of 4-bromo-2-fluoro-pyridine (1.0 g, 5.7 mmol) and morpholine (0.6 mL, 6.8mmol) in DMF (20 mL) was treated with Cs2CO3 (5.6 g, 17 mmol). The reaction mixture washeated at 100 ºC for 16 h and then cooled to rt. The mixture was diluted with water and extractedwith EtOAc (3x). The combined organics were washed with brine, dried over anhydrous Na2SO4,filtered, and concentrated under reduced pressure. The resulting crude was purified by silica gelcolumn chromatography (0 to 15% EtOAc / pet-ether) to obtain 4-(4-bromopyridin-2-yl)morpholine (A1, 1.0 g, 72%) as a yellow solid. 1H NMR (400 MHz, methanol-d4): δ 7.95 (d, J= 5.4 Hz, 1H), 6.98 (d, J =1.4 Hz, 1H), 6.84 (dd, J = 1.4, 5.4 Hz, 1H), 3.73-3.79 (m, 4H), 3.44-3.51 (m, 4H); MS (ESI) m / z: 242.9 (M+H+).Preparation of intermediate A2: 4-(3-bromophenyl)morpholineon of 1-bromo-3-iodo-benzene (0.9 mL, 7.1 mmol) and morpholine (0.62 mL,7.1 mmol) in toluene (15 mL) was treated with and tert-BuONa (1.4 g, 14 mmol). The mixturewas degassed and purged with N2 for 5 min. Pd2(dba)3 (0.65 g, 0.1 eq) and BINAP (0.44 g, 0.1 eq)were added and then the mixture was heated at 60 ºC for 4 h under N2atmosphere. The reactionmixture was cooled to rt, diluted with water (20 mL) and extracted with EtOAc (3x). The combinedorganics were washed by brine, dried over anhydrous Na2SO4, filtered, and concentrated underreduced pressure. The resulting crude was purified by silica gel column chromatography (0 to 35% EtOAc / pet-ether) to obtain 4-(3-bromophenyl)morpholine (A2, 1.3 g, 76%) as a yellow gum.1HNMR (400 MHz, methanol-d4): δ 7.14 (t, J = 7.6 Hz, 1H), 7.07 (d, J = 2.0 Hz, 1H), 6.96 (d, J = 2.0Hz, 1H), 6.94 (d, J = 2.0 Hz, 1H), 3.66-3.79 (m, 4H), 3.08-3.18 (m, 4H); MS (ESI) m / z: 241.9 (M+H+).The following compounds are prepared essentially by method of preparation intermediates A1.Ex No SM Product Yield 1H NMR (400 MHz, DMSO-d6): ^ MS (m / z:A375 7.82 (d, J = 5.4 Hz, 1H), 7.21 (s,291.0 1H), 7.03 (d, J = 5.2 Hz, 1H), 3.60-DIEA 3.80 (m, 1H), 3.59 (m, 1H), 2.78(dd, J = 10.8, 12.8 Hz, 1H).A1770 6.81 (br s, 1H), 6.64 (d, J = 2.4 Hz,320.9 1H), 4.80 (s, 1H), 4.65 (s, 1H), 3.75The following compounds are prepared essentially by method of preparation intermediate A2. Ex No SM Product Yield1H NMR (400 MHz, DMSO-d6): MS (m / z: (%) ^ M+H+)Preparation of Intermediate B1: 4-(4-chloro-6-cyclopropylpyridin-2-yl)morpholineixture of 4-(4,6-dichloropyridin-2-yl)morpholine (A8, 0.62 g, 2.7 mmol),cyclopropylboronic acid (0.34 g, 4.0 mmol) in a mixture of 1,4-dioxane (10 mL) and H2O (2 mL)was treated with Na2CO3 (0.56 g, 5.3 mmol). The reaction mixture was purged with N2 for 5 minand then Pd(dppf)Cl2 (0.19 g, 0.27 mmol) was added and then the reaction was heated at 100 ºC for 3 h under N2 atmosphere. The reaction mixture was cooled to rt, quenched with water, and extracted with EtOAc (3x). The combined organic layers were washed with brine, dried overanhydrous Na2SO4, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC silica gel column chromatography (10% MeOH / DCM) to obtain 4-(4-chloro-6-cyclopropylpyridin-2-yl)morpholine (B1, 0.15 g, 24%) as a white solid. 1H NMR (400 MHz,DMSO-d6): δ 6.69 (d, J = 1.4 Hz, 1H), 6.63 (d, J = 1.6 Hz, 1H), 3.65 (m, 4H), 3.40 (m, 4H), 1.94(m, 1H), 0.82-0.91 (m, 4H); MS (ESI) m / z: 239.2 (M+H+).Preparation of Intermediate B2: (R)-2-((4-iodo-6-morpholinopyridin-2-yl)amino)propan-1-olmixture of (2R)-2-aminopropan-1-ol (6.1 mL, 78 mmol), 4-(6-fluoro-4-iodopyridin-2-yl)morpholine (A5, 12 g, 39 mmol), K2CO3 (10.77 g, 77.90 mmol, 2 eq) in NMP (120 mL) washeated at 120 ºC for 16 h. The reaction mixture cooled to the room temperature, diluted with water, and extracted with EtOAc (3x). The combined organic layers were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The resulting crude waspurified by silica gel column chromatography (0 to100 % EtOAc / pet-ether) to obtain (R)-2-((4-iodo-6-morpholinopyridin-2-yl)amino)propan-1-ol (B2, 8.0 g, 57%) as a purple solid.1H NMR (400 MHz, CDCl3): δ 6.17 (s, 1H), 6.12 (s, 1H), 4.28 (br s, 1H), 3.97 (m, 1H), 3.76 (m, 4H), 3.66(m, 1H), 3.46 (m, 1H), 3.29 (m, 4H), 3.19 (br s, 1H), 1.19 (d, J = 6.8 Hz, 3H).The following compounds are prepared essentially by method of preparation intermediate B1 andB2. Ex No SM Product Yield 1H NMR (400 MHz, DMSO-d6): ^ MS (m / z:B4 A6 85 6.26 (s, 1H), 6.15 (d, J = 7.6 Hz,376.2 1H), 6.07 (s, 1H), 4.65-4.75 (m,B10 A16 27 No Data 260.3Preparation of Intermediate C1: tert-butyl (3-(2-chloro-6-methylpyridin-4-yl)-4-methylphenyl)carbamatelution of 2-chloro-6-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine (3.0 g, 12 mmol) and 3-bromo-4-methyl-aniline (3.3 g, 18 mmol) in a mixture of 1,4-dioxane (50 mL) and H2O (10 mL) was treated with Na2CO3 (2.5 g, 24 mmol). The reaction was degassed with N2 for 4 min and Pd(dppf)Cl2 (0.87 g, 1.2 mmol) was added, then the reaction washeated at 100 ºC for 3 h under N2atmosphere. The reaction was cooled to rt and quenched with water, extracted with EtOAc (3x). The combined organics were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (0 to 7% EtOAc / pet-ether) to obtain 3-(2-chloro-6-methyl-4-pyridyl)-4-methyl-aniline (C1, 2.2 g, 80%) as a white solid.1H NMR (400 MHz, DMSO-d6): δ 7.21 (s, 2H), 6.95 (d, J = 8.4 Hz, 1H), 6.56 (dd, J = 2.4, 8.2 Hz, 1H), 6.45 (d, J = 2.4 Hz, 1H), 5.01(s, 2H), 2.50 (s, 3H), 2.06 (s, 3H); MS (ESI) m / z: 233.1 (M+H+). The following compounds are prepared essentially by method of preparation intermediate C1.ExSM Product YieldMS (m / z: No (%) M+H+)Preparation of Intermediate C3: 4-(6-fluoro-4-(2-methyl-5-nitrophenyl)pyridin-2-yl)morpholineof 2,6-difluoro-4-(2-methyl-5-nitrophenyl)pyridine (C2, 1.5 g, 6.0 mmol) andmorpholine (1.6 mL, 18 mol) in EtOH (30 mL) was treated with DIEA (3.1 mL, 18 mmol). Thereaction was sealed and heated to 65 ºC for 4 h and then cooled to rt. The reaction mixture wasdiluted with water and sonicated for 5 min. The solid was filtered and washed with water. Thematerial was dried under high vacuum overnight to obtain 4-(6-fluoro-4-(2-methyl-5-nitrophenyl)pyridin-2-yl)morpholine (C3, 1.64 g, 86%) as a golden brown solid. 1H NMR (400MHz, DMSO-d6): ^ 8.18 (dd, J = 2.4, 8.4 Hz, 1H), 8.04 (d, J = 2.4 Hz, 1H), 7.62 (d, J = 8.4 Hz,1H), 6.71 (s, 1H), 6.41 (s, 1H), 3.68 (t, J = 4.8 Hz, 4H), 3.49 (t, J = 4.8 Hz, 4H), 2.36 (s, 3H); MS(ESI) m / z: 318.2 (M+H+).The following compounds are prepared essentially by method of preparation intermediate C3. Ex No SM Product YieldMS (m / z: (%) M+H+)reparat on o nterme ate : -( - uoro- -morp o nopyr din-4-yl)-4-methylanilineof 4-(6-fluoro-4-(2-methyl-5-nitrophenyl)pyridin-2-yl)morpholine (C3, 2.0g, 6.3 mmol) in EtOH (30 mL) was treated with 10% palladium on carbon (50% wet with water)(1.34 g, 0.63 mmol). The reaction mixture was placed under an H2 atmosphere (50 Psi) and allowedto shake at rt for 5 h. The reaction mixture was filtered through a pad of celite and washed with EtOH. The filtrate was concentrated under reduced pressure to dryness to afford 3-(2-fluoro-6-morpholinopyridin-4-yl)-4-methylaniline (C5, 1.81 g, 100%) as a pale-yellow oil. 1H NMR (500MHz, DMSO-d6): ^ 6.92 (d, J = 8.0 Hz, 1H), 6.52 (m, 2H), 6.44 (d, J = 2.4 Hz, 1H), 6.22 (s, 1H),4.96 (s, 2H), 3.67 (t, J = 4.8 Hz, 4H), 3.44-3.46 (m, 4H), 2.05 (s, 3H). Preparation