Treating cancer

By engineering T cells with reduced IL-4R, IL-4, TCF7, PTPN2, PTPN3, or IL-4 enhancer levels, the challenge of T cell exhaustion in CAR T cell therapies is addressed, resulting in improved durability and efficacy against cancer.

WO2025231208A1PCT designated stage Publication Date: 2025-11-06MAYO FOUNDATION FOR MEDICAL EDUCATION & RESEARCH
View PDF 4 Cites 0 Cited by

Patent Information

Application Number
PCT/US2025/027239
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-05-01
Filing Date
2025-05-01
Publication Date
2025-11-06

AI Technical Summary

Technical Problem

CAR T cell therapies face limitations due to T cell exhaustion, which leads to decreased proliferation and efficacy, with durable response rates remaining at approximately 40% in treating hematological malignancies.

Method used

Engineering T cells, such as CAR T cells, with reduced levels of IL-4R polypeptide, IL-4 polypeptide, TCF7 polypeptide, PTPN2 polypeptide, and/or PTPN3 polypeptide, or reduced activity of the IL-4 enhancer, to enhance their resistance to exhaustion and maintain antitumor activity.

Benefits of technology

The engineered T cells exhibit enhanced function and prolonged antitumor activity, reducing the rapid onset of T cell exhaustion and improving the efficacy of CAR T cell therapies.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure IMGF000034_0001
    Figure IMGF000034_0001
  • Figure IMGF000035_0001
    Figure IMGF000035_0001
  • Figure IMGF000036_0001
    Figure IMGF000036_0001
Patent Text Reader

Abstract

This document relates to methods and materials involved in treating cancer. For example, methods and materials for using chimeric antigen receptor (CAR) T cells having reduced levels of an interleukin (IL) 4 polypeptide, having reduced levels of a transcription factor 7 (TCF7) polypeptide, having reduced levels of a protein tyrosine phosphatase non-receptor type 2 (PTPN2) polypeptide, and / or having reduced levels of a protein tyrosine phosphatase non-receptor type 3 (PTPN3) polypeptide are provided. Methods and materials for using such CAR T cells in an adoptive cell therapy (e.g., a CAR T cell therapy) to treat a mammal (e.g., a human) having cancer also are provided
Need to check novelty before this filing date? Find Prior Art

Description

[0001] TREATING CANCER

[0002] CROSS-REFERENCE TO RELATED APPLICATIONS

[0003] This application claims priority to U.S. Application Serial No. 63 / 641,315, filed on May 1, 2024. The disclosure of the prior application is considered part of the disclosure of this application, and is incorporated in its entirety into this application.

[0004] Sequence Listing

[0005] This application contains a Sequence Listing that has been submitted electronically as an XML file named “07039-2335WO1.XML.” The XML file, created on April 30, 2025, is 20,480 bytes in size. The material in the XML file is hereby incorporated by reference in its entirety7.

[0006] TECHNICAL FIELD

[0007] This document relates to methods and materials involved in treating cancer. For example, this document provides methods and materials for using chimeric antigen receptor (CAR) T cells having reduced levels of an interleukin-4 receptor (IL-4R) polypeptide and / or having reduced activity of an IL-4 enhancer, and optionally also having reduced levels of an IL-4 polypeptide, having reduced levels of a transcription factor 7 (TCF7) polypeptide, having reduced levels of a protein tyrosine phosphatase nonreceptor type 2 (PTPN2) polypeptide, and / or having reduced levels of a protein ty rosine phosphatase non-receptor type 3 (PTPN3) polypeptide. This document also provides methods and materials for using such CAR T cells in an adoptive cell therapy (e.g.. a CAR T cell therapy) to treat a mammal (e.g., a human) having cancer.

[0008] BACKGROUND INFORMATION

[0009] CAR T cell therapy targeting CD19 (CART19) has shown remarkable overall response rates in the treatment of hematological malignancies. However, durable response rates remain at approximately 40%. CAR T cell in vivo functions depend on their associated cell fate following infusion. Thus, the success of CAR T cell therapies relies on the survival, proliferation, and continued efficacy of the CAR T cells. T cell exhaustion, an acquired state of T cell dysfunction that is associated with decreased proliferation and efficacy, is widely considered a major limitation of CAR T cell therapy.

[0010] SUMMARY

[0011] This document provides methods and materials for generating T cells (e.g., CAR T cells) having a reduced level of an IL-4R polypeptide, and optionally also having a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide. For example, a T cell (e.g., a CAR T cell) can be engineered to have reduced IL-4R polypeptide expression (e.g., for use in adoptive cell therapy). In some cases, a T cell (e.g., a CAR T cell) can be engineered to knock out (KO) a nucleic acid encoding an IL- 4R polypeptide to reduce IL-4R polypeptide expression in that T cell. In another example, aT cell (e.g., a CAR T cell) can be engineered to have reduced IL-4R polypeptide expression in combination with reduced IL-4 polypeptide expression (e.g., for use in adoptive cell therapy). In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid encoding an IL-4R polypeptide and to KO a nucleic acid encoding an IL-4 polypeptide, to reduce IL-4R polypeptide expression and IL-4 polypeptide expression in that T cell. In another example, a T cell (e.g., a CAR T cell) can be engineered to have reduced IL-4R polypeptide expression in combination with reduced TCF7 polypeptide expression (e.g., for use in adoptive cell therapy). In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid encoding an IL-4R polypeptide and to KO a nucleic acid encoding a TCF7 polypeptide, to reduce IL-4R polypeptide expression and TCF7 polypeptide expression in that T cell. In another example, a T cell (e.g., a CAR T cell) can be engineered to have reduced IL-4R polypeptide expression in combination with reduced PTPN3 polypeptide expression (e.g., for use in adoptive cell therapy). In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid encoding an IL-4R polypeptide and to KO a nucleic acid encoding a PTPN3 polypeptide, to reduce IL-4R polypeptide expression and PTPN3 polypeptide expression in that T cell.

[0012] This document also provides methods and materials for generating T cells (e g., CAR T cells) having a reduced activity of an IL-4 enhancer, and optionally also having a reduced level of an IL-4R polypeptide, a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide. For example, aT cell (e.g., a CAR T cell) can be engineered to have reduced activity of an IL-4 enhancer (e.g., for use in adoptive cell therapy). In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid containing an IL-4 enhancer to reduce IL-4 polypeptide expression in that T cell. For example, a T cell (e.g., a CAR T cell) can be engineered to have reduced activity of an IL- 4 enhancer in combination with a reduced level of IL-4R polypeptide expression (e.g., for use in adoptive cell therapy). In some cases, aT cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid containing an IL-4 enhancer and to KO a nucleic acid encoding an IL-4R polypeptide, to reduce IL-4 polypeptide expression and to reduce IL- 4R polypeptide expression in that T cell. In another example, a T cell (e.g., a CAR T cell) can be engineered to have reduced IL-4 enhancer activity in combination with reduced IL-4 polypeptide expression (e.g., for use in adoptive cell therapy). In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid containing an IL-4 enhancer and to KO a nucleic acid encoding an IL-4 polypeptide, to reduce IL-4 polypeptide expression in that T cell. In another example, a T cell (e.g., a CAR T cell) can be engineered to have reduced IL-4 enhancer activity in combination with reduced TCF7 polypeptide expression (e.g.. for use in adoptive cell therapy). In some cases, a T cell (e.g.. a CAR T cell) can be engineered to KO a nucleic acid containing an IL-4 enhancer and to KO a nucleic acid encoding a TCF7 polypeptide, to reduce IL-4 polypeptide expression and TCF7 polypeptide expression in that T cell. In another example, a T cell (e.g., a CAR T cell) can be engineered to have reduced IL-4 enhancer activity in combination with reduced PTPN3 polypeptide expression (e.g.. for use in adoptive cell therapy). In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid containing an IL-4 enhancer and to KO a nucleic acid encoding a PTPN3 polypeptide, to reduce IL -4 poly peptide expression and PTPN3 polypeptide expression in that T cell.

[0013] This document also provides methods and materials for using T cells (e.g., CAR T cells) having a reduced level of an IL-4R polypeptide and / or having reduced activity of an IL-4 enhancer, optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide. For example, T cells (e.g.. CAR T cells) having a reduced level of an IL-4R polypeptide and / or having reduced activity of an IL-4 enhancer, optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be administered (e.g., in an adoptive cell therapy) to a mammal (e.g., a human) having cancer to treat the mammal’s cancer.

[0014] As demonstrated herein, IL-4R polypeptides, as well as IL-4 polypeptides, TCF7 polypeptides, and PTPN3 polypeptides, are mediators of CAR T cell exhaustion. Also as demonstrated herein, CAR T cells having a reduced level of an IL-4R polypeptide (e.g., IL-4R KO CAR T cells), a reduced level of activity of an IL-4 enhancer, a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) are less susceptible to T cell exhaustion, and therefore demonstrate enhanced CAR T cell function and antitumor activity. In some cases, CAR T cells having a reduced level of an IL-4R polypeptide (e.g., IL-4R KO CAR T cells), CAR T cells having a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) can be incorporated into adoptive T cell therapies (e.g., CAR T cell therapies) to treat, for example, mammals having cancer.

[0015] In general, one aspect of this document features T cells having reduced susceptibility to T cell exhaustion, wherein the T cell comprises (a) a reduced level of an IL-4R polypeptide, and (b) nucleic acid encoding a chimeric antigen receptor, and wherein the T cell expresses the chimeric antigen receptor. The T cell can include a disruption in at least one endogenous allele encoding the IL-4R polypeptide. The T cell can include a disruption in both endogenous alleles encoding the IL-4R polypeptide. The T cell can express a reduced level of the IL-4R polypeptide as compared to a comparable T cell lacking the disruption. The T cell can include a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, or a reduced level of a PTPN3 polypeptide. The T cell can include a reduced level of an IL-4 polypeptide. The T cell can include a disruption in at least one endogenous allele encoding the IL-4 polypeptide. The T cell can include a disruption in both endogenous alleles encoding the IL-4 polypeptide. The T cell can express a reduced level of the TL-4 polypeptide as compared to a comparable T cell lacking the disruption. The T cell can include a reduced level of a TCF7 polypeptide. The T cell can include a disruption in at least one endogenous allele encoding a TCF7 polypeptide. The T cell can include a disruption in both endogenous alleles encoding a TCF7 polypeptide. The T cell can express a reduced level of the TCF7 polypeptide as compared to a comparable T cell lacking the disruption. The T cell can include a reduced level of a PTPN2 polypeptide. The T cell can include a disruption in at least one endogenous allele encoding a PTPN2 polypeptide. The T cell can include a disruption in both endogenous alleles encoding a PTPN2 polypeptide. The T cell can express a reduced level of the PTPN2 polypeptide as compared to a comparable T cell lacking the disruption. The T cell can include a reduced level of a PTPN3 polypeptide. The T cell can include a disruption in at least one endogenous allele encoding a PTPN3 polypeptide. The T cell can include a disruption in both endogenous alleles encoding a PTPN3 polypeptide. The T cell can express a reduced level of the PTPN3 polypeptide as compared to a comparable T cell lacking the disruption. The chimeric antigen receptor can target a tumor-associated antigen. The tumor-associated antigen can be CD 19. The T cell can be obtained from a human. The T cell can exhibit anti-tumor activity for at least 1 week. The T cell can exhibit anti-tumor activity for from about 1 week to about 2 years. The T cell can exhibit proliferation for at least 1 week. The T cell does not exhibit T cell exhaustion as rapidly as a comparable T cell lacking the reduced level of the IL-4R polypeptide.

[0016] In another aspect, this document features T cells having reduced susceptibility to T cell exhaustion, wherein the T cell comprises (a) reduced activity of an IL-4 enhancer, and (b) nucleic acid encoding a chimeric antigen receptor, and wherein the T cell expresses the chimeric antigen receptor. The T cell can include a disruption in at least one endogenous allele comprising the IL-4 enhancer. The T cell can include a disruption in both endogenous alleles comprising the IL-4 enhancer. The IL-4 enhancer can be an HS2 enhancer. The T cell can include a reduced level of an IL-4R polypeptide, a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide or a reduced level of a PTPN3 polypeptide. The T cell can include a reduced level of an IL-4R polypeptide. The T cell can include a disruption in at least one endogenous allele encoding the IL-4R polypeptide. The T cell can include a disruption in both endogenous alleles encoding the IL-4R polypeptide. The T cell can express a reduced level of the IL-4R polypeptide as compared to a comparable T cell lacking the disruption. The T cell can include a reduced level of an IL-4 polypeptide. The T cell can include a disruption in at least one endogenous allele encoding the IL-4 polypeptide. The T cell can include a disruption in both endogenous alleles encoding the IL-4 polypeptide. The T cell can express a reduced level of the IL-4 polypeptide as compared to a comparable T cell lacking the disruption. The T cell can include a reduced level of a TCF7 polypeptide. The T cell can include a disruption in at least one endogenous allele encoding a TCF7 polypeptide. The T cell can include a disruption in both endogenous alleles encoding a TCF7 polypeptide. The T cell can express a reduced level of the TCF7 polypeptide as compared to a comparable T cell lacking the disruption. The T cell can include a reduced level of a PTPN2 polypeptide. The T cell can include a disruption in at least one endogenous allele encoding a PTPN2 polypeptide. The T cell can include a disruption in both endogenous alleles encoding a PTPN2 polypeptide. The T cell can express a reduced level of the PTPN2 polypeptide as compared to a comparable T cell lacking the disruption. The T cell can include a reduced level of a PTPN3 polypeptide. The T cell can include a disruption in at least one endogenous allele encoding a PTPN3 polypeptide. The T cell can include a disruption in both endogenous alleles encoding a PTPN3 polypeptide. The T cell can express a reduced level of the PTPN3 polypeptide as compared to a comparable T cell lacking the disruption. The chimeric antigen receptor can target a tumor-associated antigen. The tumor-associated antigen can be CD19. The T cell can be obtained from a human. The T cell can exhibit anti-tumor activity for at least 1 week. The T cell can exhibit anti-tumor activity for from about 1 week to about 2 years. The T cell can exhibit proliferation for at least 1 week. The T cell does not exhibit T cell exhaustion as rapidly as a comparable T cell lacking the reduced activity of the IL-4 enhancer.

[0017] In another aspect, this document features methods for treating a mammal having cancer. The methods can include, or consist essentially of. administering, to a mammal having cancer, a composition comprising T cells having reduced susceptibility to T cell exhaustion, wherein the T cell comprises (a) a reduced level of an IL-4R polypeptide and / or a reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), and (b) nucleic acid encoding a chimeric antigen receptor, and wherein the T cell expresses the chimeric antigen receptor. The mammal can be identified as being in need of T cells having reduced susceptibility to CAR T cell exhaustion. The mammal can be a human. The composition can include from about 0.1 x 106to about 10 x 106of the T cells. The cancer can be a lymphoma. The lymphoma can be a diffuse large B cell lymphoma. The cancer can be a leukemia. The leukemia can be an acute lymphoblastic leukemia. The chimeric antigen receptor can target a tumor-associated antigen. The tumor-associated antigen can be CD19.

[0018] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Although methods and materials similar or equivalent to those described herein can be used to practice the invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.

[0019] The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims.

[0020] DESCRIPTION OF THE DRAWINGS

[0021] Fig. 1. A schematic of an assay designed to induce exhaustion in CAR T cells. On Day 15, the CART 19 cells were considered exhausted, assay was continued until Day 22 for more terminally exhausted CAR T-cells.

[0022] Figs. 2A-2C. The exhaustion assay described in Fig. 1 resulted in CAR T cells with a reduced ability to proliferate (Fig. 2A), a reduced CD4+T cell population (Fig. 2B), and a reduced ability to produce 3 or more cytokines at once (Fig. 2C). This shows evidence of CAR T Cell dysfunction. These figures represent data from three biological replicates. * p < 0.05, ** p < 0.01. *** p < 0.001, **** p < 0.0001, one-way ANOVA.

[0023] Figs. 3A-3F. The exhaustion assay described in Fig. 1 resulted in CAR T cells with increased expression of inhibitory' receptors such as PD-1 (Fig. 3A), TIM-3 (Fig. 3B), CTLA-4 (Fig. 3C), and LAG-3 (Fig. 3D) on CAR T cells. The expression of the inhibitory receptors continues to increase as the assay continues from Day 15 to Day 22. Additionally, the exhaustion assay described in Fig. 1 resulted in CAR T cells that exhibited a reduced production of effector cytokines such as IL-2 (Fig. 3E) and TNF-a (Fig. 3F). This showed evidence of exhaustion-specific signs of CAR T-cell dysfunction. These figures represent data from three biological replicates. * p < 0.05, ** p < 0.01, *** p < 0.001, **** p < 0.0001, one-way ANOVA.

[0024] Figs. 4A-4B. CART19-28^ cells from Day 8 and Day 22 of the exhaustion assay described in Fig. 1 were used to treat nod scid gamma (NSG) mice that were engrafted with a CD19+JeKo-1 tumor. Tumor flux measurements indicated increased tumor burden when mice were treated with Day 22 exhausted CART 19-28^ cells as compared to treatment with Day 8 CART 19-28^ cells (Fig. 4A). There was also a decreased probability of survival in mice treated with the Day 22 CARTI 9-28y cells as opposed to the Day 8 CART 19-28^ cells (Fig. 4B). Five mice were included in each group. Tumor flux data was analyzed with two-way ANOVA and overall survival data was analyzed with a Log-rank (Mantel-Cox) test. * p < 0.05, ** p < 0.01, *** p < 0.001, **** p < 0.0001.

[0025] Figs. 5A-5B. Using the in vitro exhaustion assay depicted in Fig. 1 with CAR T cells from three healthy donors, RNA sequencing was performed on Day 8 and Day 15. Comparing RNA sequencing of Day 8 to Day 15 samples revealed the development of a distinct transcriptomic profile (Fig. 5A). This transcriptomic profile was characterized by an upregulation of know n exhaustion genes such as EOMES and IL10RA (Fig. 5B). These figures represent differential gene expression analysis (padj < 0.05) from three biological replicates.

[0026] Fig. 6. Since AT AC sequencing was also performed on Days 8 and 15 of the in vitro exhaustion assays, the genes that were both differentially expressed and differentially accessible were identified by using the sequencing analysis pipeline depicted in Fig. 6.

[0027] Figs. 7A-7B. After determining genes that were both differentially expressed and differentially accessible between Day 8 and Day 15 cells, Ingenuity Pathway Analysis software was used to determine the affected pathways and potential upstream regulators. Pathway analysis revealed an enrichment in the T cell exhaustion pathway (Fig. 7A). Additionally, potential upstream regulators include IL-2, Tcf-7. and IL-4. These figures represent results from differential gene expression analysis (padj < 0.05) and differential gene accessibility analysis (padj < 0.05) from three biological replicates.

[0028] Figs. 8A-8B. In order to determine which transcription factors play a key role in the development of exhaustion, Taiji, a multi-omics data analysis framework was used. Performing Taiji analysis with the RNA and AT AC sequencing from Day 8 and Day 15 revealed an enrichment in several transcription factors in Day 15 samples, including EOMES (Fig. 8A). Additionally, Taiji analysis revealed a reduction in the AP-1 transcription factors FOSB and FOSL2 from Day 8 to Day 15 (Fig. 8A). This figure represents average gene rank values from three biological replicates in each condition. Further, mining of previously conducted ChlPseq experiments with ReMap revealed an increase in accessibility of binding sites for transcription factors such as RUNX3, BATF, and TBX21 in Day 15 samples (Fig. 8B). Differential peak analysis results originated from three biological replicates.

[0029] Fig. 9. To evaluate CAR T-cell dysfunction in a more clinically relevant setting, RNA and AT AC sequencing was performed on baseline Axi-cel products from 3 responders and 3 non-responders from the Zuma-1 clinical trial. After comparing genes that were both differentially expressed and differentially accessible when comparing responders to non-responders, only two genes, IL-4 and HLA-DQB1, were identified (Fig. 9). These genes were upregulated in baseline products from non-responders. Differential gene analysis was performed with six biological replicates in total, three biological replicates per condition. A cut-off of p-value < 0.05 was used for differentially expressed genes.

[0030] Figs. 10A-10B. Taiji analysis was used to investigate the differential role of transcription factors in baseline Axi-cel products from responders and non-responders. It was revealed that GAT A3 and EOMES were enriched in patient non-responders (Fig. 10A). This figure represents average gene rank values from three biological replicates in each condition. Further, mining of previously conducted ChlPseq experiments with ReMap revealed an increase in accessibility of binding sites for transcription factors such as TBX21 and RunX3 in Day 15 samples (Fig. 10B). Differential peak analysis results originated from three biological replicates.

[0031] Fig. 11. After overlapping the differentially expressed genes from the in vitro exhaustion assay and the differentially expressed genes in the comparison of baseline responder and non-responder samples, only one gene was in found to be common, PTPN3.

[0032] Figs. 12A-12B. Addition of PTPN3 cDNA to CART19 cells resulted in a decrease in cytotoxicity (Fig. 12A) and a decrease in proliferation (Fig. 12B). This is evidence of the induction of CAR T-cell dysfunction after PTPN3 polypeptide levels were increased. These figures represent data from one biological replicate with two technical replicates. ** p < 0.01, two-way ANOVA and a student’s t-test, respectively.

[0033] Fig. 13. A schematic of a CRISPR screen designed to identify key genes that could be downregulated to prevent the development of exhaustion.

[0034] Figs. 14A-14C. Overall CRISPR screen results (day 8 vs. day 22). Positive selection occurred in the CRISPR screen as evidenced by an increase in the gini index from Day 8 to Day 22 samples (Fig. 14A). PCA analysis also revealed clustering based on experimental condition as opposed to biological replicate (Fig. 14B). Volcano plot depicting positive and negative selection of genes. Two of the top positively selected genes include PTPN2 and CSF2 (Fig. 14C). Three biological replicates w ere used.

[0035] Figs. 15A-15B. Gene Ontology enrichment analysis of the positively selected genes (p-value < 0.001) when comparing Day 8 to Day 22 samples revealed as enrichment in pathways such as: the regulation of JAK-STAT cascade, negative regulation of IL-2 mediated signaling pathway and negative regulation of IL-4 mediated signaling pathway (Fig. 15 A). Two out of three of the IL-4 targeting gRNAs resulted in a positive fold change after averaging the fold change from three biological replicates (Fig. 15B).

[0036] Figs. 16A-16B. Absolute CD3 counts after 5-days of antigen-specific proliferation of CAR T-cells were treated with either 20 ng / mL human recombinant IL-4 (hrIL-4) or diluent (Fig. 16A). 48-hour cytotoxicity results of CART19-28g cells that were either treated with 20 ng / mL human recombinant IL -4 or treated with vehicle. CART19-28g cells were co-cultured with JeKo-1 cells that express luciferase. Cytotoxicity was measured by luminescence after lucifenn was added to the co-culture. This figure represents data from three biological replicates. * p < 0.05, ** p < 0.01, *** p < 0.001, student’s t-test and two-way ANOVA, respectively.

[0037] Figs. 17A-17B. Continuous treatment of CART19-28^ cells with 20 ng / mL hrIL-4 resulted in an increase in the expression of TIM-3 by Day 15 (Fig. 17A) and an increase in the transcription of EOMES by Day 15 (Fig. 17B). This figure represents data from three biological replicates. ** p < 0.01, student’s t-test.

[0038] Fig. 18. Functional changes seen after the treatment of CART 19-28^ cells with 20 ng / mL hrIL-4 did not appear to be a result of an effect of hrIL-4 on JeKo-1 tumor cells. No significant changes in luminescence were seen when luciferase JeKo-1 cells were treated with 20 ng / mL hrIL-4. This figure represents data from six technical replicates, ns = not statistically significant, student’s t-test.

[0039] Figs. 19A-19C. The efficacy of a combination of CAR T cell therapy + IL-4 neutralization with a monoclonal antibody (mAb) was tested using a JeKo-1 xenograft mouse model in NSG mice. Combination of Day 8 CAR T Cells and 10 mg / kg IL-4 mAb resulted in reduced tumor burden (Fig. 19A), an increase in CAR T cell proliferation (Fig. 19B), and an increase in overall survival as compared to mice treated with Day 8 CAR T Cells (Fig. 19C). Five mice were included in each group. Tumor flux data was analyzed with two-way ANOVA, T cell proliferation was analyzed with a student’s t-test, and overall survival data was analyzed with a Log-rank (Mantel-Cox) test. * p < 0.05, ** p < 0.01, *** p < 0.001, **** p < 0.0001.

[0040] Figs. 20A-20B. There was enhanced chromatin accessibility at exhaustion-related gene loci (e.g., PDCD1 and ENTPDP) in the chronically stimulated samples (Fig. 20A) as well as enhanced motif accessibility for AP-1 and RUNX family members (Fig. 20B).

[0041] Figs. 21A-21 C. To further evaluate CAR T-cell dysfunction, RNA and AT AC sequencing was performed on baseline Axi-cel products from 6 responders and 6 nonresponders from the Zuma-1 clinical trial. Interrogation of the transcriptome with RNA sequencing of pre-infusion axi-cel products from 6 responders and 6 non-responders showed clustering of non-responder samples (Fig. 21 A). One of the top upregulated genes in CAR T cells from non-responders is IL-4 (Fig. 21B). Additionally, analysis of the differentially expressed genes with QIAGEN IPA identified IL-4 as one of the upstream regulators, along with other genes such as TNF and STAT3 (Fig. 21C) Differential gene analysis was performed with twelve biological replicates in total, six biological replicates per condition. A cut-off of p-value < 0.05 was used for differentially expressed genes.

[0042] Figs. 22A-22B. Analysis of chromatin changes between responder and non- responder samples revealed many similarities to the findings observed following chronic stimulation of healthy donor CART 19-28^ cells in the in vitro model for exhaustion. Motif analysis revealed an enrichment of motif binding sites for EOMES and PRDM1 (Fig. 22A). Additionally, non-responders showed similar enhancement of chromatin accessibility to exhausted cell populations at exhaustion-related gene loci such as PDCDJ , HAVCR2 (UM-3), and EOMES (Fig. 22B).

[0043] Fig. 23. Continuous treatment of CART19-28^ cells with 20 ng / mL hrIL-4 resulted in an increase in the percent of CAR T cells expressing multiple inhibitory receptors by Day 15.

[0044] Figs. 24A-24C. Continuous treatment of CAR T cells with hrIL-4 still enhanced the exhaustion profile by Day 15 when the CAR T cells were exposed to cell-free stimulation by CD19 beads. This is seen by a decrease in proliferative ability (Fig. 24A). a decrease in IL-2 production (Fig. 24B), and an increase in the percent of CAR T cells expressing multiple inhibitory receptors (Fig. 24C).

[0045] Fig. 25 contains graphs plotting the percent of IL-4 producing CD3 cells following IL-4 knockout in CART19-28^ cells using gRNAl or gRNA2 as compared to control gRNA. The percent of cells producing IL-4 was determined by intracellular staining for IL-4 by flow' cytometry following four hours of antigen-specific CAR stimulation by co-culturing CART cells with JeKo-1 target cells at a 1 :5 effector- to-target ratio. Three biological replicates; T-test; * = p<0.05. The DNA sequence encoding gRNAl is TGATATCGCACTTGTGTCCG (SEQ ID NO: 1), the DNA sequence encoding gRNA2 is CAAGTGCGATATCACCTTAC (SEQ ID NO:2), and the DNA sequence encoding a control gRNA is GTATTACTGATATTGGTGGG (SEQ ID NO: 14).

[0046] Fig. 26 contains graphs plotting percent killing as measured with bioluminescent imaging after either IL-4 knockout using gRNAl or gRNA2 as compared to control gRNA in CART 19-28^ cells co-cultured with luciferase+ Jeko-1 cells at various effector- to-target ratios for 24 hours. Three biological replicates; two-way ANOVA; * = p<0.05. The DNA sequence encoding gRNAl is TGATATCGCACTTGTGTCCG (SEQ ID NO: 1). the DNA sequence encoding gRNA2 is CAAGTGCGATATCACCTTAC (SEQ ID NO:2), and the DNA sequence encoding a control gRNA is GTATTACTGATATTGGTGGG (SEQ ID NO: 14).

[0047] Figs. 27A-27G show the effect of IL-4 knockout on CAR T cell exhaustion. Fig. 27 A) Absolute CD3+cell count, as determined with flow cytometry, after chronically stimulated control gRNA CART 19-28^ cells or IL-4 knockout CART 19-28^ cells (using gRNA 1) were co-cultured with JeKo-1 target cells at a 1 : 1 ratio for 5 days (T-test with one biological replicate and three technical replicates). Figs. 27B and 27C) The percent of IL-4 knockout CART 19-28^ cells (using gRNA 1) as compared with control gRNA CART19-28^ cells producing the effector cytokines IL-2 and IFN-y, respectively. This was determined by strongly stimulating CAR T cells at a 1:5 effector to target cell ratio for four hours before performing intracellular staining for the cytokines (Paired T-test with three biological replicates, average of tw o technical replicates per biological replicate). Fig. 27D) Absolute CD3+cell count, as determined with flow cytometry, after chronically stimulated control gRNA CAR T cells or IL-4 knockout CAR T cells (using gRNA 2) were co-cultured with JeKo-1 target cells at a 1 : 1 ratio for 5 days (T-test with one biological replicate and three technical replicates). Figs. 27E and 27F) The percent of IL-4 knockout CART 19-28^ cells (using gRNA 2) as compared with control gRNA CART 19-28^ cells producing the effector cytokines IL-2 and IFN-y, respectively. This was determined by strongly stimulating CAR T cells at a 1:5 effector to target cell ratio for four hours before performing intracellular staining for the cytokines (Paired T-test with two biological replicates, average of two technical replicates per biological replicate). Fig. 27G) Circle plots showing the percent of either control gRNA, IL-4 gRNA 1. or IL-4 gRNA 2 CART19-28^ cells expressing 0. 1, 2, 3. or 4 inhibitory receptors following chronic stimulation with the in vitro model for exhaustion. This was determined with flow' cytometric detection of CD3+cells positive for PD-1, TIM-3, CTLA-4, and / or LAG-3 (One representative biological replicate out of three tested).

[0048] (*p<0.05, **p<0.01). The DNA sequence encoding gRNAl is TGATATCGCACTTGTGTCCG (SEQ ID NO: 1), the DNA sequence encoding gRNA2 is CAAGTGCGATATCACCTTAC (SEQ ID NO:2), and the DNA sequence encoding a control gRNA is GTATTACTGATATTGGTGGG (SEQ ID NO: 14).