of Intermediate D1: (R)-2-((4-(5-amino-2-methylphenyl)-6-morpholinopyridin-2-yl)amino)propan-1-olre of (R)-2-((4-iodo-6-morpholinopyridin-2-yl)amino)propan-1-ol (B2, 11 g, 30mmol), 4-methyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)aniline (7.0 g, 30 mmol), andK2CO3 (10.4 g, 75 mmol) in a mixture of 1,4-dioxane (135 mL) and water (15 mL) was purgedwith Ar for 5 min. Pd(dppf)Cl2-DCM adduct (2.4 g, 3.0 mmol) was added and then the reactionwas sealed and heated to 80 ºC overnight. The reaction was cooled to rt and then diluted with sat’dNaHCO3 (aq). The aqueous was extracted with DCM (3x). The combined organics were dried overanhydrous Na2SO4, filtered, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (0 to 100% EtOAc / hexanes) to obtain (R)-2-((4-(5-amino-2-methylphenyl)-6-morpholinopyridin-2-yl)amino)propan-1-ol (D1, 7.1 g, 69%) as a tan solid. MS(ESI) m / z: 343.2 (M+H+).Preparation of Intermediate D2 and D3: 2-((4-(5-amino-2-methylphenyl)-6-morpholinopyridin-2-yl)oxy)ethan-1-ol (D2) and 3-(2-(2-((tert-butyldimethylsilyl)oxy)ethoxy)-6-morpholinopyridin-4- yl)-4-methylaniline and intermediate (D3))oxy)ethan-1-ol (37 g, 209 mmol) in a mixtureof 1, 4-dioxane and NMP (4:1, 150 ML) was treated with NaH (5.2 g, 131 mmol, 60% dispersion in mineral oil) slowly. The resultant mixture was stirred at rt for 15 min under Ar atmosphere.3- (2-Fluoro-6-morpholinopyridin-4-yl)-4-methylaniline (C5, 15 g, 52 mmol) was added and then the reaction mixture was heated at 120 °C for 2 h. The reaction mixture was cooled to rt and pouredinto cold sat’d NH4Cl solution (aq, 200 mL). The mixture was extracted with DCM (3x). Thecombined organics were dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The crude was purified by silica gel column chromatography (0 to 40% EtOAc / hexanes) to obtain two major products: 2-((4-(5-amino-2-methylphenyl)-6-morpholinopyridin-2-yl)oxy)ethan-1-ol (D2, 6.5 g, 55%) as a brown liquid. 1H NMR (400 MHz, DMSO-d6): ^ 6.89 (d,J = 8.2 Hz, 1H), 6.48 (dd, J = 2.0, 8.0 Hz, 1H), 6.41 (br s, 1H), 6.16 (m, 1H), 5.95 (m, 1H), 4.9 (brs, 2H), 4.78 (t, J = 5.6 Hz, 1H), 4.23 (t, J = 5.2 Hz, 2H), 3.69 (m, 6H), 3.39 (m, 4H), 2.01 (s, 3H);MS (ESI) m / z: 330.0 (M+H+) and 3-(2-(2-((tert-butyldimethylsilyl)oxy)ethoxy)-6-morpholinopyridin-4-yl)-4-methylaniline (D3, 7.0 g, 30%) as a brown liquid. 1H NMR (400 MHz,DMSO-d6): ^ 6.89 (d, J = 8.0 Hz, 1H), 6.48 (dd, J = 2.4, 8.0 Hz, 1H), 6.41 (s, 1H), 6.16 (s, 1H),5.91 (s, 1H), 4.9 (br s, 2H), 4.28 (t, J = 5.2 Hz, 2H), 3.89 (t, J = 5.2 Hz, 2H), 3.68 (m, 4H), 3.42(m, 4H), 2.01 (s, 3H), 0.85 (s, 9H), 0.04 (s, 6H); MS (ESI) m / z: 444.1 (M+H+)The following compounds are prepared essentially by method of preparation intermediate D1. Ex No SM Product Yield1H NMR (400 MHz, DMSO- MS (m / z: (%) d6): ^ M+H+)D10 A2 68 7.26 (t, J = 7.9 Hz, 1H), 6.91269.0 (d, J = 8.2 Hz, 2H), 6.80 (s,[000193] A solution of methyl 6-chloropyridazine-3-carboxylate (25 g, 145 mmol) in a mixture ofsulfolane (50 mL), H2O (250 mL) and MeCN (50 mL) was treated with cyclobutanecarboxylicacid (21 mL, 217 mmol) and AgNO3 (25 g, 145 mmol). The mixture was heated at 50 ºC, and then H2SO4 (22 mL, 419 mmol) in H2O (150 mL) was added dropwise. Ammonia (52 mL, 239 mmol) in H2O (150 mL) was added dropwise manner for 35 min. The reaction mixture was stirred at 70 ºC for 20 min. Then the mixture was cooled to rt and stirred for 12 h. The reaction mixture was basified with 30% NaOH (aq) at 0 ºC to pH around 7. The solution was extracted with EtOAc (3x). The combined extracts were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The resulting product was purified by silica gel column chromatography (0 to 40% EtOAc / pet-ether) to obtain methyl 6-chloro-5-cyclobutylpyridazine-3-carboxylate (E1, 7.2 g, 19%) as a yellow oil. 1H NMR (400 MHz, DMSO-d6): δ 8.08 (s, 1H), 3.98(s, 3H), 3.70-3.78 (m, 1H), 2.36-2.45 (m, 2H), 2.20-2.24 (m, 2H), 2.01-2.19 (m, 1H), 1.78-1.88 (m, 1H). Preparation of intermediate E2: 3-chloro-5-cyclopropylpyridazinemixture of 5-bromo-3-chloro-pyridazine (10 g, 52 mmol), cyclopropylboronic acid(4.4 g, 52 mmol), and Na2CO3 (16 g, 155 mmol) in a mixture of 1,4-dioxane (100 mL) and H2O(20 mL) was purged with N2 for 5 min. Pd(dppf)Cl2 (3.0 g, 4.2 mmol) was added and then themixture was heated at 90 ºC for 12 h under N2 atmosphere. The reaction mixture was cooled to rt,diluted with water (150 mL) and extracted with EtOAc (4x). The combined organic layers werewashed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reducedpressure. The residue was purified by silica gel column chromatography (0 to 50% EtOAc / pet-ether) to give 3-chloro-5-cyclopropylpyridazine (E2, 4.1 g, 51%) as a yellow solid.1H NMR (400MHz, DMSO-d6): δ 9.08 (d, J = 2.0 Hz, 1H), 7.59 (d, J = 1.9 Hz, 1H), 2.01 (m, 1H), 1.15-1.21 (m,2H), 0.98-1.04 (m, 2H); MS (ESI) m / z: 155.1 (M+H+).Preparation of intermediate E3: 3-chloro-5-(1-ethoxyvinyl)pyridazineL three round-bottom flask equipped with a stirrer bar was charged with 5-bromo-3-chloro-pyridazine (40 g, 208 mmol), tributyl(1-ethoxyvinyl)stannane (70 mL, 208 mmol), TEA(87 mL, 620 mmol) in DMF (500 mL) was purged with N2 for 3 min. Pd(PPh3)2Cl2 (7.3 g, 10mmol) was added and then the mixture was heated at 90 ºC for 3 h under N2 atmosphere. Thereaction mixture was cooled to rt, quenched with sat’d NH4Cl (aq, 100 mL) and sat’d KF(1 L) at 0 ºC. The mixture was stirred at rt for 0.5 h, then extracted with EtOAc (3x). The combinedorganics were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated underreduced pressure. The resulting crude was purified by silica gel column chromatography (0 to 100% EtOAc / pet-ether) to obtain 3-chloro-5-(1-ethoxyvinyl)pyridazine (E3, 30 g, 79%) as ayellow solid. 1H NMR (400 MHz, methanol-d4): δ 9.41 (d, J = 1.6 Hz, 1H), 7.95 (d, J = 1.8 Hz,1H), 5.29 (d, J = 3.8 Hz, 1H), 4.76 (d, J = 3.9 Hz, 1H), 4.03 (q, J = 7.0 Hz, 2H), 1.47 (t, J = 7.0 Hz, 3H). The following compounds are prepared essentially by method of preparation intermediate D2.ExSM Product Yield 1H NMR (400 MHz, DMSO-d6): ^ MS (m / z:No (%) M+H+)mixture of 3-chloro-5-isopropenyl-pyridazine (E4, 1.0 g, 6.5 mmol), phenylsilane (4mL, 32 mmol), tris[(Z)-1-tert-butyl-4,4-dimethyl-3-oxo-pent-1-enoxy]manganese (3.9 g, 6.5mmol) in a mixture of DCM (10 mL) and iso-PrOH (30 mL) was purged with O2 for 5 min, andthen the mixture was stirred at 0 ºC for 0.5 h under O2 atmosphere. The reaction mixture wasquenched with sat’d Na2SO3 (aq) and extracted with EtOAc (3x). The combined organics werewashed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reducedpressure. The resulting crude was purified by silica gel column chromatography (20 to 100%EtOAc / pet-ether) to obtain 2-(6-chloropyridazin-4-yl)propan-2-ol (E5, 0.78 g, 63%) as a whitesolid. 