[0049] Figs. 28A-28G show the effect of human recombinant IL-4 on the activity’ of CART19-BB^ cells. Fig. 28A) Percent killing as measured with bioluminescent imaging after CART19-BB(^ cells w’ere co-cultured with luciferase+JeKo-1 cells at various E:T cell ratios for 48 hours in the presence of either 20ng / mL human recombinant IL-4 (hrlL- 4) or diluent control (Two-way ANOVA with three biological replicates, two technical replicates per biological replicate). Fig. 28B) Absolute CD3+cell count as measured with flow cytometry after CART19-BB^ cells were co-cultured with JeKo-1 cells at a 1 : 1 E:T cell ratio for five days in the presence of either 20ng / mL hrIL-4 or diluent control (Paired t-test with three biological replicates, two technical replicates per biological replicate). Fig. 28C) Absolute CD3+cell count as measured with flow cytometry after CART19-BB^ cells that had been chronically stimulated either in the presence of 20ng / mL hrIL-4 or diluent for one week were co-cultured with JeKo-1 cells at a 1: 1 E:T cell ratio for five days (Paired t-test with three biological replicates, two technical replicates per biological replicate). Fig. 28D) The percent of CD107a+ T cells in CART19-BB^ cells that have been chronically stimulated for a week in the presence of 20 ng / mL hrIL-4 or diluent.

[0050] This is determined by flow cytometry after strongly stimulating the chronically stimulated CAR T cells with CD19+target cells at a 1 :5 effector-to-target cell ratio for four hours (Paired T-test with three biological replicates, average of two technical replicates). Figs. 28E and 28F) The percent of CART I 9-BB^ cells producing the effector cytokines IFN-y and IL-2, respectively following one week of chronic stimulation in the presence of 20 ng / mL hrIL-4 or diluent. This was determined by strongly stimulating chronically stimulated CAR T cells at a 1:5 effector to target cell ratio for four hours before performing intracellular staining for the cytokines (Paired T-test with two biological replicates, average of two technical replicates per biological replicate). Fig. 28G) The percent of CART I 9-BBc cells expressing three or more inhibitory receptors following chronic stimulation in the presence of either 20 ng / mL hrIL-4 or diluent. This was determined with flow' cytometric detection of CD3+cells positive for PD-1, TIM-3, CTLA-4, and / or LAG-3 (Paired T-test with three biological replicates, average of two technical replicates). (*p<0.05, **p<0.01, ***p<0.001, ****p<0.0001).

[0051] Figs. 29A-29B show the results of ingenuity pathway analysis of positively selected genes in a genome-wide CRISPR knockout screen, which identified IL-4R in the top 5 causal networks. Fig. 29A is a table listing the top 5 causal netw orks identified in the genome-wide CRISPR knockout screen in healthy donor CART cells using the in vitro model for exhaustion. Fig. 29B depicts regulation of the IL-4R network, as determined with ingenuity pathway analysis.

[0052] Fig. 30 is a graph plotting the percentage of IL-4R+CD3+T cells after treating CART cells from healthy human donors with a Cas9 polypeptide and a control gRNA or two different gRNAs targeted to IL-4R. As shown in Fig. 30, both gRNAs were effective to reduce TL-4R expression.

[0053] Figs. 31A-31E show that after chronic stimulation, IL-4R knockout reduced the exhausted phenotype of healthy donor CART cells. Fig. 31 A is a pair of graphs plotting the proliferative ability of CART cells from two different healthy donors, treated with a Cas9 polypeptide and a control gRNA or an IL-4R gRNA. Fig. 3 IB includes a series of pie charts showing the number of inhibitory receptors expressed on CD3+CART cells from two different healthy donors, treated with a Cas polypeptide9 and a control gRNA or two different IL-4R gRNAs, demonstrating that co-expression of multiple inhibitory receptors was reduced by the IL-4R gRNAs. Figs. 31C-31D include graphs plotting the percentage of IL-2+(Fig. 31 C) or TNF-a+(Fig. 3 ID) CART cells from two different healthy donors after treatment of the CART cells with a Cas polypeptide9 and a control gRNA or an IL-4R gRNA, showing that the IL-4R gRNA increased production of these effector cytokines. Fig. 3 IE includes a pair of flow cytometry plots that also show increased production of IL-2 and TNF-a with Cas and IL-4R gRNA treatment.

[0054] Figs. 32A-32F show IL4R knockdown reduced signs of exhaustion in CD8+CART19-28^ cells. During CART cell production, CART 19-28^ cells were transduced with a lentiCRISPRv2 plasmid containing a gRNA targeting IL4R or a non-targeting gRNA (Control gRNA). Figs. 32A-32D include line and representative flow plots showing the production of IL-2 and TNF-a by CD8+CART cells as determined through intracellular staining after Day 22 CART cells were co-cultured with JeKo-1 cells at a 1:5 E:T ratio for four hours (Paired t-test, average of two technical replicates for tw o biological replicates, mean + / - SD). Figs. 32E-32F include line and circle graphs depicting the percent of CD8+cells expressing multiple inhibitor}’ receptors (0 - black, 1 - pink, 2- green, 3 - dark purple, 4 - light purple) on Day 15 as determined by flow cytometric staining for CD3, CD8, PD-1, CTLA-4, TIM-3, and LAG-3 (Paired t-test, average of two technical replicates for two biological replicates). (*p<0.05, ns: p>0.05).

[0055] Fig. 33 includes a series of pie charts showing the number of inhibitory receptors expressed on CD8+CART cells treated with a Cas9 polypeptide and a control gRNA or tw o different IL-4R gRNAs, showing that the IL-4R knockout CART cells had reduced coexpression of multiple inhibitor}' receptors following chronic stimulation, and indicating that IL-4R knockout reduced the exhausted phenotype of the CD8 CART cells. Figs. 34A-34B show that IL-4R knockout CART cells exhibited enhanced in vivo efficacy. Fig. 34A is a graph plotting anti-tumor efficacy (total flux) of control and IL-4R knockout CART cells in a JeKo-1 xenograft mouse model. Fig. 34B is a graph plotting expansion of control and IL-4R knockout CART cells in the JeKo-1 mouse model.

[0056] Figs. 35A-35C show that silencing the HS2 IL-4 enhancer improved CART cell activity. Fig. 35A is a plot showing chromatin accessibility of CART cell products from non-responders at baseline and during the development of exhaustion, indicating increased chromatin accessibility at the IL-4 locus (and particularly at an enhancer in the second intron of IL-4. Fig. 35B is a graph plotting the percentage of IL-4 CD3+CART cells after treatment with dCas9 KRAB and a control gRNA or a gRNA targeted to the HS2 enhancer, showing that dCas9 KRAB with the HS2 gRNA reduced IL-4 production. Fig. 35C includes graphs plotting the percent killing of JeKo-1 tumor cells by CART19 cells treated with dCas9 KRAB and control gRNA or 4 different HS2 gRNAs, demonstrating that silencing the HS2 enhancer improved CART 19 cell killing of the JeKo-1 tumor cells.

[0057] DETAILED DESCRIPTION

[0058] This document provides methods and materials for generating T cells (e.g., CAR T cells) having a reduced level of an IL-4R polypeptide (e.g., IL4R KO CAR T cells), optionally in combination with a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells). This document also provides methods and materials for generating T cells (e.g., CAR T cells) having reduced activity of an HS2 IL-4 enhancer (e.g., HS2 KO CAR T cells), optionally in combination with a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells).

[0059] In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid encoding an IL-4R polypeptide to reduce IL-4R polypeptide expression in that T cell (e.g., as compared to a comparable T cell that is not engineered to KO a nucleic acid encoding an IL-4R polypeptide). A T cell that is engineered to KO a nucleic acid encoding an IL-4R polypeptide can also be referred to herein as an IL-4R KO T cell, an IL-4Rk / o T cell, or an IL-4RK0 T cell. In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid containing an IL-4 enhancer to reduce IL-4 polypeptide expression in that T cell (e g., as compared to a comparable T cell that is not engineered to KO a nucleic acid containing an HS2 IL-4 enhancer). AT cell that is engineered to KO a nucleic acid containing an HS2 IL-4 enhancer can also be referred to herein as an HS2 KO T cell, an HS2k / o T cell, or an HS2K0 T cell.

[0060] In some cases, a T cell (e.g., a CAR T cell) can be engineered to also (in combination with an IL-4R KO and / or an HS2 KO) KO a nucleic acid encoding an IL-4 polypeptide to reduce IL-4 polypeptide expression in that T cell (e.g., as compared to a comparable T cell that is not engineered to KO a nucleic acid encoding an IL-4 polypeptide). AT cell that is engineered to KO a nucleic acid encoding an IL-4 polypeptide can also be referred to herein as an IL-4 KO T cell, an IL-4k" T cell, or an IL- 4KOT cell. In some cases, a T cell (e.g., a CAR T cell) can be engineered to also (in combination with an IL-4R KO and / or an HS2 KO) KO a nucleic acid encoding a TCF7 polypeptide to reduce TCF7 polypeptide expression in that T cell (e.g., as compared to a comparable T cell that is not engineered to KO a nucleic acid encoding a TCF7 polypeptide). AT cell that is engineered to KO a nucleic acid encoding a TCF7 polypeptide can also be referred to herein as a TCF7 KO T cell, a TCF?1^0T cell, or a TCF7KOT cell. In some cases, a T cell (e.g., a CAR T cell) can be engineered to also (in combination with an IL-4R KO and / or an HS2 KO) KO a nucleic acid encoding a PTPN2 polypeptide to reduce PTPN3 polypeptide expression in that T cell (e.g., as compared to a comparable T cell that is not engineered to KO a nucleic acid encoding a PTPN2 polypeptide). AT cell that is engineered to KO a nucleic acid encoding a PTPN2 polypeptide can also be referred to herein as a PTPN2 KO T cell, a PTPN2k / oT cell, or a PTPN2KOT cell. In some cases, a T cell (e.g., a CAR T cell) can be engineered to also (in combination with an IL-4R KO and / or an HS2 KO) KO a nucleic acid encoding a PTPN3 polypeptide to reduce PTPN3 polypeptide expression in that T cell (e.g., as compared to a comparable T cell that is not engineered to KO a nucleic acid encoding a PTPN3 polypeptide). AT cell that is engineered to KO a nucleic acid encoding a PTPN3 polypeptide can also be referred to herein as a PTPN3 KO T cell, a PTPN3koT cell, or a PTPN3KOT cell.

[0061] The term “reduced level” as used herein with respect to a level of an IL-4R polypeptide, an IL-4 polypeptide, a TCF7 polypeptide, a PTPN2 polypeptide, or a PTPN3 polypeptide refers to any level that is lower than a reference level of that polypeptide. The term “reference level” as used herein with respect to an IL-4R polypeptide, an IL-4 polypeptide, a TCF7 polypeptide, a PTPN2 polypeptide, or a PTPN3 polypeptide refers to the level of that polypeptide typically observed in control T cells from one or more mammals (e.g.. humans) not engineered to have a reduced level of that polypeptide as described herein. Control T cells can include, without limitation, T cells that are wild-type T cells. In some cases, a reduced level of an IL-4R polypeptide, an IL-4 polypeptide, a TCF7 polypeptide, a PTPN2 polypeptide, or a PTPN3 polypeptide can be an undetectable level of that polypeptide. In some cases, a reduced level of an IL-4R polypeptide, an IL-4 polypeptide, a TCF7 polypeptide, a PTPN2 polypeptide, and / or a PTPN3 polypeptide can be an eliminated level of that polypeptide.

[0062] In some cases, a T cell having (e.g., engineered to have) a reduced level of an IL- 4R polypeptide and / or reduced activity' of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide is less likely7to undergo exhaustion (e.g., as compared to a CAR T cell that is not engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer, optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide). For example, reducing a level of an IL-4R polypeptide and / or reducing activity7of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with reducing a level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or reducing a level of a PTPN3 polypeptide in aT cell can be effective to delay the onset of exhaustion in the T cell by, for example, 10, 20, 30, 40, 50, 60, 70, 80, 90, 95, or more percent. For example, a T cell having a reduced level of an IL-4R polypeptide and / or reduced activity7of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can maintain one or more T cell functions for at least 1 week. In some cases, a T cell having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can maintain one or more T cell functions for from about 1 week to about 2 years (e.g., from about 1 week to about 1.5 years, from about 1 week to about 1 year, from about 1 week to about 9 months, from about 1 week to about 6 months, from about 1 week to about 4 months, from about 1 week to about 3 months, from about 1 week to about 2 months, from about 1 week to about 1 month, from about 1 week to about 4 weeks, from about 1 week to about 3 weeks, from about 1 week to about 2 weeks, from about 2 weeks to about 2 years, from about 3 weeks to about 2 years, from about 4 weeks to about 2 years, from about 1 month to about 2 years, from about 2 months to about 2 years, from about 3 months to about 2 years, from about 4 months to about 2 years, from about 6 months to about 2 years, from about 9 months to about 2 years, from about 1 year to about 2 years, from about 1.5 years to about 2 years, from about 2 weeks to about 1.5 years, from about 3 weeks to about 1 year, from about 1 month to about 9 months, from about 2 months to about 6 months, from about 3 months to about 4 months, from about 2 weeks to about 4 weeks, from about 1 month to about 4 months, from about 2 months to about 6 months, from about 3 months to about 9 months, or from about 6 months to about 1.5 years).

[0063] Any appropriate method can be used to determine whether or not one or more T cells (e.g., T cells having a reduced level of an IL-4R polypeptide and / or reduced activity’ of an IL-4 enhancer, optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide) are exhausted. Examples of methods that can be used to evaluate T cell (e.g., CAR T cell) exhaustion include, without limitation, testing the T cell’s ability to proliferation, to maintain a CD4+population, to produce multiple cytokines at once, to produce effector cytokines such as IL-2 and TNF- a, and to express inhibitory receptors.

[0064] In some cases, a T cell having (e.g., engineered to have) a reduced level of an IL- 4R polypeptide and / or reduced activity’ of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can have enhanced CAR T cell function such as improved antitumor activity, improved proliferation, improved cell killing (e.g., improved killing of tumor cells), improved CD4+T cell levels, improved persistence, and improved ability to produce several cytokines at once (e.g., as compared to a CAR T cell that is not engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer, optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide). Any appropriate method can be used to assess one or more functions of T cells (e.g., T cells having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer, optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide). Examples of methods that can be used to evaluate T cell (e.g., CAR T cell) functions include, without limitation, the treatment of in vivo tumor models, proliferation assays (to determine absolute T cell numbers following antigen-specific stimulation), cytotoxicityassays (e.g., to evaluate whether or not T cells (e.g., CAR T cells) are effective at killing target cells, cell number determinations, proliferation assays, determining CD4+cell populations at different timepoints, and degranulation assays.

[0065] AT cell having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be any appropriate T cell. AT cell can be a naive T cell. Examples of T cells that can be engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide as described herein include, without limitation, cytotoxic T cells, helper T cells, CD4+T cells, and CDS T cells. For example, a T cell that can be engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide as described herein can be a CAR T cell. In some cases, one or more T cells designed to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be T cells that were obtained from a mammal (e.g., a mammal having cancer) that is to be treated with those T cells designed to have a reduced level of an IL- 4R polypeptide and / or reduced activ ity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide. For example, T cells can be obtained from a mammal to be treated with the materials and method described herein.

[0066] AT cell having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity7of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be generated using any appropriate method. In some cases. a T cell (e.g.. a CAR T cell) can be treated with one or more inhibitors to reduce polypeptide expression in that T cell (e.g., as compared to a T cell that was not treated with the one or more inhibitors). For example, aT cell (e.g., a CAR T cell) can be treated with one or more IL- 4R polypeptide inhibitors to reduce a level of IL-4R polypeptides in that T cell (e.g., as compared to a T cell that was not treated with the one or more IL-4R polypeptide inhibitors). In some cases, in addition to being treated with one or more IL-4R polypeptide inhibitors, a T cell (e.g., a CAR T cell) also can be treated with one or more IL-4 polypeptide inhibitors to reduce a level of IL-4 polypeptides in that T cell (e.g., as compared to a T cell that was not treated with the one or more IL-4 polypeptide inhibitors). In some cases, in addition to being treated with one or more IL-4R polypeptide inhibitors, a T cell (e.g., a CAR T cell) also can be treated with one or more TCF7 polypeptide inhibitors to reduce a level of TCF7 polypeptide in that T cell (e.g., as compared to aT cell that was not treated with the one or more TCF7 polypeptide inhibitors). In some cases, in addition to being treated with one or more IL-4R polypeptide inhibitors, a T cell (e g., a CAR T cell) can be treated with one or more PTPN2 polypeptide inhibitors to reduce a level of PTPN2 polypeptides in that T cell (e.g., as compared to a T cell that was not treated with the one or more PTPN2 polypeptide inhibitors). In some cases, in addition to being treated with one or more IL-4R polypeptide inhibitors, a T cell (e.g., a CAR T cell) can be treated with one or more PTPN3 polypeptide inhibitors to reduce a level of PTPN3 polypeptides in that T cell (e.g., as compared to a T cell that was not treated with the one or more PTPN3 polypeptide inhibitors).

[0067] In some cases, T cells (e.g., CAR T cells) and one or more inhibitors can be administered to a mammal (e.g., a human) having cancer to reduce polypeptide expression within the mammal (e.g., to generate CAR T cells having a reduced susceptibility to T cell exhaustion within the mammal). For example, T cells (e g., CAR T cells) and one or more IL-4R polypeptide inhibitors can be administered to a mammal (e.g., a human) having cancer (e.g., to generate CAR T cells having a reduced susceptibility to T cell exhaustion within the mammal). In some cases, in addition to one or more IL-4R polypeptide inhibitors, T cells (e.g., CAR T cells) and one or more IL-4 polypeptide inhibitors can be administered to a mammal (e.g., a human) having cancer (e.g.. to generate CAR T cells having a reduced susceptibility to T cell exhaustion within the mammal). In some cases, in addition to one or more IL-4R polypeptide inhibitors, a T cell (e.g., a CAR T cell) and one or more TCF7 polypeptide inhibitors can be administered to a mammal (e.g., a human) having cancer (e.g., to generate CAR T cells having a reduced susceptibility to T cell exhaustion within the mammal). In some cases, in addition to one or more IL-4R polypeptide inhibitors, aT cell (e.g., a CAR T cell) and one or more PTPN2 polypeptide inhibitors can be administered to a mammal (e.g., a human) having cancer (e.g., to generate CAR T cells having a reduced susceptibility' to T cell exhaustion within the mammal). In some cases, in addition to one or more IL-4R polypeptide inhibitors, a T cell (e.g.. a CAR T cell) and one or more PTPN3 polypeptide inhibitors can be administered to a mammal (e.g., a human) having cancer (e.g., to generate CAR T cells having a reduced susceptibility to T cell exhaustion within the mammal). In some cases, T cells (e.g., CAR T cells) having a reduced level of an IL-4R polypeptide (e.g., IL4R KO CAR T cells) and / or T cells (e.g.. CAR T cells) having reduced activity of an IL-4 enhancer (e.g.. an HS2 enhancer), optionally in combination with T cells (e.g., CAR T cells) having a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) and one or more inhibitors can be administered to a mammal (e.g., a human) having cancer to reduce polypeptide expression within the mammal (e.g., to generate CAR T cells having a reduced susceptibility7to T cell exhaustion within the mammal).

[0068] An IL-4R polypeptide inhibitor can be any appropriate IL-4R poly peptide inhibitor. An IL-4R polypeptide inhibitor can be an inhibitor of IL-4R polypeptide expression or an inhibitor of IL-4R polypeptide activity. In some cases, an IL-4R inhibitor can inhibit one or more polypeptides that can regulate production of an IL-4R polypeptide (e.g., one or more polypeptides that are upstream regulators of an IL-4R polypeptide). Examples of compounds that can inhibit IL-4 polypeptide activity include, without limitation, antibodies (e.g., neutralizing antibodies) that target (e.g., target and bind) to an IL-4R polypeptide, and small molecules that target (e.g., target and bind) to an IL-4R polypeptide. Examples of compounds that can inhibit of IL-4R poly peptide expression include, without limitation, nucleic acid molecules designed to induce RNA interference of polypeptide expression of an 1L-4R polypeptide (e.g., a siRNA molecule or a shRNA molecule), antisense molecules, and miRNAs.

[0069] An IL-4 polypeptide inhibitor can be any appropriate IL-4 polypeptide inhibitor. An IL-4 polypeptide inhibitor can be an inhibitor of IL-4 polypeptide expression or an inhibitor of IL-4 polypeptide activity’. In some cases, an IL-4 inhibitor can inhibit one or more polypeptides that can regulate production of an IL-4 polypeptide (e.g., one or more polypeptides that are upstream regulators of an IL-4 polypeptide). Examples of compounds that can inhibit IL-4 polypeptide activity' include, without limitation, antibodies (e.g., neutralizing antibodies) that target (e.g., target and bind) to an IL-4 polypeptide, and small molecules that target (e.g.. target and bind) to an IL-4 polypeptide. Examples of compounds that can inhibit of IL-4 polypeptide expression include, without limitation, nucleic acid molecules designed to induce RNA interference of polypeptide expression of an IL-4 polypeptide (e.g., a siRNA molecule or a shRNA molecule), antisense molecules, and miRNAs. In some cases, an IL-4 polypeptide inhibitor that can be contacted with a T cell (e.g., CAR T cell) to reduce a level of an IL-4 polypeptide within the T cell can be as described elsewhere (see, e.g., Quinnell et al., ACS Chem. Biol., 15, 10, 2649-2654 (2020)).

[0070] A TCF7 polypeptide inhibitor can be any appropriate TCF7 polypeptide inhibitor. A TCF7 polypeptide inhibitor can be an inhibitor of TCF7 polypeptide expression or an inhibitor of TCF7 polypeptide activity. Examples of compounds that can inhibit TCF7 polypeptide activity include, without limitation, antibodies (e.g., neutralizing antibodies) that target (e.g., target and bind) to a TCF7 polypeptide, and small molecules that target (e.g., target and bind) to a TCF7 polypeptide. Examples of compounds that can inhibit of TCF7 polypeptide expression include, without limitation, nucleic acid molecules designed to induce RNA interference of polypeptide expression of a TCF7 polypeptide (e.g., a siRNA molecule or a shRNA molecule), antisense molecules, and miRNAs.

[0071] A PTPN2 polypeptide inhibitor can be any appropriate PTPN2 polypeptide inhibitor. A PTPN2 polypeptide inhibitor can be an inhibitor of PTPN2 polypeptide expression or an inhibitor of PTPN2 polypeptide activity. Examples of compounds that can inhibit PTPN2 polypeptide activity include, without limitation, antibodies (e.g., neutralizing antibodies) that target (e.g., target and bind) to a PTPN2 polypeptide, and small molecules that target (e.g., target and bind) to a PTPN2 polypeptide. Examples of compounds that can inhibit of PTPN2 polypeptide expression include, without limitation, nucleic acid molecules designed to induce RNA interference of polypeptide expression of a PTPN2 polypeptide (e.g., a siRNA molecule or a shRNA molecule), antisense molecules, and miRNAs. Examples of PTPN2 polypeptide inhibitors that can be contacted with a T cell (e.g., CAR T cell) to reduce a level of a PTPN2 polypeptide within the T cell include, without limitation, ABBV-CLS-484 and ABBV-CLS-579.

[0072] A PTPN3 polypeptide inhibitor can be any appropriate PTPN3 polypeptide inhibitor. A PTPN3 polypeptide inhibitor can be an inhibitor of PTPN3 polypeptide expression or an inhibitor of PTPN3 polypeptide activity. Examples of compounds that can inhibit PTPN3 polypeptide activity include, without limitation, antibodies (e.g., neutralizing antibodies) that target (e.g., target and bind) to a PTPN3 polypeptide, and small molecules that target (e.g., target and bind) to a PTPN3 polypeptide. Examples of compounds that can inhibit of PTPN3 polypeptide expression include, without limitation, nucleic acid molecules designed to induce RNA interference of polypeptide expression of a PTPN3 polypeptide (e.g., a siRNA molecule or a shRNA molecule), antisense molecules, and miRNAs.

[0073] In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid encoding an IL-4R polypeptide to reduce IL-4R polypeptide expression in that T cell, and / or can be engineered to KO a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer) to reduce IL-4 polypeptide expression in that T cell. In some cases, a T cell (e.g., a CAR T cell) also (in combination with an IL-4R KO and / or an HS2 KO) can be engineered to KO a nucleic acid encoding an IL-4 polypeptide to reduce IL-4 polypeptide expression in that T cell, can be engineered to KO a nucleic acid encoding a TCF7 polypeptide to reduce TCF7 polypeptide expression in that T cell, can be engineered to KO a nucleic acid encoding a PTPN2 polypeptide to reduce PTPN2 polypeptide expression in that T cell, and / or can be engineered to KO a nucleic acid encoding a PTPN3 polypeptide to reduce PTPN3 polypeptide expression in that T cell.

[0074] In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid encoding an IL-4R polypeptide to reduce IL-4R polypeptide expression in that T cell. For example, at least one endogenous allele of a nucleic acid encoding an IL-4R polypeptide can be disrupted (e.g., knocked out) to generate a T cell (e.g., a CAR T cell) having a reduced level of an IL-4R polypeptide. For example, both endogenous alleles of a nucleic acid encoding an IL-4R polypeptide can be disrupted (e.g., knocked out) to generate a T cell (e g., a CAR T cell) having a reduced level of an IL-4R polypeptide.

[0075] In some cases, a T cell (e.g., a CAR T cell) can be engineered to KO a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer) to reduce IL-4 polypeptide expression in that T cell. For example, at least one endogenous allele of a nucleic acid containing an IL-4 enhancer can be disrupted (e.g., knocked out) to generate a T cell (e.g., a CAR T cell) having a reduced level of an IL-4 polypeptide. For example, both endogenous alleles of a nucleic acid containing an IL-4 enhancer can be disrupted (e.g., knocked out) to generate aT cell (e.g.. a CAR T cell) having a reduced level of an IL-4 polypeptide.

[0076] In some cases, a T cell (e.g., a CAR T cell) can be engineered to also KO (in addition to a nucleic acid encoding an IL-4R polypeptide and / or a nucleic acid encoding an IL-4 enhancer) a nucleic acid encoding an IL-4 polypeptide to reduce IL-4 polypeptide expression in that T cell. For example, at least one endogenous allele of a nucleic acid encoding an IL-4 polypeptide can be disrupted (e.g., knocked out) to generate a T cell (e.g., a CAR T cell) having a reduced level of an IL-4 polypeptide. For example, both endogenous alleles of a nucleic acid encoding an IL-4 polypeptide can be disrupted (e.g., knocked out) to generate aT cell (e.g., a CAR T cell) having a reduced level of an IL-4 polypeptide.

[0077] In some cases, a T cell (e.g., a CAR T cell) can be engineered to also KO (in addition to a nucleic acid encoding an IL-4R polypeptide and / or a nucleic acid encoding an IL-4 enhancer) a nucleic acid encoding a TCF7 polypeptide to reduce TCF7 polypeptide expression in that T cell. For example, at least one endogenous allele of a nucleic acid encoding a TCF7 polypeptide can be disrupted (e.g., knocked out) to generate a T cell (e.g., a CAR T cell) having a reduced level of a TCF7 polypeptide. For example, both endogenous alleles of a nucleic acid encoding a TCF7 polypeptide can be disrupted (e.g., knocked out) to generate a T cell (e.g., a CAR T cell) having a reduced level of a TCF7 polypeptide.

[0078] In some cases, a T cell (e.g., a CAR T cell) can be engineered to also KO (in addition to a nucleic acid encoding an IL-4R polypeptide and / or a nucleic acid encoding an IL-4 enhancer) a nucleic acid encoding a PTPN2 polypeptide to reduce PTPN2 polypeptide expression in that T cell. For example, at least one endogenous allele of a nucleic acid encoding a PTPN2 polypeptide can be disrupted (e.g., knocked out) to generate a T cell (e.g., a CAR T cell) having a reduced level of a PTPN2 polypeptide. For example, both endogenous alleles of a nucleic acid encoding a PTPN2 polypeptide can be disrupted (e.g., knocked out) to generate a T cell (e.g.. a CAR T cell) having a reduced level of a PTPN2 polypeptide.

[0079] In some cases, a T cell (e.g., a CAR T cell) can be engineered to also KO (in addition to a nucleic acid encoding an IL-4R polypeptide and / or a nucleic acid encoding an IL-4 enhancer) a nucleic acid encoding a PTPN3 polypeptide to reduce PTPN3 polypeptide expression in that T cell. For example, at least one endogenous allele of a nucleic acid encoding a PTPN3 polypeptide can be disrupted (e.g., knocked out) to generate a T cell (e.g., a CAR T cell) having a reduced level of a PTPN3 polypeptide. For example, both endogenous alleles of a nucleic acid encoding a PTPN3 polypeptide can be disrupted (e.g., knocked out) to generate a T cell (e.g.. a CAR T cell) having a reduced level of a PTPN3 polypeptide. In some cases, when a T cell (e.g., a CAR T cell) is engineered to KO a nucleic acid encoding an IL-4R polypeptide to reduce IL-4R polypeptide expression in that T cell, and / or to KO a nucleic acid containing an IL-4 enhancer to reduce IL-4 polypeptide expression in that T cell, and optionally also is engineered to KO a nucleic acid encoding an IL-4 polypeptide to reduce IL-4 polypeptide expression in that T cell, a nucleic acid encoding a TCF7 polypeptide to reduce TCF7 polypeptide expression in that T cell, a nucleic acid encoding a PTPN2 polypeptide to reduce PTPN2 polypeptide expression in that T cell, and / or a nucleic acid encoding a PTPN3 polypeptide to reduce PTPN3 polypeptide expression in that T cell, any appropriate method can be used to KO a nucleic acid. Examples of techniques that can be used to knock out a nucleic acid encoding an IL- 4R polypeptide and / or a nucleic acid containing an IL-4 enhancer (e g., an HS2 enhancer), optionally in combination with a nucleic acid encoding an IL-4 polypeptide, a nucleic acid encoding a TCF7 polypeptide, a nucleic acid encoding a PTPN2 polypeptide, and / or a nucleic acid encoding a PTPN3 polypeptide include, without limitation, gene editing, homologous recombination, non-homologous end joining, microhomology end joining, and base editing For example, gene editing (e.g., with engineered nucleases) can be used to knock out a nucleic acid encoding an IL-4R polypeptide and / or a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a nucleic acid encoding an IL-4 polypeptide, a nucleic acid encoding a TCF7 polypeptide, a nucleic acid encoding a PTPN2 polypeptide, and / or a nucleic acid encoding a PTPN3 polypeptide. Nucleases useful for genome editing include, without limitation, CRISPR- associated (Cas) nucleases, zinc finger nucleases (ZFNs), transcription activator-like effector (TALE) nucleases, and homing endonucleases (HE: also referred to as meganucleases).

[0080] In some cases, a clustered regularly interspaced short palindromic repeat (CRISPR) I Cas system can be used (e.g., can be introduced into one or more T cells) to KO a nucleic acid encoding an IL-4R polypeptide and / or a nucleic acid containing an IL- 4 enhancer (e.g., an HS2 enhancer), and optionally also to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide. A CRISPR / Cas system used to KO a nucleic acid can include a guide RNA (gRNA) that is complementary to the target nucleic acid (e.g.. a nucleic acid encoding an IL-4R polypeptide, a nucleic acid containing an IL-4 enhancer, a nucleic acid encoding an IL-4 polypeptide, a nucleic acid encoding a TCF7 polypeptide, a nucleic acid encoding a PTPN2 polypeptide, and / or a nucleic acid encoding a PTPN3 polypeptide).