1H NMR (400 MHz, methanol-d6): δ 9.28 (d, J = 2.0 Hz, 1H), 7.86 (d, J = 1.8 Hz, 1H), 1.56(s, 6H); MS (ESI) m / z: 173.1 (M+H+).Preparation of intermediate E6: 3-chloro-5-(2-fluoropropan-2-yl)pyridazinea solution of 2-(6-chloropyridazin-4-yl)propan-2-ol (E5, 0.6 g, 3.5 mmol) in DCE (6mL) was treated with BAST (2.3 mL, 10 mmol). The mixture was stirred at rt for 2 h. The mixture was poured into water (10 mL) and extracted with DCM (3x). The combined organic layers werewashed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reducedpressure. The crude was purified by silica gel column chromatography (0 to 50% EtOAc / pet-ether)to obtain 3-chloro-5-(2-fluoropropan-2-yl)pyridazine (E6, 0.5 g, 80%) as a yellow gum. MS (ESI)m / z: 175.1 (M+H+).Preparation of intermediate F1: methyl 5-cyclobutylpyridazine-3-carboxylate lution of methyl 6-chloro-5-cyclobutyl-pyridazine-3-carboxylate (E1, 5.5 g, 24mmol) in MeOH (30 mL) was treated with Pd-C (5.5 g, 5.2 mmol, 10%) under N2 atmosphere. The mixture was stirred at rt for 5 h under H2 (15 Psi). The reaction mixture was filtered and concentrated under reduced pressure to give methyl 5-cyclobutylpyridazine-3-carboxylate (F1, 4.0g, crude) as a yellow oil. 1H NMR (400 MHz, DMSO-d6): δ 9.38 (s, 1H), 8.10 (s, 1H), 3.95 (s,3H), 3.65-3.73 (m, 1H), 2.29-2.37 (m, 2H), 2.13-2.26 (m, 2H), 1.99-2.08 (m, 1H), 1.83-1.91 (m, 1H). Preparation of intermediate F2: methyl 6-(trifluoromethyl)pyridazine-3-carboxylate[000199] A solution of 3-chloro-6-(trifluoromethyl)pyridazine (2.0 g, 11 mmol) and Pd(dppf)Cl2(0.8 g, 1.1 mmol) in MeOH (20 mL) was treated with DIEA (3.8 mL, 22 mmol). The mixture waspurged with CO for 5 min. The mixture was stirred under CO (50 Psi) at 80 ºC for 3 h. The reactionmixture was cooled to rt and then diluted with water (30 mL). The solution was extracted withEtOAc (3x). The combined organics were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The crude product was purified by silica gel column chromatography (0 to 25 % EtOAc / pet-ether) to obtain methyl 6- (trifluoromethyl)pyridazine-3-carboxylate (F2, 1.0 g, 44%) as a white solid. MS (ESI) m / z: 207.1 (M+H+).The following compounds are prepared essentially by method of preparation intermediates F1 andF2. ExSM Product Yield 1H NMR (400 MHz, DMSO-d6): ^ MS (m / z:F4 E4 80 9.41 (d, J = 2.2 Hz, 1H), 8.06 (d, JNo Data and then = 2.2 Hz, 1H), 3.96 (s, 3H), 3.07ution of methyl 5-acetylpyridazine-3-carboxylate (F7, 30 g, 166 mmol) in DCM(300 mL) was stirred at 0 ºC. DAST (66 mL, 500 mmol) was added dropwise at 0 ºC and warmedto rt. The reaction mixture was stirred at rt for 10 h. Water (300 mL) was added and then thesolution was extracted with DCM (3x). The combined organic layers were washed with brine,dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The resultingcrude was purified by silica gel column chromatography (0 to 100 % EtOAc / pet-ether) to obtainmethyl 5-(1,1-difluoroethyl)pyridazine-3-carboxylate (F8, 11 g, 33%) as a white solid. 1H NMR(400 MHz, methanol-d4): δ 9.48 (d, J = 2.2 Hz, 1H), 8.30 (d, J = 2.0 Hz, 1H), 3.99 (s, 3H), 1.95 (t, J = 18.9 Hz, 3H). Preparation of intermediate G1: 6-(trifluoromethyl)pyridazine-3-carboxylic acidsolution of methyl 6-(trifluoromethyl)pyridazine-3-carboxylate (F2, 1.0 g, 4.8mmol) in a mixture of THF (5 mL) and MeOH (5 mL) was added LiOH•H2O (0.41 g, 9.7 mmol).The mixture was stirred at rt for 2 h. The mixture was concentrated under reduced pressure. Theaqueous residue was acidified by 1.0 N HCl (aq) to pH around 3. The solution was extracted withEtOAc (3x). The combined organics were washed with brine, dried over anhydrous Na2SO4,filtered, and concentrated under reduced pressure to give 6-(trifluoromethyl)pyridazine-3-carboxylic acid (G1, 0.80 g, 80%) as a brown solid. 1H NMR (400 MHz, DMSO-d6): δ 8.53 (d, J= 8.6 Hz, 1H), 8.30 (d, J = 8.8 Hz, 1H), carboxylic acid proton is missing; MS (ESI) m / z: 193.0 (M+H+). The following compounds are prepared essentially by method of preparation intermediate G1. ExSM Product Yield 1H NMR (400 MHz, DMSO-d6): ^ MS (m / z:No (%) M+H+)Preparation of intermediate H1: N-(4-methyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)-5-(trifluoromethyl)pyridazine-3-carboxamide[000202] A solution of 5-(trifluoromethyl)pyridazine-3-carboxylic acid (6.4 g, 33 mmol), HATU(14 g, 36 mmol) and DIEA (17 mL, 99 mmol) in DMF (66 mL) was stirred at 0 ºC for 15 min. 4-Methyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)aniline (7.7 g, 33 mmol) was added and then the reaction mixture was warmed to rt and stirred at rt overnight. The reaction mixture was quenched with water and the resulting solid was collected by filtration to obtain N-(4-methyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)-5-(trifluoromethyl)pyridazine-3-carboxamide (H1, 12 g, 87%) as a white solid. 1H NMR (400 MHz,DMSO-d6): δ 11.14 (s, 1H), 9.92 (s, 1H), 8.55 (d, J = 2.4 Hz, 1H), 8.20 (d, J = 2.4 Hz,1H), 7.85(dd, J = 2.4, 8.2 Hz, 1H), 7.19 (d, J = 8.2 Hz, 1H), 2.44 (s, 3H), 1.30 (d, J = 1.4 Hz, 12H); MS(ESI) m / z: 408.2 (M+H+).The following compounds are prepared essentially by method of preparation intermediate H1. ExSM Product Yield1H NMR (400 MHz, DMSO- MS (m / z: No (%) d6): ^ M+H+)Preparation of intermediate H4: 5-cyano-N-(4-methyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)pyridazine-3-carboxamidetion of N3-[4-methyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]pyridazine-3,5-dicarboxamide (H3, 16.5 g, 43 mmol) in THF (200 mL) was treated with methoxycarbonyl-(triethylammonio)sulfonyl-azanide (51.4 g, 216 mmol). The mixture was stirredat 20 ºC for 1 h, then the resulting precipitate was collected by filtration to give 5-cyano-N-[4-methyl-3-(4,4,5,5-tetramethyl-1,3,2dioxaborolan-2-yl)phenyl]pyridazine-3-carboxamide (5.0 g, 31%) as a yellow solid. The mother liquor was concentrated under reduced pressure and then theresulting residue was triturated with water (50 mL). The solid was filtered to obtain second batchof 5-cyano-N-[4-methyl-3-(4,4,5,5-tetramethyl-1,3,2dioxaborolan-2-yl)phenyl]pyridazine-3-carboxamide (H4, 4.2 g, 25%) as a yellow solid. 1H NMR (400 MHz, DMSO-d6): δ 11.13 (s, 1H),9.86 (d, J = 1.8 Hz, 1H), 8.78 (d, J = 1.8 Hz, 1H), 8.21 (d, J = 2.2 Hz, 1H), 7.85 (dd, J = 2.2, 8.2 Hz, 1H), 7.20 (d, J = 8.2 Hz, 1H), 2.45 (s, 3H), 1.32 (s, 12H); MS (ESI) m / z: 365.1 (M+H+).Preparation of intermediate I1: N-(3-(6-chloropyridazin-4-yl)-4-methylphenyl)-5-(trifluoromethyl)pyridazine-3-carboxamide5-bromo-3-chloropyridazine (0.26 g, 1.35 mmol), and N-(4-methyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)-5-(trifluoromethyl)pyridazine-3-carboxamide (H1, 0.55 g, 1.35 mmol) in a mixture of 1,4-dioxane (10 mL) and water (1.25 mL)was treated with K2CO3 (0.56 g, 4.05 mmol). The mixture was purged with Ar for 5 min and thenPdCl2(dppf)-DCM adduct (0.11 g, 0.14 mmol) was added. The reaction mixture was sealed andheated to 90 ºC overnight. The mixture was cooled to rt, diluted with EtOAc and filtered througha pad of celite. The filtrate was concentrated under reduced pressure. The crude was purified bysilica gel column chromatography (0 to 100% EtOAc / hexanes) to provide N-(3-(6-chloropyridazin-4-yl)-4-methylphenyl)-5-(trifluoromethyl)pyridazine-3-carboxamide (I1, 0.50 g,94%) as a yellow solid. MS m / z: 394.2 (M+H+).The following compounds are prepared essentially by method of preparation intermediate I1. ExSM Product Yield1H NMR (400 MHz, DMSO- MS (m / z: +H2 I4 A18 98 11.32 (s, 1H), 9.96 (d, J = 2.0467.4Preparation of Example 1: N-(4-methyl-3-(2-morpholinopyridin-4-yl)phenyl)-5- (trifluoromethyl)pyridazine-3-carboxamide[000 05] so ut on o 5-(trifluoromethyl)pyridazine-3-carboxylic acid (0.12 g, 0.61 mmol), 4-methyl-3-(2-morpholino-4-pyridyl)aniline (D6, 0.15 g, 0.56 mmol), HATU (0.32 g, 0.84mmol) and DIEA (0.2 mL, 1.1 mmol) in DMF (3 mL) was stirred at rt for 2 h. The reactionmixture was diluted with water and extracted with EtOAc (3x). The combined organics werewashed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reducedpressure. The residue was purified by C-18 prep-HPLC (25 to 55% water (HCl) / MeCN) toobtain N-(4-methyl-3-(2-morpholinopyridin-4-yl)phenyl)-5-(trifluoromethyl)pyridazine-3-carboxamide (1, 0.11 g, 45%) as a pale-yellow solid. 