[0081] Examples of nucleic acids that can encode gRNAs that are specific to a nucleic acid encoding an IL-4R polypeptide include, without limitation, TGAGCATCTCTACTTGCGAG (SEQ ID NO: 15) and GCTCCGCCTGTTGTACCAGC (SEQ ID NO: 16). In some cases, a gRNA can be designed based on a sequence of a nucleic acid encoding an IL-4R polypeptide. Examples of nucleic acids encoding an IL- 4R polypeptide sequence include, without limitation, those set forth in National Center for Biotechnology Information (NCBI) accession no. NM 000418, accession no. NM_001257406.2, accession no. NM_001257407.2, and accession no. NM_001257997.2.

[0082] Examples of nucleic acids that can encode gRNAs that are specific to a nucleic acid containing an HS2 IL-4 enhancer include, without limitation, CTTTGACCAGGATCTGAGTC (SEQ ID NO: 17), TGTAGTCCTGACTCAGATCC (SEQ ID NO: 18), CCGTGTGTTTCCATGAAAAC (SEQ ID NO: 19), and CCACTGTGAAATTGAGGCTT (SEQ ID NO:20). In some cases, a gRNA can be designed based on a sequence of a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer).

[0083] Examples of nucleic acids that can encode gRNAs that are specific to a nucleic acid encoding an IL -4 polypeptide include, without limitation, TGATATCGCACTTGTGTCCG (SEQ ID NO: 1), CAAGTGCGATATCACCTTAC (SEQ ID NO: 2), and GGTTCCTGTCGAGCCGTTTC (SEQ ID NO: 3). In some cases, a gRNA can be designed based on a sequence of a nucleic acid encoding an IL-4 polypeptide. Examples of nucleic acids encoding an IL-4 polypeptide sequence include, without limitation, those set forth in NCBI accession no. NM_000589, accession no.

[0084] NM_001354990.2, and accession no. NM_172348.3. For example, a gRNA specific to a nucleic acid encoding an IL-4 polypeptide can be as described elsewhere (see, e.g.. Sanjana et al., Nat. Methods, 11(8):783-4 (2014)).

[0085] Examples of nucleic acids that can encode gRNAs that are specific to a nucleic acid encoding a TCF7 polypeptide include, without limitation, GTCGCTCGTGAACGAGTCCG (SEQ ID NO:4), CGCGCTGTCGCGAGAAGAGC (SEQ ID NO: 5), and CACGAGCGACGACTTGAGCT (SEQ ID NO: 6). In some cases, a gRNA can be designed based on a sequence of a nucleic acid encoding a TCF7 polypeptide. Examples of nucleic acids encoding a TCF7 polypeptide sequence include, without limitation, those set forth in NCBI accession no. NM_213648.5, accession no. NM_003202.5. and accession no. NM_001134851.4. For example, a gRNA specific to a nucleic acid encoding a TCF7 polypeptide can be as described elsewhere (see, e.g., Rutishauser et al., JCI Insight, 6(3): (2021); and Zhou et al., Science Immunology, 7(71):eabml920 (2022)).

[0086] Examples of nucleic acids that can encode gRNAs that are specific to a nucleic acid encoding a PTPN2 polypeptide include, without limitation, CTCTTCGAACTCCCGCTCGA (SEQ ID NO:7), AGTTGGATACTCAGCGTCGC (SEQ ID NO: 8), and CCATGACTATCCTCATAGAG (SEQ ID NO: 9). In some cases, a gRNA can be designed based on a sequence of a nucleic acid encoding a PTPN2 polypeptide. Examples of nucleic acids encoding a PTPN2 polypeptide sequence include, without limitation, those set forth in NCBI accession no. NM_002828.4, accession no. NM_080422.3, and accession no. NM_080423.3. For example, a gRNA specific to a nucleic acid encoding a PTPN2 polypeptide can be as described elsewhere (see, e.g., Zhang et al., J. Periodontal Research, 53(3): 467-477 (2018); and LaFleur et al., Nature Immunology. 20(10): 1335-1347 (2019)).

[0087] Examples of nucleic acids that can encode gRNAs that are specific to a nucleic acid encoding a PTPN3 polypeptide include, without limitation, ACAGCATGATGACGACTCCG (SEQ ID NO: 10). GGATATGGTGCACAACCACC (SEQ ID NO: 11), and CTGAAGATGGATATTTGCGA (SEQ ID NO: 12). In some cases, a gRNA can be designed based on a sequence of a nucleic acid encoding a PTPN3 polypeptide. Examples of nucleic acids encoding a PTPN3 polypeptide sequence include, without limitation, those set forth in NCBI accession no. NM_002829.4, accession no. NM_001145368.2, and accession no. NM_001145369.2. For example, a gRNA specific to a nucleic acid encoding a PTPN3 polypeptide can be as described elsewhere (see, e.g.. Sanjana et al , Nat. Methods. Aug:I l(8):783-4 (2014)).

[0088] A CRISPR / Cas system used to KO a nucleic acid encoding an IL-4R polypeptide, to KO a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer), to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide can include any appropriate Cas nuclease. Examples of Cas nucleases include, without limitation, Casl, Cas2, Cas3, Cas9, Cas 10, Cpfl, Casl2a, and ErCasl2a. In some cases, a Cas component of a CRISPR / Cas system designed to KO a nucleic acid encoding an IL-4R polypeptide, to KO a nucleic acid encoding an IL-4 enhancer (e.g., an HS2 enhancer) to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide can be a Cas9 nuclease. An exemplary Cas9 nuclease can have the amino acid sequence set forth in Example 7. For example, the Cas9 nuclease of a CRISPR / Cas9 system described herein can be a Streptococcus pyogenes Cas9 nuclease (see, e.g., Cox et al., Leukemia, 36(6): 1635-1645 (2022)). In some cases, a fusion polypeptide containing (a) a domain that includes an attenuated or “dead’' Cas9 polypeptide (e.g., a Cas9 polypeptide that can only cleave or “nick” a single strand of the DNA, or a Cas9 polypeptide that does not have any cleavage activity, also referred to as “dCas9”), and (b) a repressor domain such as a KRAB domain can be used to reduce the activity of an IL-4 enhancer. A dCas9 polypeptide can have an amino acid sequence in which the Asp at position 10 of SEQ ID NO: 13 and the His at position 840 of SEQ ID NO: 13 are replaced with, for example, Ala.

[0089] Components of a CRISPR / Cas system (e.g., a gRNA and a Cas nuclease) used to KO a nucleic acid encoding an IL-4R polypeptide, to KO a nucleic acid containing an IL- 4 enhancer (e.g., an HS2 enhancer), to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide can be introduced into one or more T cells (e.g., CAR T cells) in any appropriate format. In some cases, a component of a CRISPR / Cas system can be introduced into one or more T cells as a nucleic acid encoding a gRNA and / or a nucleic acid encoding a Cas nuclease. For example, a nucleic acid encoding at least one gRNA and a nucleic acid encoding at least one Cas nuclease (e.g., a Cas9 nuclease) can be introduced into one or more T cells. In some cases, a component of a CRISPR / Cas system can be introduced into one or more T cells as a gRNA and / or as a Cas nuclease. For example, at least one gRNA and at least one Cas nuclease (e.g.. a Cas9 nuclease) can be introduced into one or more T cells. In some cases, a ZFN system can be used can be used (e.g., can be introduced into one or more T cells) to KO a nucleic acid encoding an IL-4R polypeptide, to KO a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer), to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide. A ZFN system used to KO a nucleic acid can include a polypeptide including (a) a DNA-binding domain (e.g., zinc fingers) that that is complementary to a target nucleic acid (e.g., a nucleic acid encoding an IL-4R polypeptide, a nucleic acid containing an IL-4 enhancer, a nucleic acid encoding an IL-4 polypeptide, a nucleic acid encoding a TCF7 polypeptide, a nucleic acid encoding a PTPN2 polypeptide, and / or a nucleic acid encoding a PTPN3 polypeptide), and (b) a nuclease domain (e.g., a nuclease domain that can created double-strand breaks). A ZFN system used to KO a nucleic acid encoding an IL-4R polypeptide, to KO a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer), to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide can include any appropriate nuclease domain. In some cases, a nuclease domain of a ZFN system designed to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide can be a Fokl nuclease domain.

[0090] In some cases, a TALEN system can be used can be used (e.g., can be introduced into one or more T cells) to KO a nucleic acid encoding an IL-4R polypeptide, to KO a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer), to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide. A TALEN system used to KO a nucleic acid can include a polypeptide including (a) a transcription activator-like (TAL) effector DNA-binding domain directing the nuclease to a target nucleic acid (e.g., a nucleic acid encoding an IL- 4R polypeptide, a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer), a nucleic acid encoding an IL-4 polypeptide, a nucleic acid encoding a TCF7 polypeptide, a nucleic acid encoding a PTPN2 polypeptide, and / or a nucleic acid encoding a PTPN3 polypeptide), and (b) a nuclease domain (e.g., a nuclease domain that can created double- strand breaks). ATALEN system used to KO a nucleic acid encoding an IL-4R polypeptide, to KO a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer), to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide can include any appropriate nuclease. In some cases, a nuclease can be a non-specific nuclease. In some cases, a nuclease can function as a dimer. In some cases, a nuclease of a TALEN system designed to KO a nucleic acid encoding an IL-4R polypeptide, to KO a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer), to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide can be a Fokl nuclease.

[0091] Components of a gene-editing system (e.g., a CRISPR / Cas system) used to KO a nucleic acid encoding an IL-4R polypeptide, to KO a nucleic acid containing an IL-4 enhancer (e.g., an HS2 enhancer), to KO a nucleic acid encoding an IL-4 polypeptide, to KO a nucleic acid encoding a TCF7 polypeptide, to KO a nucleic acid encoding a PTPN2 polypeptide, and / or to KO a nucleic acid encoding a PTPN3 polypeptide can be introduced into one or more T cells (e.g., CAR T cells) using any appropriate method. A method of introducing components of a gene-editing system into a T cell can be a physical method. A method of introducing components of a gene-editing system into a T cell can be a chemical method. A method of introducing components of a gene-editing system into a T cell can be a particle-based method. Examples of methods that can be used to introduce components of a gene-editing system into one or more T cells include, without limitation, electroporation, transfection (e.g., lipofection), transduction (e.g., viral vector mediated transduction), microinjection, nucleofection, Cell Squeeze®, and microfluidics.

[0092] AT cell having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can express (e.g., can be engineered to express) any appropriate antigen receptor. In some cases, an antigen receptor can be a heterologous antigen receptor. In some cases, an antigen receptor can be a CAR. In some cases, an antigen receptor can be a tumor antigen (e.g., tumor-specific antigen) receptor. For example, a T cell can be engineered to express a tumor-specific antigen receptor that targets a tumor-specific antigen (e.g., a cell surface tumor-specific antigen) expressed by a cancer cell in a mammal having cancer. Examples of antigens that can be recognized by an antigen receptor expressed in a T cell having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide as described herein include, without limitation, cluster of differentiation 19 (CD 19). mucin 1 (MUC-1), human epidermal growth factor receptor 2 (HER-2), estrogen receptor (ER), epidermal growth factor receptor (EGFR), alphafetoprotein (AFP), carcinoembryonic antigen (CEA), CA-125, epithelial tumor antigen (ETA), melanoma-associated antigen (MAGE), CD33, CD123, CLL-1, E-Cadherin, folate receptor alpha, folate receptor beta, IL13R, EGFRviii, CD22, CD20. kappa light chain, lambda light chain, desmopressin, CD44v, CD45, CD30, CD5, CD7, CD2, CD38, BCMA, CD 138, FAP, CS-1, C-met, TSHR, and EphA3. For example, a T cell having a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be designed to express an antigen receptor targeting CD 19.

[0093] In some cases, a CAR can be designed to include a single chain antibody (e.g., a scFv) targeting a tumor antigen. For example, a CAR can be designed to include a single chain antibody as set forth in Table 1.

[0094] Table 1. Exemplary CARs for targeting tumor antigens.

[0095] Any appropriate method can be used to express an antigen receptor on a T cell having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an TL-4 enhancer (e g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide. For example, a nucleic acid encoding an antigen receptor can be introduced into one or more T cells. In some cases, viral transduction can be used to introduce a nucleic acid encoding an antigen receptor into a non-dividing a cell. A nucleic acid encoding an antigen receptor can be introduced in a T cell using any appropriate method. In some cases, a nucleic acid encoding an antigen receptor can be introduced into aT cell by transduction (e.g., viral transduction using a retroviral vector such as a lentiviral vector) or transfection. In some cases, a nucleic acid encoding an antigen receptor can be introduced ex vivo into one or more T cells. For example, ex vivo engineering of T cells expressing an antigen receptor can include transducing isolated T cells with a lentiviral vector encoding an antigen receptor. In cases where T cells are engineered ex vivo to express an antigen receptor, the T cells can be obtained from any appropriate source (e.g., a mammal such as the mammal to be treated or a donor mammal, or a cell line).

[0096] In some cases, when a T cell having (e g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide also expresses (e.g., is engineered to express) an antigen receptor, that T cell can be engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g.. an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide and engineered to express an antigen receptor using any appropriate method. In some cases, a T cell can be engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide first and engineered to express an antigen receptor second, or vice versa. In some cases, a T cell can be simultaneously engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide and to express an antigen receptor. For example, one or more nucleic acids used to reduce a level of an IL-4R polypeptide and / or one or more nucleic acids used to reduce a level of activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with one or more nucleic acids used to reduce a level of an IL-4 polypeptide, reduce a level of a TCF7 polypeptide, reduce a level of a PTPN2 polypeptide, and / or reduce a level of a PTPN3 polypeptide (e.g., a lentiviral vector encoding a nucleic acid molecule designed to induce RNA interference and / or a lentiviral vector encoding gene-editing components) and one or more nucleic acids encoding an antigen receptor (e.g.. a CAR) can be simultaneously introduced into one or more T cells. One or more nucleic acids used to reduce a level of an IL-4R polypeptide and / or one or more nucleic acids used to reduce a level of activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with one or more nucleic acids used to reduce a level of an IL-4 polypeptide, reduce a level of a TCF7 polypeptide, reduce a level of a PTPN2 polypeptide, and / or reduce a level of a PTPN3 polypeptide, and one or more nucleic acids encoding an antigen receptor can be introduced into one or more T cells on separate nucleic acid constructs or on a single nucleic acid construct. In some cases, one or more nucleic acids used to reduce a level of an IL-4R polypeptide and / or one or more nucleic acids used to reduce a level of activity of an IL -4 enhancer (e.g., an HS2 enhancer), optionally in combination with one or more nucleic acids used to reduce a level of an IL-4 polypeptide, reduce a level of a TCF7 polypeptide, reduce a level of a PTPN2 polypeptide, and / or reduce a level of a PTPN3 polypeptide, and one or more nucleic acids encoding an antigen receptor can be introduced into one or more T cells on a single nucleic acid construct. In some cases, one or more nucleic acids used to reduce a level of an IL-4R polypeptide and / or one or more nucleic acids used to reduce a level of activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with one or more nucleic acids used to reduce a level of an IL-4 polypeptide, reduce a level of a TCF7 polypeptide, reduce a level of a PTPN2 polypeptide, and / or reduce a level of a PTPN3 polypeptide, and one or more nucleic acids encoding an antigen receptor can be introduced ex vivo into one or more T cells. In cases where T cells are engineered ex vivo to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide, and to express an antigen receptor, the T cells can be obtained from any appropriate source (e.g., a mammal such as the mammal to be treated or a donor mammal, or a cell line).

[0097] In some cases, a T cell having (e.g., engineered to have) a reduced level of an IL- 4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be stimulated. AT cell can be stimulated at the same time as being engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide or independently of being engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide. For example, one or more T cells having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide used in an adoptive cell therapy can be stimulated first, and can be engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide second, or vice versa. In some cases, one or more T cells having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide used in an adoptive cell therapy can be stimulated first, and can be engineered to have a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 poly peptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide second. AT cell can be stimulated using any appropriate method. For example, aT cell can be stimulated by contacting the T cell with one or more CD polypeptides. Examples of CD polypeptides that can be used to stimulate a T cell include, without limitation, CD3, CD28, inducible T cell co-stimulator (ICOS), CD137. CD2. 0X40, CD27, MYD88, and CD40L.

[0098] This document also provides methods and materials involved in treating cancer. For example, one or more T cells having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) can be administered (e.g., in an adoptive cell therapy such as a CAR T cell therapy) to a mammal (e.g., a human) having cancer to treat the mammal. In some cases, methods of treating a mammal having cancer as described herein can reduce the number of cancer cells (e.g., cancer cells expressing a tumor antigen) within a mammal. In some cases, methods of treating a mammal having cancer as described herein can reduce the size of one or more tumors (e.g., tumors expressing a tumor antigen) within a mammal.

[0099] Any appropriate amount (e.g., number) of T cells having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) can be administered (e.g., in an adoptive cell therapy such as a CAR T cell therapy) to a mammal (e.g., a human) having cancer. In some cases, from about 0. 1 x 106T cells (e.g., CAR T cells) to about 10 x 106T cells (e.g., CAR T cells) having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g.. an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide (e g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) per kilogram (kg) bodyweight of the mammal (e.g., from about 0. 1 x 106to about 9 x IO6, from about 0. 1 x 106to about 8 x 106, from about 0.1 x 106to about 7 x 106, from about 0.1 x 106to about 6 x 106, from about 0. 1 x 106to about 5 x 106, from about 0. 1 x 106to about 4 x 106, from about 0.1 x 106to about 3 x 106, from about 0. 1 x 106to about 2 x 106, from about 0. 1 x 106to about 1 x 106, from about 0. 1 x 106to about 0.5 x 106, from about 0.5 x 106to about 10 x 106, from about 1 x 106to about 10 x 106, from about 2 x 106to about 10 x 106, from about 3 x 106to about 10 x 106, from about 4 x 106to about 10 x 106, from about 5 x 106to about 10 x 106, from about 6 x 106to about 10 x 106, from about 7 x 106to about 10 x 106, from about 8 x 106to about 10 x 106, from about 9 x 106to about 10 x 106, from about 0.5 x 106to about 9 x 106. from about 1 x 106to about 8 x 106, from about 2 x 106to about 7 x 106, from about 3 x 106to about 6 x 106, from about 4 x 106to about 5 x 106, from about 1 x 106to about 3 x 106, from about 2 x 106to about 4 x 106, from about 3 x 106to about 5 x 106, from about 4 x 106to about 6 x 106, from about 5 x 106to about 7 x 106, from about 6 x 106to about 8 x 106, or from about 7 x 106to about 9 x 106of T cells per kg) can be administered to a mammal having cancer to treat the mammal.

[0100] Any appropriate mammal (e.g., a human) having a cancer can be treated as described herein. Examples of mammals that can be treated as described herein include, without limitation, humans, non-human primates (e.g., monkeys), dogs, cats, horses, cows, pigs, sheep, mice, and rats. For example, a human having a cancer can be treated with one or more T cells having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) in, for example, an adoptive T cell therapy such as a CAR T cell therapy using the methods and materials described herein.

[0101] When treating a mammal (e g., a human) having a cancer as described herein, the cancer can be any appropriate cancer. In some cases, a cancer treated as described herein can include one or more solid tumors. In some cases, a cancer treated as described herein can be a hematological (blood) cancer. In some cases, a cancer treated as described herein can be a primary cancer. In some cases, a cancer treated as described herein can be a metastatic cancer. In some cases, a cancer treated as described herein can be a refractory cancer. In some cases, a cancer treated as described herein can be a relapsed cancer. In some cases, a cancer treated as described herein can express a tumor-associated antigen (e.g.. an antigenic substance produced by a cancer cell). Examples of cancers that can be treated as described herein include, without limitation, diffuse large B cell lymphoma (DLBCL), Hodgkin’s lymphomas, non-Hodgkin lymphomas, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), germ cell tumors, hepatocellular carcinoma, bowel cancer, lung cancer, breast cancer, ovarian cancer, melanoma, epithelial tumors, brain cancers, multiple myelomas, sarcomas, bone cancers, pancreatic cancers, liver cancers, myeloid neoplasms, prostate cancers, and thyroid cancers.

[0102] In some cases, the methods described herein can include identifying a mammal (e.g., a human) as having a cancer. Any appropriate method can be used to identify a mammal having cancer. For example, imaging techniques and biopsy techniques can be used to identify mammals (e.g., humans) having cancer.

[0103] In some cases, the methods described herein can include identifying a mammal (e.g., a human) as being in need of T cells (e.g., CAR T cells) having reduced susceptibility to T cell (e.g., CAR T cell) cell exhaustion. Any appropriate method can be used to identify a mammal as being in need of T cells (e.g., CAR T cells) having reduced susceptibility to T cell (e.g., CAR T cell) cell exhaustion. For example, medical histories (e.g., evaluations of disease state and / or knowledge of response to prior therapies) and / or diagnosis (e.g.. diagnosis with a cancer that is difficult to treat such as hematological cancer that is difficult to treat) can be used to identify mammals (e.g., humans) as being in need of such T cells (e.g., such CAR T cells).

[0104] A mammal (e.g., a human) having a cancer can be administered one or more T cells having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g.. an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) described herein. For example, one or more T cells having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be used in an adoptive T cell therapy (e.g., a CAR T cell therapy) to treat a mammal having a cancer. For example, one or more T cells having a reduced level of an IL-4R polypeptide and / or reduced activity7of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be used in an adoptive T cell therapy (e.g., a CAR T cell therapy) targeting any appropriate antigen within a mammal (e g., a mammal having cancer). In some cases, an antigen can be a tumor-associated antigen (e.g., an antigenic substance produced by a cancer cell). Examples of tumor-associated antigens that can be targeted by an adoptive T cell therapy provided herein include, without limitation, CD 19 (associated with DLBCL, ALL, and CLL), AFP (associated with germ cell tumors and / or hepatocellular carcinoma), CEA (associated with bow el cancer, lung cancer, and / or breast cancer), CA-125 (associated with ovarian cancer), MUC-1 (associated with breast cancer), ETA (associated w ith breast cancer), MAGE (associated with malignant melanoma), CD33 (associated with AML), CD 123 (associated with AML), CLL- 1 (associated with AML), E-Cadherin (associated with epithelial tumors), folate receptor alpha (associated with ovarian cancers), folate receptor feta (associated with ovarian cancers and AML), IL13R (associated with brain cancers), EGFRviii (associated with brain cancers), CD22 (associated with B cell cancers), CD20 (associated with B cell cancers), kappa light chain (associated with B cell cancers), lambda light chain (associated with B cell cancers), CD44v (associated with AML), CD45 (associated with hematological cancers), CD30 (associated with Hodgkin lymphomas and T cell lymphomas), CD5 (associated with T cell lymphomas), CD7 (associated with T cell lymphomas). CD2 (associated with T cell lymphomas), CD38 (associated with multiple myelomas and AML), BCMA (associated with multiple myelomas), CD138 (associated with multiple myelomas and AML), FAP (associated with solid tumors), CS-1 (associated with multiple myeloma), TSHR (associated with thyroid cancers), and c-Met (associated with breast cancer). For example, one or more T cells having a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be used in CAR T cell therapy targeting CD19 (e.g., a CART19 cell therapy) to treat cancer as described herein.

[0105] In some cases, one or more T cells having (e.g., engineered to have) a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g.. an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) used in an adoptive T cell therapy (e.g., a CAR T cell therapy) can be administered to a mammal having a cancer as a combination therapy with one or more additional agents used to treat a cancer. For example, one or more T cells having a reduced level of an IL-4R polypeptide and / or reduced activity' of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide used in an adoptive cell therapy can be administered to a mammal in combination with one or more anti-cancer treatments (e.g., surgery', radiation therapy, chemotherapy (e.g., alkylating agents such as busulfan). In cases where one or more T cells having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide used in an adoptive cell therapy are used with additional agents treat a cancer, the one or more additional agents can be administered at the same time or independently. In some cases, one or more T cells having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide used in an adoptive cell therapy can be administered first, and the one or more additional agents administered second, or vice versa.

[0106] In some cases, the methods and materials described herein can be applied to immune cells other than T cells, such as natural killer (NK) cells. For example, the methods and materials described herein can be used to design NK cells having (e.g., engineered to have) a reduced level of an IL-4R polypeptide (e.g., IL-4R KO CAR-NK cells) and / or reduced activity of an HS2 IL-4 enhancer (e.g., HS2 KO CAR-NK cells), optionally in combination with a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR-NK cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR-NK cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR-NK cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR-NK cells). In some cases, NK cells having a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be used in an adoptive cell therapy (e.g., a CAR-NK cell therapy). For example, NK cells having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be administered to a mammal having a cancer to treat the cancer. For example, NK cells having a reduced level of an IL-4R polypeptide and / or reduced activity of an IL-4 enhancer (e.g., an HS2 enhancer), optionally in combination with a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide, and / or a reduced level of a PTPN3 polypeptide can be administered to a mammal having a cancer as a combination therapy with one or more additional agents used to treat a cancer.

[0107] The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.

[0108] EXAMPLES

[0109] Example 1 : Induction of CAR T Cell Exhaustion

[0110] An in vitro assay to induce antigen-specific exhaustion in CAR T cells was developed as shown in Fig. 1.

[0111] This assay incorporated a CAR T cell production period of 8 days. On day 0 of the production period, T cells were isolated from peripheral blood mononuclear cells (PBMCs) and stimulated with CD3 / CD28 beads using a 3: 1 ratio of beads to cells. Then, on day 1, the activated T cells were transduced with CAR using lenti virus at a multiplicity of infection of 3. These cells were maintained at a concentration of 1 million cells / mL from day 0 to day 6. On day 6, the CD3 / CD28 beads were removed with magnetic separation, CAR expression was measured by staining the cells with a antibody against ProteinL and using flow cytometry to quantify the percent of positively stained cells. The cells were then rested from day 6 to day 8. On day 8, cells were considered baseline CAR T cells.

[0112] For the exhaustion assay, day 8 CART19 cells were stimulated at a 1 to 1 ratio with the CD19-expressing tumor cell line, JeKo-1. To maintain antigen-specific stimulation of the CART 19 cells, the same number of JeKo-1 cells as was added on day 8 was added every other day (on day 10. day 12, and day 14). On day 15. the CART19 cells were considered exhausted, but the assay was continued until day 22 to establish more terminally exhausted CAR T cells.

[0113] Proliferation assays and degranulation assays were conducted using day 8 (baseline / unstimulated CAR T cells), day 15 (one-week exhausted CAR T cells), or day 22 (two-week exhausted CAR T cells).

[0114] Proliferation Assay

[0115] • Day 0 (start of the proliferation assay using day 8. day 15. or day 22 cells from the exhaustion assay):

[0116] • In a 96-well plate, combine 100 pL of 1x106cells / mL effector cells (CART19 cells) with 100 pL of IxlO6cells / mL target cells (JeKo-1 cells).

[0117] • Day 3 - Feed the cells with fresh media:

[0118] • Remove 100 pL of supernatant from each well

[0119] • Add 100 pL of T cell media (TCM) to ach well and resuspend

[0120] • Day 5: Use flow cytometry' to detect live CD3+ cells.

[0121] Degranulation Assay

[0122] • Using either day 8, day 15, or day 22 cells, plate the degranulation assay as follows:

[0123] • Add the following to each well:

[0124] • 3 pL CD107a FITC (markers of immune cell activation and degranulation)

[0125] • 1 pL monesin (secretion inhibitor)

[0126] • 1 pL CD49d (antibody for costimulation)

[0127] • 2 pL CD28 (antibody for costimulation)

[0128] • 3 pL Flow Buffer

[0129] • Add 100 pL of targets (JeKo-1 cells) at 5x106cells / mL + 100 pL of CART19 cells at IxlO6cells / mL

[0130] • Incubate the cell mixture for 4 hours

[0131] • Use flow cytometry to detect the following: CD3, CD4, CD8, Live / Dead, IL-2, TNF-a, IFN-y, and GM-CSF. Measurement of Inhibitory Receptors:

[0132] On days 8, 15, and 22 of the in vitro exhaustion assay, the ratio of CD4 to CD8+T cells and the percent of T cells that express an inhibitory receptor was determined by staining cells with antibodies for Live / Dead. CD3, CD8, PD-1, TIM-3, CTLA-4, and LAG-3. The parent population for these measurements was live CD3+cells.

[0133] Repeated Stimulation Assay

[0134] To model antigen-driven exhaustion, a 14-day in vitro repeated stimulation assay was developed with healthy donor CART19 cells with a CD28^ costimulatory domain (CART19-28Q (Fig. 1). On Day 15, after 7 days of repeated CAR stimulation (with the CD19+tumor cell line JeK.o-1), CART19-28^ cells demonstrated signs of general dysfunction such as a decrease in antigen-specific proliferative ability (Fig. 2A) and a decrease in the ratio of CD4+to CD8+T cells (Fig. 2B). These signs of dysfunction became more severe as the CAR T cells were repeatedly stimulated for another week to generate Day 22 CART19-28^ cells. In addition, there was a significant loss of polyfunctionality, the ability of CAR T cells to secrete 3 or more cytokines at once, by the Day 22 timepoint (Fig. 2C). The CART 19-28^ cells also began to show exhaustionspecific signs of dysfunction such as an increase in the expression of inhibitory' receptors such as PD-1 (Fig. 3A), TIM-3 (Fig. 3B), CTLA-4 (Fig. 3C), and LAG-3 (Fig. 3D) on Days 15 and 22 of the in vitro exhaustion assay. Additionally, the production of effector cytokines IL-2 (Fig. 3E) and TNF-a (Fig. 3F) was by CART19-28^ cells was reduced on Day 15 and 22 of the exhaustion assay as compared to Day 8 cells.

[0135] When CART 19-28^ cells from the exhaustion assay were tested using an in vivo JeKo-1 tumor model in NSG mice, Day 22 exhausted CART19-28^ cells showed signs of dysfunction. For example, mice treated with Day 22 CART 19-28^ cells had higher tumor burdens (Fig. 4A) and they had reduced overall survival (Fig. 4B).

[0136] Example 2: Epigenetic Landscape of T Cell Exhaustion

[0137] RNA and ATAC Sequencing of in vitro Exhausted CAR T Cells:

[0138] To evaluate the transcriptomic and epigenetic profile of exhausted CAR T cells, RNA and ATAC sequencing was performed on Day 8 and Day 15 cells. An evaluation of the RNA sequencing data revealed the development of a distinct transcriptomic profile by Day 15 (Fig. 5 A). Notably, known exhaustion genes, EOMES and IL 1 ORA, were upregulated in the Day 15 cells (Fig. 5B).

[0139] Next, to evaluate the genes that were both differentially expressed, as determined with RNA sequencing, and differentially accessible, as determined with AT AC sequencing, a sequencing analysis pipeline was developed to intersect the significant genes from each dataset (Fig. 6). RNA sequencing identified 449 significantly upregulated genes and 320 significantly downregulated genes in exhausted CART I 9-28c cells. AT AC sequencing identified 411 gene regions with increased accessibility and 445 gene regions with decreased accessibility. Overlap of RNA and AT AC results showed 105 genes that were both differentially expressed and differentially accessible. Analysis of the genes that were both differentially expressed and accessible with ingenuity pathway analysis revealed an enrichment in the T cell exhaustion pathway (p = 4.23E-03, Z= 1.0), suggested a potential role for the Thl and Th2 activation pathway (p = 4.43E-05) (Fig. 7A), and identified a regulatory role for molecules such as IL-2. Tcf-7, and IL-4 (Fig. 7B).