1H NMR (400 MHz, methanol-d4): ^ 9.76 (d,J = 2.0 Hz, 1H), 8.64 (d, J = 1.4 Hz, 1H), 8.03 (d, J = 6.5 Hz, 1H), 7.92 (d, J = 2.3 Hz, 1H), 7.84(dd, J = 2.3, 8.4 Hz, 1H), 7.39-7.45 (m, 2H), 7.10 (dd, J = 1.3, 6.6 Hz, 1H), 3.85-3.93 (m, 4H),3.69-3.77 (m, 4H), 2.36 (s, 3H); MS (ESI) m / z: 444.0 (M+H+).Preparation of Example 2: 5-cyclopropyl-N-(4-methyl-3-(2-morpholinopyridin-4- yl)phenyl)pyridazine-3-carboxamide[000206] A mixture of 4-(4-bromopyridin-2-yl)morpholine (A1, 0.10 g, 0.34 mmol), 5-cyclopropyl-N-(4-methyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)pyridazine-3-carboxamide (H2, 0.13 g 0.34 mmol) in a mixture of 1,4-dioxane (3 mL) and H2O (0.6 mL) wastreated with Na2CO3 (0.07 g, 0.69 mmol). The reaction mixture was purged with N2 for 3 min thenPd(dppf)Cl2 (25 mg, 34 μmol) was added. The mixture was heated at 100 ºC for 3 h under N2atmosphere. The reaction mixture was quenched with water and extracted with EtOAc (3x). Thecombined organics were washed with water, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The resulting product was purified by silica gel column chromatography (0 to 100% EtOAc / pet-ether) to obtain 5-cyclopropyl-N-(4-methyl-3-(2- morpholinopyridin-4-yl)phenyl)pyridazine-3-carboxamide (2, 0.13 g, 89%) as a yellow solid.1HNMR (400 MHz, DMSO-d6): ^ 11.02 (s, 1H), 9.27 (d, J = 2.0 Hz, 1H), 8.19 (d, J = 5.2 Hz, 1H),7.93 (d, J = 2.4 Hz, 1H), 7.88 (dd, J = 2.4, 8.4 Hz, 1H), 7.85 (d, J = 2.0 Hz, 1H), 7.32 (d, J = 8.4 Hz, 1H), 6.77 (s, 1H), 6.71 (dd, J = 1.2, 4.8 Hz, 1H), 3.72 (m, 4H), 3.50 (m, 4H), 2.25 (s, 3H), 2.16 (m, 1H), 1.21-1.26 (m, 2H), 1.04-1.07 (m, 2H); MS (ESI) m / z: 416.2 (M+H+).The following compounds are prepared essentially by method of preparation examples 1 and 2.ExSM Product Yield1H NMR (400 MHz, DMSO-d6): MS (m / z: ^7.84 (d, J = 2.4 Hz, 1H), 7.32 (d, J = 8.3 Hz, 1H), 6.56 (d, J = 3.99 D1 50 10.63 (s, 1H), 9.22 (s, 1H), 9.06483.0 (s, 1H), 7.76 (dd, J = 2.2, 8.4 Hz,14 D1 48 11.02 (s, 1H), 9.45 (d, J = 2.3 Hz,491.2 F5 1H), 8.14 (d, J = 2.2 Hz, 1H),3.51 (m, 1H), 3.38 (m, 4H), 3.28- 3.33 (m, 1H), 2.22 (s, 3H), 2.078.4 Hz, 1H), 7.85 (d, J = 2.0 Hz, 1H), 7.31-7.34 (m, 2H), 3.77 (m,H1 (d, J = 5.0 Hz, 1H), 8.10 (d, J =2.0 Hz, 1H), 7.95 (dd, J = 2.1, 8.3(m, 6H), 3.40-3.53 (m, 4H), 2.24 (s, 3H), 1.74(d, J = 22.8 Hz, 6H).39 D2 31 11.05 (s, 1H), 9.45 (d, J = 2.0 Hz,478.3 G5 1H), 8.15 (d, J = 2.4 Hz, 1H),44 B10 36 11.29 (s, 1H), 9.97 (s, 1H), 8.59505.2 H1 (s, 1H), 8.02 (d, J = 1.2 Hz, 1H),1.94 (m, 1H), 1.14 (d, J = 6.4 Hz, 3H).53 9 77 10.38 (s, 1H), 9.15 (d, J = 8.0 Hz,489.3 2H), 7.78 (dd, J = 2.2, 8.3 Hz,59 A11 13 11.33 (s, 1H), 9.96 (s, 1H), 8.58445.0 H1 (s, 1H), 8.32 (s, 1H), 8.06 (s, 2H),64 D7 46 11.18 (s, 1H), 9.74 (s, 1H), 8.38499.1 G4(s, 1H), 7.77-7.88 (m, 2H), 7.281H), 2.24 (s, 3H), 1.14 (d, J = 6.6 Hz, 3H).HATU 2H), 6.97 (br d, J = 8.4 Hz, 1H),6.91 (s, 1H), 6.82 (d, J = 8.0 Hz,(m, 1H), 2.24 (s, 3H), 1.14 (d, J = 6.4 Hz, 3H).Preparation of Example 21: N-(4-methyl-3-(6-morpholinopyridazin-4-yl)phenyl)-5-(trifluoromethyl)pyridazine-3-carboxamide[000207] A solution of N-(3-(6-chloropyridazin-4-yl)-4-methylphenyl)-5-(trifluoromethyl)pyridazine-3-carboxamide (I1, 0.62 g, 1.6 mmol) and morpholine (0.20 mL, 2.4mmol) in EtOH (5 ml) was treated with triethylamine (0.66 mL, 4.7 mmol). The reaction mixturewas stirred at rt overnight and then concentrated under reduced pressure. The crude was purifiedby silica gel column chromatography (0 to 100% EtOAc / hexanes) to obtain N-(4-methyl-3-(6-morpholinopyridazin-4-yl)phenyl)-5-(trifluoromethyl)pyridazine-3-carboxamide (21, 0.043 g,7%) as a white solid.1H NMR (400 MHz, methanol-d4): ^ 11.32 (s, 1H), 9.96 (s, 1H), 8.66 (s, 1H),8.57 (s, 1H), 7.98 (dd, J = 2.3, 8.2 Hz, 1H), 7.90 (d, J = 2.3 Hz, 1H), 7.39 (d, J = 8.4 Hz, 1H), 7.25 (s, 1H), 3.75 (t, J = 4.6 Hz, 4H), 3.62 (d, J = 4.8 Hz, 3H), 2.28 (s, 3H); MS (ESI) m / z: 445.2 (M+H+). The following compounds are prepared essentially by method of preparation example 21. ExSM Product Yield1H NMR (400 MHz, DMSO-d6): MS (m / z: No (%) ^ M+H+)1H), 6.78 (s, 1H), 6.67 (d, J = 5.1 Hz, 1H), 4.21 (dd, J = 2.4, 13.24.66 (s, 1H), 3.74 (m, 2H), 3.48 (d, J = 10.0 Hz, 1H), 3.27 (d, J =Hz, 1H), 6.99 (br m, 1H), 5.86 (s, 1H), 4.89 (br s, 1H), 4.62 (s, 1H),-4-yl)-4-methylphenyl)-6-isopropylpyrazine-2-carboxamideN-[3-[2-[[(1R)-2-hydroxy-1-methyl-ethyl]amino]-6-morpholino-4-pyridyl]-4-methyl-phenyl]-6-isopropenyl-pyrazine-2-carboxamide (0.15 g, 0.31 mmol) in MeOH(2 mL) was added Pd-C (0.33 g, 0.31 mmol, 50% wet with water) in MeOH (2 mL). The mixturewas degassed and purged with H2 for 3 times, and then the mixture was stirred at rt for 0.5 h underH2 atmosphere. The reaction mixture was filtered a pad of celite and washed with MeOH. Thefiltrate was concentrated under reduced pressure. The residue was purified by C-18 prep-HPLC(40 to 70% H2O (10 mM NH4HCO3) / MeCN) to obtain (R)-N-(3-(2-((1-hydroxypropan-2-yl)amino)-6-morpholinopyridin-4-yl)-4-methylphenyl)-6-isopropylpyrazine-2-carboxamide (57,0.067 g, 44%) as a pale-yellow solid. 1H NMR (400 MHz, DMSO-d6): ^ 10.35 (s, 1H), 9.09 (s,1H), 8.87 (s, 1H), 7.78 (dd, J = 2.2, 8.4 Hz, 1H), 7.69 (d, J = 2.2 Hz, 1H), 7.27 (d, J = 8.4 Hz, 1H), 6.02 (d, J = 7.6 Hz, 1H), 5.80 (s, 2H), 4.66 (t, J = 5.4 Hz, 1H), 3.90 (m, 1H), 3.68 (m, 4H), 3.50 (m, 1H), 3.38 (m, 4H), 3.21-3.31 (m, 2H), 2.23 (s, 3H), 1.37 (d, J = 7.0 Hz, 6H), 1.13 (d, J = 6.6Hz, 3H); MS (ESI) m / z: 491.2 (M+H+).Biochemical assay for B-Raf[000209] Activity of B-Raf kinase (SEQ ID NO: 1) was determined spectroscopically using acoupled pyruvate kinase / lactate dehydrogenase assay that continuously monitors the ATP hydrolysis-dependent oxidation of NADH (e.g., Schindler et al., Science, 2000, 289, 1938-1942). Assays were conducted in 384-well plates (100 µL final volume) using 0.13 nM B-Raf (Sigma),1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mMNADH, 30.1 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15mM MgCl2, 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w / v) BSA, and 0.002% Triton X-100).Inhibition of B-Raf was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored continuously for 6 h at 30 ºC on a multi-mode microplate reader (BioTek). The reaction rate was calculated using the 4 to 5 h time frame. The reaction rate at each concentration of compound was converted topercent inhibition using controls (i.e., reaction with no test compound and reaction with a knowninhibitor) and IC50 values were calculated by fitting a four-parameter sigmoidal curve to the data using Prism (GraphPad software). B-Raf protein sequence residues 416-766 with N-terminal GST-tag (SEQ ID NO: 1)[000210] LQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLA IVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHED LTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVL YELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDER PLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH Biochemical assay for C-Raf[000211] Activity of C-Raf kinase (SEQ ID NO: 2) was determined spectroscopically using acoupled pyruvate kinase / lactate dehydrogenase assay that continuously monitors the ATP hydrolysis-dependent oxidation of NADH (e.g., Schindler et al., Science, 2000, 289, 1938-1942). Assays were conducted in 384-well plates (100 µL final volume) using 0.43 nM C-Raf (Sigma),1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mMNADH, 30.1 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15mM MgCl2, 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w / v) BSA, and 0.002% Triton X-100).Inhibition of C-Raf was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored continuously for6 h at 30 ºC on a multi-mode microplate reader (BioTek). The reaction rate was calculated usingthe 4 to 5 h time frame. The reaction rate at each concentration of compound was converted topercent inhibition using controls (i.e., reaction with no test compound and reaction with a knowninhibitor) and IC50values were calculated by fitting a four-parameter sigmoidal curve to the data using Prism (GraphPad software). C-Raf residues 306-end; Y340D, Y341D with N-terminal GST-tag (SEQ ID NO: 2)[000212] QPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSDDWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNL AIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFL HEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSY GIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKV KEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVFTable 1. Inhibition of biochemical activity of BRAF and CRAF kinases by exemplarycompounds (“Ex. No.”).Ex No BRAF CRAF Ex No BRAF CRAF Ex No BRAF CRAF+19 ++++ ++++ 53 ++++ ++++ 88 +++ ++++20 ++++ ++++ 54 +++ ++++ 89 +++ +For Table 1, “++++” refers to an IC50 less than or equal to 100 nM; “+++” refers to an IC50 greaterthan 100 nM and less than or equal to 500 nM; “++” refers to an IC50 greater than 500 nM and lessthan or equal to 1000 nM; and “+” refers to an IC50 greater than 1000 nM and less than or equal to10000 nM. MiaPaca-2 Cell Proliferation Assay[000213] Miapaca-2 cells (catalog #CRL-1420) are obtained from the American Type CultureCollect (ATTC, Manassas, VA). Briefly, cells were grown in DMEM supplemented with 10%characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 2.5% New Zealand sourced horse serum and 1% Penicillin / Streptomycin / L-Glutamine at 37 ºC, 5% CO2, and 95% humidity. Cells are expanded until reaching 70-95% confluency at which point they are sub-cultured or harvestedfor assay use. A serial dilution of test compound is dispensed into a 384-well black clear bottomplate in triplicate. Seven hundred fifty cells are added per well in 50 µL complete growth mediumin the 384-well plate. Plates are incubated for 67-72 h at 37 ºC, 5% CO2, and 95% humidity. Atthe end of the incubation, 10 µL of a 440 µM solution of resazurin (Sigma, St. Louis, MO) in PBS is added to each well of the plate and plates are incubated for an additional 5-6 h at 37 ºC, 5% CO2,and 95% humidity. Plates are read on a Synergy2 or equivalent reader (Biotek, Winooski VT)using an excitation of 540 nm and an emission of 600 nm. Data is analyzed using Prism software (GraphPad, San Diego, CA) to calculate IC50 values. HCT-116 Cell Proliferation Assay[000214] HCT-116 cells (catalog #CCL-247) are obtained from the American Type CultureCollect (ATCC, Manassas, VA). Briefly, cells are grown in McCoy’s 5A supplemented with 10%characterized fetal bovine serum (Invitrogen, Carlsbad, CA) and 1% Penicillin / Streptomycin / L-Glutamine at 37 ºC, 5% CO2, and 95% humidity. Cells are expanded until reaching 70-95%confluency at which point they are sub-cultured or harvested for assay use. A serial dilution of testcompound is dispensed into a 384-well black clear bottom plate in triplicate. 375 cells are addedper well in 50 µL complete growth medium in the 384-well plate. Plates are incubated for 67 to 72h at 37 ºC, 5% CO2, and 95% humidity. At the end of the incubation, 40 µL of a 440 mM solutionof resazurin (Sigma, St. Louis, MO) in PBS is added to each well of the plate and plates areincubated for an additional 4 to 5 h at 37 ºC, 5% CO2, and 95% humidity. Plates are read on aSynergy2 or equivalent reader (Biotek, Winooski, VT) using an excitation of 540 nm and anemission of 600 nm. Data is analyzed using Prism software (Graphpad, San Diego, CA) tocalculate IC50values. HPAF-II Cell Proliferation Assay[000215] HPAF-II cells (catalog #CRL-1997) are obtained from the American Type CultureCollect (ATCC, Manassas, VA). Briefly, cells are grown in Minimum Essential Mediasupplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA) and 1%Penicillin / Streptomycin / L-Glutamine at 37 ºC, 5% CO2, and 95% humidity. Cells are expandeduntil reaching 70-95% confluency at which point they are sub-cultured or harvested for assay use. A serial dilution of test compound is dispensed into a 384-well black clear bottom plate intriplicate. 750 cells are added per well in 50 µL complete growth medium in the 384-well plate.Plates are incubated for 115 to 120 h at 37 ºC, 5% CO2, and 95% humidity. At the end of theincubation, 40 µL of a 440 mM solution of resazurin (Sigma, St. Louis, MO) in PBS is added toeach well of the plate and plates are incubated for an additional 18 to 24 h at 37 ºC, 5% CO2, and95% humidity. Plates are read on a Synergy2 or equivalent reader (Biotek, Winooski, VT) usingan excitation of 540 nm and an emission of 600 nm. Data is analyzed using Prism software(Graphpad, San Diego, CA) to calculate IC50values.Pa16c Cell Proliferation Assay[000216] Pa16c cells are obtained from Dr. Channing Der, University of North Carolina at ChapelHill. Briefly, cells are grown in Dulbecco’s Modified Eagle Medium supplemented with 10%characterized fetal bovine serum (Invitrogen, Carlsbad, CA) and 1% Penicillin / Streptomycin / L-Glutamine at 37 ºC, 5% CO2, and 95% humidity. Cells are expanded until reaching 70-95%confluency at which point they are sub-cultured or harvested for assay use. A serial dilution of testcompound is dispensed into a 384-well black clear bottom plate in triplicate. 750 cells are addedper well in 50 µL complete growth medium in the 384-well plate. Plates are incubated for 67 to72h at 37 ºC, 5% CO2, and 95% humidity. At the end of the incubation, 40 µL of a 440 mM solutionof resazurin (Sigma, St. Louis, MO) in PBS is added to each well of the plate and plates areincubated for an additional 18 to 24 h at 37 ºC, 5% CO2, and 95% humidity. Plates are read on aSynergy2 or equivalent reader (Biotek, Winooski, VT) using an excitation of 540 nm and anemission of 600 nm. Data is analyzed using Prism software (Graphpad, San Diego, CA) tocalculate IC50 values. Table 2. Inhibition of cell proliferation in MiaPaca-2, HCT-116, HPAF-II and Pa16c by exemplary compounds (“Ex No”). Ex No MiaPaca-2 HCT-116 HPAF-II Pa16c9 + + ++ +10 + + + +11 +++12 ++13 ++14 +++15 ++++16 +++17 ++18 +++19 ++++20 +++21 ++22 +23 ++++24 +++25 +++26 +++27 ++++28 ++++29 ++++30 +++31 +++32 +33 +++34 ++++35 +++36 +++37 ++++38 +39 +++ ++++ +++ +++40 + ++ ++ +70 ++++ ++++ ++++ ++++71 +++ + + +; “+++” refers to an IC50greater than 100 nM and less than or equal to 500 nM; “++” refers to an IC50greater than 500 nM and lessthan or equal to 1000 nM; and “+” refers to an IC50 greater than 1000 nM and less than or equal to10000 nM. Biochemical Tubulin Polymerization Assay[000217] Porcine Brain Tubulin (T240) and Tubulin Polymerization Assay Kit (BK011P) arepurchased from Cytoskeleton, Inc (Denver, CO). Briefly, a serial dilution of test compound isdispensed into a 384-well black plate in triplicate. 