[0140] To look more specifically at transcription factors that mediate the development of exhaustion, an established multi-omics data analysis framework, Taiji, was used with the RNA and ATAC sequencing datasets. This analysis revealed an enrichment in the known exhausted-related transcription factor EOMES and a loss of AP-1 transcription factors FOSB and FOSL2 in the Day 15 samples (Fig. 8A). Additionally, mining of previously conducted ChIP sequencing experiments in T cells using the ReMAP database revealed an enrichment in binding sites for transcription factors such as TBX21, MYB (a regulator of Tcf-7), and RUNX3 (Fig. 8B).

[0141] RNA and ATAC Sequencing of Baseline Patient CAR T Cells from Responders and Non-Responders :

[0142] In order to evaluate CAR T cell dysfunction with a clinically relevant approach, RNA and ATAC sequencing was performed on pre-infusion axicabtagene ciloleucel (axi- cel; YESCARTA®) from 3 responders and 3 non-responders from the Zuma-1 clinical trial (Locke et al., Lancet Oncol., 20(l):31-42 (2019)). These products were CART19-28^ cells that were generated from B cell lymphoma patient-derived T cells and sequenced after generation before infusion into the patient. RNA sequencing showed 54 differentially expressed genes and ATAC sequencing showed 24 differentially accessible gene regions. Only two genes, IL-4 and HLA-DQB1, were upregulated in non-responders based on both RNA and ATAC sequencing data (Fig. 9).

[0143] Next, to evaluate differences in the transcription factors enriched in baseline Axi- cel products from responders and non-responders, Taiji analysis was used. This analysis revealed an enrichment in EOMES and GAT A3 in baseline products from non-responders (Fig. 10A). Additionally, mining of existing ChlPseq experiments with the ReMAP database again revealed an opening of binding sites for the transcription factors TBX21, MYB, and RUNX3 (Fig. 10B).

[0144] Comparison of RNA Sequencing Results from the in vitro Exhaustion Assay and the Baseline Patient Products:

[0145] To evaluate similarities between the differential gene expression resulting from the in vitro exhaustion assay and the differential gene expression in baseline patient products from responders and non-responders. differentially expressed genes from the in vitro assay that were related to exhaustion and not activation were isolated. To do this, sequencing was also performed on Day 8 CAR T-cells that were stimulated with JeKo-1 cells at a 1 :1 ratio for 24 hours. These CAR T-cells were referred to as Day Activated (DA) CAR T cells. It was discovered that 40 genes were differentially expressed when comparing both DA vs. Day 15 CAR T cells and when comparing Day 8 vs. Day 15 CAR T cells, but not when comparing Day 8 to DA CAR T cells. This list of 40 genes was then compared with the list of 54 genes that were differentially expressed between baseline products from patient responders and non-responders. Only one gene, PTPN3, was found to be in common between these two lists (Fig. 11).

[0146] This indicates that PTPN3 may play a key role in the development of CAR T cell exhaustion related to the development of exhaustion. As such, in vitro validation experiments were performed by adding PTPN3 cDNA to CAR T cells and evaluating signs of dysfunction such as cytotoxicity and proliferation. CAR T cells that were exposed to PTPN3 cDNA exhibited reduced cytotoxicity (Fig. 12A) and reduced proliferative ability (Fig. 12B). Cytotoxicity Protocol

[0147] • Day 0:

[0148] • Culture CART19 cells (effectors) with Jeko LucZsGr (targets) at the following E:T ratios (2.5: 1. 1.25: 1. 0.625: 1, 0.312: 1. 0.156: 1, and 0: 1)

[0149] • Day 2: Measure 48hr cytotoxicity:

[0150] • Dilute 200x luciferin 1:10 with sterile PBS

[0151] • Add 2uL of diluted luciferin per well

[0152] • Resuspend the cells using a multichannel pipettor

[0153] • Check the luminescence with 10 second exposure

[0154] Example 3: Conducting a Genome-Wide CRISPR Knockout Screen to Identify Key Genes in the Development of CAR T Cell Exhaustion

[0155] To further interrogate the epigenetic landscape of exhaustion in CART 1 -28 c cells, a genome-wide CRISPR knockout screen in healthy donor CART19-28^ cells was performed by utilizing an in vitro exhaustion assay (Fig. 13). For the screen, T cells experienced two lentiviral transduction events. The first event occurred on day 1 when the activated T cells were transduced with CAR lentivirus. Then, the second event occurred on day 2 when the CAR T cells were transduced with the gRNA library lentivirus. The gRNA library for this screen utilized a lentiCRISPRv2 vector that contained the gRNA sequence, Cas9 sequence, and a puromycin resistance cassette. The library7consisted of 3 gRNAs per gene and 1,000 non-targeting gRNA sequences. Puromycin selection was performed from day 3 to day 8 by treating the CAR T cells with 1 pg / mL puromycin. On day78, samples were collected for next-generation sequencing (NGS) and then the remaining cells were stimulated with JeKo-1 cells at a 1: 1 ratio as previously described in the in vitro exhaustion assay. On days 15 and 22, magnetic-activated cells sorting (MACS) was used to isolated CAR T-cells for NGS.

[0156] Analysis of the NGS results from the CRISPR screen with MAGeCK-VISPR, revealed successful positive selection by Day 22 of the screen (Fig. l4A). This is shown by an increase in the gini index, a measure of gRNA unevenness, from Day 8 to Day 22. Additionally, samples appeared to cluster due to condition (Day 8 vs. Day 22) as opposed to biological replicate (Fig. 14B). With the encouraging quality results from the CRISPR screen, genes that were positively or negatively selected for by generating a volcano plot were evaluated (Fig. 14C). Two of the top genes that were positively selected for in the screen include PTPN2 and CSF2. Thus, the depletion of PTPN2 and CSF2 appears to enhance CAR T Cell activity by enhancing their proliferative ability.

[0157] To further investigate the pathways that were positively selected for, gene ontology enrichment analysis was performed. The top pathways that were positively selected for include: the regulation of JAK-STAT cascade, negative regulation of IL-2 mediated signaling pathway, and negative regulation of IL-4 mediated signaling pathway (Fig. 15 A). Investigation of the IL -4 in particular revealed positive selection of 2 / 3 gRNAs targeting ILA from Day 8 to Day 22 (Fig. 15B).

[0158] Example 4: ILA as a Regulator of CAR T-Cell Exhaustion

[0159] Since a regulatory role for IL-4 in CAR T-cell dysfunction was identified through three independent approaches: RNA and ATAC sequencing of baseline and exhausted CART 19-28^ cells from the in vitro exhaustion assay. RNA and ATAC sequencing of baseline Axi-cel products from responders and non-responders in the Zuma-1 clinical trial, and a genome-wide CRISPR knockout screen in healthy donor CART19-28^ cells, additional in vitro and in vivo studies were performed to validate ILA’s role in dysfunction. To start, effector functions of healthy donor CART 19-28^ cells were assessed following treatment with human recombinant IL A. Treatment of CART 19-28^ cells with 20ng / mL human recombinant IL-4 (hrIL-4) resulted in general signs of CAR T- cell dysfunction such as a reduction in antigen specific proliferation (Fig. 16A) and a decrease in cytotoxicity (Fig. 16B). Additionally, treatment of CART 19-28^ cells with 20ng / mL hrIL-4 resulted in exhaustion-specific signs of dysfunction by Day 15 such as an increase in the expression of the inhibitory receptor, TIM-3 (Fig. 17A), and an increase in the transcription of EOMES (Fig. 17B) as compared to CAR T-cells treated with diluent. ILA induced CART 19-28^ cell modulation was not due to a direct impact on tumor cells as identified by no change in tumor cytotoxicity or proliferation when JeKo-1 cells alone were treated with human recombinant IL-4 (Fig. 18). These data suggest that the IL-4 can regulate CAR T cell exhaustion that can lead to CART19 therapy failure.

[0160] Next, to evaluate if IL-4 inhibition could prevent the development of exhaustion and therefore improve the efficacy of CAR T cell therapy. JeKo-1 xenograft NSG mice were treated with either a combination of Day 8 CART 19-28^ cells and lOmg / kg ILA monoclonal antibody (mAb) or with a combination of Day 8 CART 19-28^ cells and l Omg / kg IgG control antibody. Combination treatment with the TL-4 mAb significantly reduced tumor burden (Fig. 19A), increased CAR T cell proliferation (Fig. 19B), and increased overall survival (Fig. 19C). Thus, IL-4 inhibition can prevent CAR T cell dysfunction and improve overall treatment efficacy.

[0161] Taken together, these results demonstrate that IL-4 KO CAR T cells are less likely to undergo exhaustion (e.g., as compared to CAR T cells that are not engineered to KO a nucleic acid encoding an IL-4 polypeptide). Additional results of reducing IL-4 expression in T cells (e.g., CAR T cells) are shown in Figs. 20-22.

[0162] Example 5

[0163] The results in this Example re-present and expand on at least some of the results provided in other Examples.

[0164] Since ATAC sequencing was also performed on Days 8 and 15 of the in vitro exhaustion assays, the epigenetic landscape of the baseline and chronically stimulated CAR T cells was evaluated. Consistent with the transcriptomic changes and existing literature, there was enhanced chromatin accessibility at exhaustion-related gene loci (e.g., PDCD1 and ENTPDP) in the chronically stimulated samples (Fig. 20A) as well as enhanced motif accessibility for AP-1 and RUNX family members (Fig. 20B).

[0165] To evaluate CAR T-cell dysfunction in a more clinically relevant setting, RNA and ATAC sequencing was performed on baseline Axi-cel products from 6 responders and 6 non-responders from the Zuma-1 clinical trial. Interrogation of the transcriptome with RNA sequencing of pre-infusion axi-cel products from 6 responders and 6 non- responders showed clustering of non-responder samples (Fig. 21 A). One of the top upregulated genes in CAR T cells from non-responders is IL-4 (Fig. 21B). Additionally, analysis of the differentially expressed genes with QIAGEN IPA identified IL-4 as one of the upstream regulators, along with other genes such as TNF and STAT3 (Fig. 21 C). Differential gene analysis was performed with twelve biological replicates in total, six biological replicates per condition. A cut-off of p-value < 0.05 was used for differentially expressed genes.

[0166] Analy sis of chromatin changes between responder and non-responder samples revealed many similarities to the findings observed following chronic stimulation of healthy donor CART 19-28^ cells in our in vitro model for exhaustion. Motif analysis revealed an enrichment of motif binding sites for EOMES and PRDM1 (Fig. 22A). Additionally, non-responders showed similar enhancement of chromatin accessibility' to exhausted cell populations at exhausti on-related gene loci such as PDCD1, HAVCR2 (TIM-3), and AGATES' (Fig. 22B).

[0167] Functional changes seen after the treatment of CARTI 9-28c cells with 20 ng / mL hrIL-4 did not appear to be a result of an effect of hrIL-4 on JeKo-1 tumor cells. Continuous treatment of CART 19-28^ cells with 20 ng / mL hrIL-4 resulted in an increase in the percent of CAR T cells expressing multiple inhibitory receptors by Day 15 (Fig. 23). Continuous treatment of CAR T cells with hrIL-4 still enhanced the exhaustion profde by Day 15 when the CAR T cells were exposed to cell-free stimulation by CD19 beads. This is seen by a decrease in proliferative ability (Fig. 24A), a decrease in IL-2 production (Fig. 24B), and an increase in the percent of CAR T cells expressing multiple inhibitory’ receptors (Fig. 24C).

[0168] The percent of IL-4 producing CD3 cells was determined following IL-4 knockout in CART19-28 cells using gRNAl or gRNA2 as compared to control gRNA. The DNA sequence encoding gRNAl was TGATATCGCACTTGTGTCCG (SEQ ID NO: 1), the DNA sequence encoding gRNA2 was CAAGTGCGATATCACCTTAC (SEQ ID NO:2), and the DNA sequence encoding a control gRNA was GTATTACTGATATTGGTGGG (SEQ ID NO: 14). The percent of cells producing IL-4 w as determined by' intracellular staining for IL-4 by flow' cytometry' following four hours of antigen-specific CAR stimulation by co-culturing CART cells with JeKo-1 target cells at a 1 :5 effector- to-target ratio. Three biological replicates were tested, demonstrating a significant reduction in IL- 4 producing CD3 cells in response to either gRNAl or gRNA 2 (Fig. 25).

[0169] Percent killing w as measured with bioluminescent imaging after either IL-4 knockout using gRNAl or gRNA2 as compared to control gRNA (as for Fig. 25) in CART 19-28^ cells co-cultured with luciferase+ Jeko-1 cells at various effector-to-target ratios for 24 hours. Three biological replicates were tested. These studies demonstrated increases in killing with both gRNAl and gRNA2, although the results for gRNAl were significant at all E:T ratios tested.

[0170] The effect of IL-4 knockout on CAR T cell exhaustion was then examined. Absolute CD3+cell counts, as determined with flow cytometry, were significantly increased after chronically stimulated control gRNA CART 19-28^ cells or IL-4 knockout CART19-28(^ cells (using gRNA 1) were co-cultured with JeKo-1 target cells at a 1 : 1 ratio for 5 days (Fig. 27 A). The percent of IL-4 knockout CART19-28^ cells (using gRNA 1) was compared with control gRNA CART 19-28 cells producing the effector cytokines IL-2 (Fig. 27B) or IFN-y (Fig. 27C) by strongly stimulating CAR T cells at a 1:5 effector to target cell ratio for four hours before performing intracellular staining for the cytokines (using three biological replicates and taking the average of two technical replicates per biological replicate). The percent of IL-4 knockout CART19-28^ cells producing IFN-y was significantly increased using gRNAl. Absolute CD3+cell counts, determined by flow cytometry, were significantly increased when chronically stimulated IL-4 knockout CAR T cells (using gRNA 2) were co-cultured with JeKo-1 target cells at a 1 :1 ratio for 5 days (using one biological replicate and three technical replicates), as compared with chronically stimulated control gRNA CAR T cells (Fig. 27D). The percent of IL-4 knockout CART 19-28^ cells (using gRNA 2) producing the effector cytokines IL- 2 (Fig. 27E) or IFN-y (Fig. 27F), as determined by strongly stimulating CAR T cells at a 1:5 effector to target cell ratio for four hours before performing intracellular staining for the cytokines (with two biological replicates and taking the average of two technical replicates per biological replicate) was increased as compared with control gRNA CART19-28^ cells, although only the increase for IFN-y was significant. The percent of either control gRNA, IL-4 gRNA 1, or IL-4 gRNA 2 CART 19-28^ cells expressing 0, 1, 2, 3, or 4 inhibitory receptors also was determined following chronic stimulation with the in vitro model for exhaustion, using flow cytometric detection of CD3+cells positive for PD-1, TIMA, CTLA-4, and / or LAG-3 (Fig. 27G).

[0171] Example 6: IL-4 as a Regulator of Exhaustion in Different CAR Constructs

[0172] IL-4 also appears to influence the prevalence of exhaustion in CART19 cells with a 4-lBB costimulatory domain (CART19-BBQ. Treatment of CART19-BB^ cells with 20 ng / mL hrIL-4 resulted in decreased cytotoxicity (Fig. 28A) and a trend for decreased proliferation (Fig. 28B) at baseline. Upon chronic stimulation of CART19-BB(^ cells in the presence of hrIL-4 as opposed to diluent, the proliferative abi 1 i ty decreased (Fig.