25 µL of an assay mixture containing Buffer,Glycerol, GTP, and Porcine Brain Tubulin from the assay kit are added to each well of the 384-well plate. Plates are briefly centrifuged, then read on a Synergy Neo2 or equivalent reader(BioTek, Winooski, VT) using an excitation of 335 nm and an emission of 450 nm every 2 min for 1 h at 37 ºC to generate kinetic data and maximum velocity of polymerization from 0 to 1 h. Data is analyzed using Prism software (Graphpad, San Diego, CA) to calculate IC50 values.[000218] FIG. 1 represents the maximum velocity of tubulin polymerization in the presence ofincreasing concentrations of the known tubulin depolymerizer plinabulin. In this recombinantbiochemical tubulin assay, plinabulin inhibits tubulin polymerization with an IC50of 2.7 ^M. Cellular Tubulin Polymerization Assay[000219] HCT-116 cells (catalog #CCL-247) are obtained from the American Type CultureCollect (ATCC, Manassas, VA). Briefly, cells are grown in McCoy’s 5A supplemented with 10%characterized fetal bovine serum (Invitrogen, Carlsbad, CA) and 1% Penicillin / Streptomycin / L-Glutamine at 37 ºC, 5% CO2, and 95% humidity. Cells are expanded until reaching 70-95%confluency at which point they are sub-cultured or harvested for assay use. 450000 cells are addedper well in 1500 µL complete growth medium in a tissue culture treated, 12-well plate. Plates areincubated for 18 to 24 h at 37 ºC, 5% CO2, and 95% humidity. At the end of the incubation, 2000µL of base culture media is added to each well, followed by a serial dilution of compound. Platesare incubated for an additional 1 h at 37 ºC, 5% CO2, and 95% humidity. Lysates are generated bythe addition of 100 µL Lysis and Microtubule Stabilization Buffer 1 (LMS01, Cytoskeleton Inc,Denver, CO) supplemented with GTP (BST06, Cytoskeleton Inc), ATP (BSA04, Cytoskeleton Inc), and Protease Inhibitor Cocktail Stock (PIC02, Cytoskeleton Inc). Cells are scraped off wellsusing a rubber cell scraper and collected in a clean 96-well plate. Lysates are centrifuged at 1000xg, 37 ºC for 10 min and supernatant fraction is placed into an additional 96-well plate. Theremaining pellet fraction is reconstituted in 100 µL LMS01 buffer and sonicated for 10 min. Pelletand Supernatant fractions are probed for ^-tubulin via western blot analysis on the Jess System orequivalent (Bio-techne, Minneapolis, MN). Data is analyzed using Prism software (Graphpad, SanDiego, CA) to calculate IC50 values.[000220] FIG.2 represents the ratio of pellet (polymerized tubulin) to supernatant (tubulin dimers)compared to the DMSO control for increasing concentrations of the known tubulin depolymerizerplinabulin. In this cellular tubulin assay, plinabulin inhibits tubulin polymerization with an IC50 of5 nM.[000221] The compounds disclosed herein unexpectedly exhibit a dual mechanism of action by 1)inhibiting BRAF and CRAF MAP kinases, and 2) inhibiting tubulin polymerization. Whileinhibition of such dual mechanism may be achieved by combining several anti-cancer agents, thecompounds disclosed herein provide such dual inhibition within the same pharmacophore. Thisunexpected dual mechanism of action enables single agent potent inhibition of mutant RAS cancer cell lines, not achievable with previously reported BRAF / CRAF inhibitors.[000222] Representative examples are illustrated in Table 3. These examples inhibit BRAF andCRAF with biochemical IC50 values as shown in Table 3. These examples also inhibit tubulinpolymerization in the Tubulin Biochemical assay. In cellular assays, these examples exhibit potentsingle agent anti-proliferative activity in the MiaPaca-2 mutant KRAS pancreatic cancer cell line, potent single agent anti-proliferative activity in the HCT-116 mutant KRAS colorectal cancer cellline, and potent single agent anti-proliferative activity in the HPAF-II mutant KRAS pancreaticcancer cell line.[000223] Other chemical classes of reported BRAF and / or CRAF inhibitors are shown in Table 4.While these compounds inhibit BRAF and / or CRAF, none of them potently inhibits tubulinpolymerization. The compounds of Table 4 exhibit weaker anti-proliferative activity in theMiaPaca-2 mutant KRAS pancreatic cancer cell line, weaker anti-proliferative activity in the HCT- 116 mutant KRAS colorectal cancer cell line, and weaker anti-proliferative activity in the HPAF- II mutant KRAS pancreatic cancer cell line.Table 3. Representative CompoundsExStructure BRAF CRAF TubulinTubulin MiaPaca- HCT- HPAF- ++19 ++++ ++++ *** ++++ ++++ ++++ ++++++++++++For Table 3, for BRAF, CRAF, MiaPaca-2. HCT-116, HPAF-II, and Tubulin cellular assay, “++++” refers to an IC50less than or equal to 100 nM; “+++” refers to an IC50greater than 100 nM and less than or equal to 500 nM; “++” refers to an IC50 greater than 500 nM and less than or equal to 1000 nM; and “+” refers to an IC50greater than 1000 nM and less than or equal to 10000nM; for Tubulin Biochemical assay, “****” refers to an IC50 less than or equal to 3 ^M; “***”refers to an IC50greater than 3 ^M and less than or equal to 20 ^M; “**” refers to an IC50greater than 20 ^M and less than or equal to 100 ^M; and “*” refers to an IC50greater than 100 ^M.Table 4. Previously disclosed BRAF / CRAF inhibitorscompound BRAF CRAF TubulinTubulin MiaPaca- HCT- HPAFFor Table 4, for BRAF, CRAF, MiaPaca-2. HCT-116, HPAF-II, and Tubulin cellular assay, “++++” refers to an IC50 less than or equal to 100 nM; “+++” refers to an IC50 greater than 100 nM and less than or equal to 500 nM; “++” refers to an IC50 greater than 500 nM and less than or equal to 1000 nM; and “+” refers to an IC50greater than 1000 nM and less than or equal to 10000nM; for Tubulin Biochemical assay, “****” refers to an IC50 less than or equal to 3 ^M; “***”refers to an IC50 greater than 3 ^M and less than or equal to 20 ^M; “**” refers to an IC50 greater than 20 ^M and less than or equal to 100 ^M; and “*” refers to an IC50 greater than 100 ^M. EQUIVALENTS[000224] While specific embodiments have been discussed, the above specification is illustrativeand not restrictive. Many variations of the embodiments will become apparent to those skilled inthe art upon review of this specification. The full scope of what is disclosed should be determined by reference to the claims, along with their full scope of equivalents, and the specification, along with such variations.[000225] Unless otherwise indicated, all numbers expressing quantities of ingredients, reactionconditions, and so forth used in the specification and claims are to be understood as being modifiedin all instances by the term “about.” Accordingly, unless indicated to the contrary, the numericalparameters set forth in this specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained.