[0173] 28C). the ability of CAR T cells to degranulate decreased (Fig. 28D), the production of effector cytokines such as IFN-y and IL-2 decreased (Figs. 28E-28F). and the percentage of CAR T cells expressing multiple inhibitory receptors increased (Fig. 28G). Together, these results indicates that II.-4 can push CART19-BB^ cells towards an exhausted phenotype.

[0174] Example 7: Exemplary Cas9 Polypeptide Sequence

[0175] MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDS GETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDK KHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGH

[0176] FLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLE NLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNL LAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMTKRYDEHHQDLTL LKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELL VKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFR IPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNL PNEKVLPKH SLLYEYFTVYNELTKVKYVTEGMRKPAFL SGEQKKAI VDLLFKTNR KVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENE DILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLIN GIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHI ANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIV1EMARENQTTQKGQKNSR ERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRL SDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLL NAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTK YDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTAL IKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLA NGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKE SILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKEL LGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGE

[0177] LQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEI1EQ1SE FSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTID RKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD (SEQ ID NO: 13) Example 8: Treating Cancer

[0178] A human having cancer is administered CAR T cells having a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 poly peptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells).

[0179] The administered CAR T cells having a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g.. PTPN3 KO CAR T cells) can target (e.g., target and destroy) cancer cells (e.g., cancer cells expressing a tumor antigen targeted by the CAR T cells) within a mammal.

[0180] Example 9: Treating Cancer

[0181] T cells are obtained from a mammal having cancer and are engineered be CAR T cells having a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells).

[0182] The CAR T cells having a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g., PTPN3 KO CAR T cells) are administered back to the human.

[0183] The administered CAR T cells having a reduced level of an IL-4 polypeptide (e.g., IL-4 KO CAR T cells), a reduced level of a TCF7 polypeptide (e.g., TCF7 KO CAR T cells), a reduced level of a PTPN2 polypeptide (e.g., PTPN2 KO CAR T cells), and / or a reduced level of a PTPN3 polypeptide (e.g.. PTPN3 KO CAR T cells) can target (e.g., target and destroy) cancer cells (e.g., cancer cells expressing a tumor antigen targeted by the CAR T cells) within a mammal. Example 10: IL-4R Editing in Human CAR T Cells

[0184] CAR T cell therapy has shown remarkable success in the treatment of cancer, but the durable response remains limited. One factor that limits durable response is the inability of CAR T cells to expand and persist in vivo due to the development of exhaustion. The studies described above showed that IL-4 depletion and / or neutralization can improve CAR T cell expansion both in vitro and in vivo by reducing the incidence of CAR T cell exhaustion.

[0185] Data from a genome-wide CRISPR knockout screen (Figs. 29A-29B) indicated a role for the IL4R receptor pathway in the development of CART cell dysfunction. To further interrogate the mechanism of IL-4 induced CART cell exhaustion, the IL-4 pathway was interrupted in two different locations (the IL4R gene and the IL-4 enhancer HS2) using CRISPR technology.

[0186] To first evaluate if IL-4 reception by CART cells can drive an exhausted phenotype. IL4R knockdown CART19-28^ cells were generated by using CRISPR Cas9 (Fig. 30). IL-4R was effectively reduced in human CAR T cells from healthy donors using the lentiCRISPRv2 plasmid w ith a Cas9 polypeptide and the following gRNA sequences:

[0187] Control gRNA: GTATTACTGATATTGGTGGG (SEQ ID NO: 14)

[0188] IL-4R gRNAl: TGAGCATCTCTACTTGCGAG (SEQ ID NO: 15) IL-4R gRNA2: GCTCCGCCTGTTGTACCAGC (SEQ ID NO: 16) Following chronic stimulation with JeKo-1 cells, IL4R knockdown CART 19-28^ cells showed reduced phenotypical and functional signs of exhaustion such as 1) increased proliferative ability (Fig. 31 A), 2) decreased co-expression of multiple inhibitory receptors (Fig. 3 IB), and 3) increased production of effector cytokines (Fig. 31C-31E). Further, the CD8+population of IL4R knockdown CART cells also showed reduced phenotypical and functional signs of exhaustion (Figs. 32A-32F and 33). This further supported the notion that the IL-4 pathway can drive an exhausted phenotype in CD8+CART cells.

[0189] In order to validate in vitro findings that IL-4 pathway editing can improve the activity7of CART 19-28^ cells, IL4R knockdown CART cells also was tested in vivo using a CD19+JeKo-1 stress xenograft mouse model. In this model. IL4R knockdown

[0190] CART I9-28C cells showed improved antitumor activity as compared with control gRNA CART19-28^ cells (Fig. 34A). Additionally. IL4R knockdown CART19-28^ cells displayed enhanced in vivo expansion as compared to control gRNA CART 19-28^ cells (Fig. 34B). This indicated that editing of the IL-4 pathway in CART cells can improve the activity of CART cells both in vitro and in vivo.

[0191] To evaluate the importance of epigenetic regulation downstream of the IL4R in CART dysfunction, dCas9-KRAB was used to silence the IL-4 enhancer, HS2 (Fig. 35A), using the following gRNAs: gRNA5: CTTTGACCAGGATCTGAGTC (SEQ ID NO: 17) gRNA6: TGTAGTCCTGACTCAGAFCC (SEQ ID NO: 18) gRNA7: CCGTGTGTTTCCATGAAAAC (SEQ ID NO: 19) gRNA8: CCACTGTGAAATTGAGGCTT (SEQ ID NO:20).

[0192] The HS2 enhancer was more accessible in both exhausted healthy donor CART19-28^ cells and preinfusion CART cell products from non-responders in the Zuma-1 clinical trial (Fig. 35A). Silencing of HS2 reduced the production of IL-4 by CART19-28^ cells (Fig. 35B) and increased the cytotoxicity of CART19-28 cells (Fig. 35C). These data demonstrated that modulation of HS2 activity can improve CART cell activity in vitro.

[0193] OTHER EMBODIMENTS

[0194] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

Claims

WHAT Is CLAIMED is:

1. AT cell having reduced susceptibility to T cell exhaustion, wherein said T cell comprises (a) a reduced level of an interleukin-4 receptor (IL-4R) polypeptide, and (b) nucleic acid encoding a chimeric antigen receptor, and wherein said T cell expresses said chimeric antigen receptor.

2. The T cell of claim 1, wherein said T cell comprises a disruption in at least one endogenous allele encoding said IL-4R polypeptide.

3. The T cell of claim 1, wherein said T cell comprises a disruption in both endogenous alleles encoding said IL-4R polypeptide.

4. The T cell of claim 2 or claim 3, wherein said T cell expresses a reduced level of said IL-4R polypeptide as compared to a comparable T cell lacking said disruption.

5. The T cell of any one of claims 1-4, wherein said T cell further comprises a reduced level of an IL-4 polypeptide, a reduced level of a transcription factor 7 (TCF7) polypeptide, a reduced level of a protein tyrosine phosphatase non-receptor type 2 (PTPN2) polypeptide or a reduced level of a protein tyrosine phosphatase non-receptor type 3 (PTPN3) polypeptide.

6. The T cell of claim 5, wherein said T cell comprises a reduced level of an IL-4 polypeptide.

7. The T cell of claim 6, wherein said T cell comprises a disruption in at least one endogenous allele encoding said IL-4 polypeptide.

8. The T cell of claim 6, wherein said T cell comprises a disruption in both endogenous alleles encoding said IL-4 polypeptide.

9. The T cell of claim 7 or claim 8, wherein said T cell expresses a reduced level of said IL-4 polypeptide as compared to a comparable T cell lacking said disruption.

10. The T cell of any one of claims 5-9, wherein said T cell comprises a reduced level of a TCF7 polypeptide.

11. The T cell of claim 10, wherein said T cell comprises a disruption in at least one endogenous allele encoding a TCF7 polypeptide.

12. The T cell of claim 10, wherein said T cell comprises a disruption in both endogenous alleles encoding a TCF7 polypeptide.

13. The T cell of claim 11 or claim 12, wherein said T cell expresses a reduced level of said TCF7 polypeptide as compared to a comparable T cell lacking said disruption.

14. The T cell of any one of claims 5-13, wherein said T cell comprises a reduced level of a PTPN2 polypeptide.

15. The T cell of claim 14, wherein said T cell comprises a disruption in at least one endogenous allele encoding a PTPN2 polypeptide.

16. The T cell of claim 14, wherein said T cell comprises a disruption in both endogenous alleles encoding a PTPN2 polypeptide.

17. The T cell of claim 15 or claim 16. wherein said T cell expresses a reduced level of said PTPN2 polypeptide as compared to a comparable T cell lacking said disruption.

18. The T cell of any one of claims 5-17, w herein said T cell comprises a reduced level of a PTPN3 polypeptide.

19. The T cell of claim 18, wherein said T cell comprises a disruption in at least one endogenous allele encoding a PTPN3 polypeptide.

20. The T cell of claim 18, wherein said T cell comprises a disruption in both endogenous alleles encoding a PTPN3 polypeptide.

21. The T cell of claim 19 or claim 20, wherein said T cell expresses a reduced level of said PTPN3 polypeptide as compared to a comparable T cell lacking said disruption.

22. The T cell of any one of claims 1-21, wherein said chimeric antigen receptor targets a tumor-associated antigen.

23. The T cell of claim 22, wherein said tumor-associated antigen is CD19.

24. The T cell of any one of claims 1-23, wherein said T cell is obtained from a human.

25. The T cell of any one of claims 1-24, wherein said T cell exhibits anti-tumor activity for at least one week.

26. The T cell of claim 25, wherein said T cell exhibits anti-tumor activity for from about one week to about two years.

27. The T cell of any one of claim 1-24, wherein said T cell exhibits proliferation for at least one week.

28. The T cell of claim 27, wherein said T cell does not exhibit T cell exhaustion as rapidly as a comparable T cell lacking said reduced level of said IL-4R polypeptide.

29. AT cell having reduced susceptibility to T cell exhaustion, wherein said T cell comprises (a) reduced activity of an IL-4 enhancer, and (b) nucleic acid encoding a chimeric antigen receptor, and wherein said T cell expresses said chimeric antigen receptor.

30. The T cell of claim 29, wherein said T cell comprises a disruption in at least one endogenous allele comprising said IL-4 enhancer.

31. The T cell of claim 29, wherein said T cell comprises a disruption in both endogenous alleles comprising said IL-4 enhancer.

32. The T cell of any one of claims 29-31, wherein said IL-4 enhancer is an HS2 enhancer.

33. The T cell of any one of claims 29-32, wherein said T cell further comprises a reduced level of an IL-4R polypeptide, a reduced level of an IL-4 polypeptide, a reduced level of a TCF7 polypeptide, a reduced level of a PTPN2 polypeptide or a reduced level of a PTPN3 polypeptide.

34. The T cell of claim 33, wherein said T cell comprises a reduced level of an IL-4R polypeptide.

35. The T cell of claim 34, wherein said T cell comprises a disruption in at least one endogenous allele encoding said IL-4R polypeptide.

36. The T cell of claim 34, wherein said T cell comprises a disruption in both endogenous alleles encoding said IL-4R polypeptide.

37. The T cell of claim 35 or claim 36, wherein said T cell expresses a reduced level of said IL-4R polypeptide as compared to a comparable T cell lacking said disruption.

38. The T cell of any one of claims 33-37, wherein said T cell comprises a reduced level of an IL-4 polypeptide.

39. The T cell of claim 38, wherein said T cell comprises a disruption in at least one endogenous allele encoding said IL-4 polypeptide.

40. The T cell of claim 38, wherein said T cell comprises a disruption in both endogenous alleles encoding said IL-4 polypeptide.

41. The T cell of claim 39 or claim 40, wherein said T cell expresses a reduced level of said IL-4 polypeptide as compared to a comparable T cell lacking said disruption.

42. The T cell of any one of claims 33-41, wherein said T cell comprises a reduced level of a TCF7 polypeptide.

43. The T cell of claim 42, wherein said T cell comprises a disruption in at least one endogenous allele encoding a TCF7 polypeptide.

44. The T cell of claim 42, wherein said T cell comprises a disruption in both endogenous alleles encoding a TCF7 polypeptide.

45. The T cell of claim 43 or claim 44, wherein said T cell expresses a reduced level of said TCF7 polypeptide as compared to a comparable T cell lacking said disruption.

46. The T cell of any one of claims 33-45. wherein said T cell comprises a reduced level of a PTPN2 polypeptide.

47. The T cell of claim 46, wherein said T cell comprises a disruption in at least one endogenous allele encoding a PTPN2 polypeptide.

48. The T cell of claim 46, wherein said T cell comprises a disruption in both endogenous alleles encoding a PTPN2 polypeptide.

49. The T cell of claim 47 or claim 48. wherein said T cell expresses a reduced level of said PTPN2 polypeptide as compared to a comparable T cell lacking said disruption.

50. The T cell of any one of claims 33-49, wherein said T cell comprises a reduced level of a PTPN3 polypeptide.51 . The T cell of claim 50, wherein said T cell comprises a disruption in at least one endogenous allele encoding a PTPN3 polypeptide.

52. The T cell of claim 50, wherein said T cell comprises a disruption in both endogenous alleles encoding a PTPN3 polypeptide.

53. The T cell of claim 51 or claim 52, wherein said T cell expresses a reduced level of said PTPN3 polypeptide as compared to a comparable T cell lacking said disruption.

54. The T cell of any one of claims 29-53, wherein said chimeric antigen receptor targets a tumor-associated antigen.

55. The T cell of claim 54, wherein said tumor-associated antigen is CD 19.

56. The T cell of any one of claims 29-55, wherein said T cell is obtained from a human.

57. The T cell of any one of claims 29-56. wherein said T cell exhibits anti-tumor activity for at least one week.

58. The T cell of claim 57, wherein said T cell exhibits anti-tumor activity for from about one week to about two years.

59. The T cell of any one of claim 29-58, wherein said T cell exhibits proliferation for at least one week.

60. The T cell of claim 59. wherein said T cell does not exhibit T cell exhaustion as rapidly as a comparable T cell lacking said reduced activity of said IL-4 enhancer.

61. A method for treating a mammal having cancer, wherein said method comprises administering, to said mammal, a composition comprising the T cell of any one of claims 1-60.

62. The method of claim 61, wherein said mammal is identified as being in need of T cells having reduced susceptibility to CAR T cell exhaustion.

63. The method of claim 61 or claim 62, wherein said mammal is a human.

64. The method of any one of claims 61-63, wherein said composition comprises from about 0.1 x 106to about 10 x 106of said T cells.

65. The method of any one of claims 61-64, wherein said cancer is a lymphoma.

66. The method of claim 65, wherein said lymphoma is a diffuse large B cell lymphoma.

67. The method of any one of claims 61-64, wherein said cancer is a leukemia.

68. The method of claim 67, wherein said leukemia is an acute lymphoblastic leukemia.

69. The method of any one of claims 61-68, wherein said chimeric antigen receptor targets a tumor-associated antigen.

70. The method of claim 69, wherein said tumor-associated antigen is CD 19.

71. The use of a composition comprising the T cell of any one of claims 1-60 to treat a mammal having cancer.

72. A composition comprising the T cell of any one of claims 1-60 for use in the preparation of a medicament to treat a mammal having cancer.

73. A composition comprising the T cell of any one of claims 1-60 for use in the treatment of cancer.

Citation Information

Patent Citations

  • Method for treating cancer

    US20020076409A1

  • Modulation of novel immune checkpoint targets

    WO2018067991A1

  • Gene targets for manipulating t cell behavior

    WO2024059641A2

  • Treating cancer

    WO2024097276A1