Claims

CLAIMS What is claimed is:

1. A compound represented by Formula I-A:or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:X1 and X4 are each independently selected from the group consisting of CH and N;X2 is selected from the group consisting of N, CH, C-N(R4)-L-E, and N-L-E;X3 is selected from the group consisting of N, CH, C-Q-L-E, C-L-E, and N-L-E;Q is selected from the group consisting of O and N(R4);X5and X6are each independently selected from the group consisting of CH, CF, and N; X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than two of X1, X2, X3, and X4is N; provided that not more than one of X5and X6is N; provided that not more than one of X7, X8, and X9is N; provided that when X2is N, X3is C-Q-L-E, C-L-E, N, or CH; provided that when X3is N, X2is N, CH, or C-N(R4)-L-E; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R2 is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, andamine; R3is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, and halogen, or wherein two occurrences of R3are optionally taken together with the carbon atoms to which they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in the ring structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at each occurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN, and halogen;R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, and cyano; andm is 0, 1, 2, 3, or 4, provided that when X2is N, X8is CR5, and X7and X9are CH, R5is not N(CH3)2; when X2is N, X1, X3, and X4are CH, one of X7, X8, and X9is N and the other two remaining of X7, X8, and X9are CH, R2is not H; and when X7and X9are CH, X8is CR5, R2is H, R5is CF3, X2is N, and X1and X4are CH, X3or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:X1 and X4 are each independently selected from the group consisting of CH and N;X2 is selected from the group consisting of N, CH, C-N(R4)-L-E, and N-L-E;X3 is selected from the group consisting of N, CH, C-Q-L-E, C-L-E, and N-L-E;Q is selected from the group consisting of O and N(R4);X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than one of X3 and X4 is N;provided that not more than one of X7, X8, and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R2is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, and amine; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X2is N, X8is CR5, and X7and X9are CH, R5is not N(CH3)2; when X2is N, X1, X3, and X4are CH, one of X7, X8, and X9is N and the other two remaining of X7, X8, and X9are CH, R2is not H; and when X7and X9are CH, X8is CR5, R2is H, R5is CF3, X2is N, and X1and X4are CH, X3is not .3.I-C:or a pharmaceuticall mer thereof, wherein:X3 is selectedo e g oup co s s g o , , - - - , - -E, and N-L-E;Q is selected from the group consisting of O and N(R4);X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than one of X7, X8, and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R2is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, and amine; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided thatwhen X8is CR5and X7and X9are CH, R5is not N(CH3)2; when X1, X3, and X4are CH, one of X7, X8, and X9is N and the other two remaining of X7, X8, and X9are CH, R2is not H; and when X7and X9are CH, X8is CR5, R2is H, R5is CF3, and X1and X4are CH, X3is not .mula I-D:or a pharmaceutical, , , er thereof, wherein:Q is selected from the group consisting of O and N(R4);X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than one of X7, X8, and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R2is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, and amine; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl;L is selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X8 is CR5 and X7 and X9 are CH, R5 is not N(CH3)2; andwhen X7and X9are CH, X8is CR5, R2is H, R5is CF3, and X1and X4are CH, Q-L-E is not .y Formula I-E:or a pharmaceuticall er thereof, wherein:X7 and X9 are each independently selected from the group consisting of CH and N;X8is selected from the group consisting of CR5and N; provided that not more than one of X7, X8, and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R2is selected from the group consisting of H, halogen, haloalkyl, alkyl, cycloalkyl, and amine; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; andm is 0, 1, 2, 3, or 4; provided that when X8is CR5and X7and X9are CH, R5is not N(CH3)2; and when one of X7, X8, and X9is N and the other two remaining of X7, X8, and X9are CH, R2is not H.

6. A compound represented by Formula I-F:or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:X1 and X4 are each independently selected from the group consisting of CH and N;X2 is selected from the group consisting of N, CH, C-N(R4)-L-E, and N-L-E;X3 is selected from the group consisting of N, CH, C-Q-L-E, C-L-E, and N-L-E;Q is selected from the group consisting of O and N(R4);X5and X6are each independently selected from the group consisting of CH, CF, and N; X7 and X9 are each independently selected from the group consisting of CH and N;provided that not more than two of X1, X2, X3, and X4is N; provided that not more than one of X5and X6is N; provided that not more than one of X7and X9is N; provided that when X2is N, X3is C-Q-L-E, C-L-E, N, or CH; provided that when X3is N, X2is N, CH, or C-N(R4)-L-E; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X2 is N, and X7 and X9 are CH, R5 is not N(CH3)2;when X2is N, X1, X3, and X4are CH, one of X7and X9is N and the other of X7and X9isCH, R5 is not H; andwhen X7and X9are CH, R5is CF3, X2is N, and X1and X4are CH, X3is n ,.ented by Formula I-G:or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:X3 is selected from the group consisting of N, CH, C-Q-L-E, C-L-E, and N-L-E;Q is selected from the group consisting of O and N(R4);X7 and X9 are each independently selected from the group consisting of CH and N;provided that not more than one of X7and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5 is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl;L is selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X2is N, and X7and X9are CH, R5is not N(CH3)2; when X2is N, X1, X3, and X4are CH, one of X7and X9is N and the other of X7and X9is CH, R5is not H; and when X7 and X9 are CH, and R5 is CF3, X3 is no.

8. A compound represented by Formula I-H:or a pharmaceuticall mer thereof, wherein:Q is selected from t e group cons st ng o an ( );X7 and X9 are each independently selected from the group consisting of CH and N;provided that not more than one of X7and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4; provided that when X7and X9are CH, R5is not N(CH3)2;when X7 and X9 are CH and R5 is CF3, Q-L-E is not or.

9. A compound represented by Formula I-J:or a pharmaceuticallyaccepta e sa t, enant omer, stereo somer, or tautomer thereof, wherein:X7 and X9 are each independently selected from the group consisting of CH and N;provided that not more than one of X7and X9is N; R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; andm is 0, 1, 2, 3, or 4; provided that when X7and X9are CH, R5is not N(CH3)2; and when one of X7and X9is N and the other of X7and X9is CH, R5is not H.

10. A compound represented by Formula I-K:or a pharmaceuticall er thereof, wherein:Q is selectedrom t e group cons st ng o O and N( );R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen; R4is selected from the group consisting of H and alkyl; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl, alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; Lis selected from the group consisting of a direct bond and optionally substituted C1-C6alkyl; Eis selected from the group consisting of H, alkyl, hydroxy, cycloalkyl, alkoxy,haloalkoxy, alkoxyalkyl, amine, heteroaryl, and optionally substituted heterocyclyl wherein theoptionally substituted substituent, at each occurrence, is independently selected from the groupconsisting of alkyl, halogen, amine, hydroxy, oxo, and cyano; andm is 0, 1, 2, 3, or 4.

11. A compound represented by Formula I-L:or a pharmaceuticall er thereof, wherein:R1is selectedrom t e group cons st ng o a y , , a ogen, an alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms inthe ring structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, ateach occurrence, with a substituent selected from the group consisting of alkyl, haloalkyl,alkoxy, CN, and halogen; R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; andm is 0, 1, 2, 3, or 4.

12. A compound represented by Formula I-M:or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein:R1is selected from the group consisting of alkyl, H, halogen, and alkoxy; R3 is selected from the group consisting of H, alkyl, haloalkyl, alkoxy, haloalkoxy, andhalogen, or wherein two occurrences of R3 are optionally taken together with the carbon atoms towhich they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in thering structure, wherein said cycloalkyl or the heterocyclyl ring is optionally substituted, at eachoccurrence, with a substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN,and halogen;R5is selected from the group consisting of haloalkyl, cycloalkyl, cyano, H, alkyl, alkenyl,alkoxy, amine, amide, halogen, phosphine oxide, haloalkoxy, and cyanoalkyl; andm is 0, 1, 2, 3, or 4.

13. The compound of any one of claims 1, 2 and 6, wherein X1 is CH.

14. The compound of any one of claims 1, 2, 6 and 13, wherein X2 is N.

15. The compound of any one of claims 1, 2, 6, 13, and 14, wherein X3 is selected from thegroup consisting of N, CH, C-O-L-E, and C-N(R4)-L-E.

16. The compound of any one of claims 1, 2, 6, and 13-15, wherein X3 is selected from thegroup consisting of N and CH.

17. The compound of any one of claims 1, 2, 6, and 13-15, wherein X3 is selected from thegroup consisting of C-O-CH(R4)-CH2-OH and C-NH-CH(R4)-CH2-OH.

18. The compound of any one of claims 1, 2, 6 and 13-17, wherein X5 is CH.

19. The compound of claim 1, 2, or 6, wherein the ring containing X2, X3, X4, and X5 is selectedfrom the group consisting of:s1 s2 s1 s2 s1 N s2 s1 s2 s1 s2N 2 , s2,indicates attachment to the ring comprising X5and X6.

20. The compound of any one of claims 1, 6, and 13-19, wherein X5 is CH.

21. The compound of any one of claims 1, 6, and 13-20, wherein X6 is CH.

22. The compound of any one of claims 1-9, and 13-21, wherein X7 is N.

23. The compound of any one of claims 1-5, and 13-22, wherein X8 is CR5.

24. The compound of any one of claims 1-5 and 13-23, wherein R5 is selected from the groupconsisting of alkyl, cycloalkyl, haloalkyl and halogen.

25. The compound of any one of claims 1-9, and 13-24, wherein X9 is CH.

26. The compound of any one of claims 1-25, wherein R1 is selected from the group consistingof alkyl and halogen.

27. The compound of any one of claims 1-26, wherein R1 is selected from the group consistingof methyl.

28. The compound of any one of claims 1-27, wherein R2 is selected from the group consistingof H, halogen, alkyl, alkoxy, amine, and haloalkyl.

29. The compound of any one of claims 1-28, wherein R2 is selected from the group consistingof trifluoromethyl and H.

30. The compound of any one of claims 1-29, wherein R3 is selected from the group consistingof H, alkyl, haloalkyl, alkoxy, haloalkoxy, and halogen, or wherein two occurrences of R3are optionally taken together with the carbon atoms to which they are attached to form a cycloalkyl or a heterocyclyl ring having from 3 to 7 atoms in the ring structure, whereinsaid cycloalkyl or the heterocyclyl ring is optionally substituted, at each occurrence, witha substituent selected from the group consisting of alkyl, haloalkyl, alkoxy, CN, andhalogen.

31. The compound of any one of claims 1-30, wherein the ring containing (R3)m is selected thegroup consisting of: .

32. The compound of any one of claims 1-31, wherein the ring containing (R3)m .

33. The compound of any one of claims 1-4, 6-8, 10, and 13-32, wherein R4 is H.

34. The compound of any one of claims 1-33, wherein R5 is selected from the group consistingof H, alkyl, alkenyl, alkoxy, amine, amide, haloalkyl, cycloalkyl, phosphine oxide, halogen, haloalkoxy, cyano, and cyanoalkyl.

35. The compound of any one of claims 1-34, wherein R5 is selected from the group consistingof H, trifluoromethyl, isopropyl, cyclopropyl, cyclobutyl, alkenyl, cyano, chloro, bromo,.36.ed from the group consistingof trifluoromethyl, cyclopropyl, and .

37. The compound of any one of claims- , wherein R5 is trifluoromethyl.

38. The compound of any one of claims 1-4, 6-8, 10, and 13-37, wherein L is optionallysubstituted C1-C6alkyl.

39. The compound of any one of claims 1-4, 6-8, 10, and 13-38, wherein L is selected fromthe group consisting f .

40. The compound of any one of claims 1-4, 6-8, 10, and 13-39, wherein L is selected fromthe group consisting .

41. The compound of any one of claims 1-4, 6-8, 10, and 13-40, wherein E selected from thegroup consisting of H, methyl, cyclopropyl, and hydroxy.

42. A compound selected from the group consisting of:. 1-42, or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, and a pharmaceutically acceptable carrier or excipient.

44. A method of treating a cancer in a patient in need thereof, comprising administering to thepatient a therapeutically effective amount of the compound of any one of claims 1-42, or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, or of the pharmaceutical composition of claim 43.

45. The method of claim 44, wherein the cancer is selected from the group consisting ofmelanoma, multiple myeloma, thyroid cancer, ovarian cancer, colon cancer, pancreatic cancer, lung cancer, bladder cancer, gastrointestinal stromal tumors, solid tumors, brain cancers, gliomas, glioblastomas, astrocytomas, blood-borne cancers, acute myelogenous leukemia (AML), and other cancers caused by activation of the RAS ^RAF ^MEK ^ ERK signaling pathway.

46. The method of claim 44 or 45, wherein the cancer has a BRAF oncogenic mutation.

47. The method of any one of claims 44-46, wherein the cancer has a RAS oncogenic mutation.

48. The method of any one of claims 44-47, wherein the cancer has a NRAS oncogenicmutation.

49. The method of claim 48, wherein the NRAS oncogenic mutation is NRAS Q61R or NRASQ61K mutation.

50. The method of any one of claims 44-49, wherein the cancer has a KRAS oncogenicmutation.

51. The method of claim 50, wherein the KRAS oncogenic mutation is KRAS G12D, KRASG12V, KRAS G12C, KRAS G12R, or KRAS G13D.

52. The method of any one of claims 44-51, wherein the cancer has a NF1 oncogenic mutation.

53. A method of treating a disorder selected from the group consisting of melanoma, multiplemyeloma, thyroid cancer, ovarian cancer, colon cancer, pancreatic cancer, lung cancer, bladder cancer, gastrointestinal stromal tumors, solid tumors, brain cancers, gliomas, glioblastomas, astrocytomas, blood-borne cancers, acute myelogenous leukemia (AML), and other cancers caused by activation of the RAS ^RAF ^MEK ^ ERK signalingpathway in a patient in need thereof, comprising administering to the patient atherapeutically effective amount of the compound of any one of claims 1-42, or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, or of the pharmaceutical composition of claim 43.

Images