Compositions comprising pharmaceutically acceptable salts and other derivatives of dual GLP-1 / amylin receptor agonists and uses thereof

Abstract

Provided herein are compounds comprising derivatives of dual GLP-1 / amylin receptor agonists and methods of use thereof.

Description

WSGR Docket No.: 56017-735.601 COMPOSITIONS COMPRISING PHARMACEUTICALLY ACCEPTABLE SALTS AND OTHER DERIVATIVES OF DUAL GLP-1 / AMYLIN RECEPTOR AGONISTS AND USES THEREOF CROSS REFERENCE TO RELATED APPLICATIONS

[0001] This application claims the benefit of U.S. Provisional Application No.63 / 662,659, filed on June 21, 2024, which is incorporated herein by reference in its entirety. BACKGROUND

[0002] Glucagon-like peptide-1 (GLP-1) receptor agonists, human amylin analogs, and dual acting compounds of the GLP-1 and amylin receptors, are used for the treatment of various diseases or conditions, such as metabolic diseases, and for weight management. However, there are limitations to currently available compositions or formulations containing GLP-1 receptor agonists, human amylin analogs, and dual acting compounds of the GLP-1 and amylin receptors, such as poor solubility in an aqueous environment and lower stability, which could lead to limited efficacy and high dosing. Thus, there is a need for better compositions or formulations containing such therapeutic compounds. SUMMARY

[0003] In an aspect, provided herein is, inter alia, a compound comprising the structure of Formula I:Formula I, wherein: (a)is an anion of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide;WSGR Docket No.: 56017-735.601 (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein one or more carboxyl groups of the C18 diacid, C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) are in the form(b) is a cationic component.

[0004] In some embodiments, provided herein is a compound consisting, or consisting essentially, of the structure of Formula I.

[0005] In some embodiments, the compounds of any one selected from the group consisting of (i), (ii), (iii), (iv), (v), (vi) and (vii) are referred herein as “peptides (i), (ii), (iii), (iv), (v), (vi) andWSGR Docket No.: 56017-735.601 (vii).”

[0006] In some embodiments, the cationic component is selected from the group consisting of alkali metal, alkaline earth metal, a metal ion such as aluminum, sodium, lithium, potassium, magnesium, calcium, and zinc, ammonium (NH4+), a protonated or positively (+) charged ion from an aliphatic primary amine, secondary amine or tertiary amine such as 2-aminoethanol, tromethamine, dimethylamine, diethylamine, N-ethyl-glucamine, hydrabamine, trimethylamine, triethylamine, dicyclohexylamine, ethanolamine, diethanolamine, triethanolamine, dimethylethanolamine, (2,2′,2″-nitrilotris(ethanol)), 2-diethylaminoethanol, procaine or substituted procaine (e.g., chloroprocaine), meglumine, carnitine, ethylenediamine, choline, acetylcholine, aralkyl amine such as Ν,Ν-dibenzylethylenediamine, benzathine, benethamine; heterocyclic aromatic amine such as pyridine, pyrimidine, picoline, quinoline or isoquinoline, quaternary ammonium (e.g., NH4+) such as betaine, nontoxic quaternary ammonium (e.g., NMe4+, N+(C1–4alkyl)4,), tetramethylammonium, tetraethylammonium, benzyltrimethylammonium, benzyltriethylammonium, benzyltributylammonium, methyltrioctylammonium or tetrabutylammonium; 1H-imidazole, substituted-imidazole (e.g., N-alkyl imidazole, N-methyl imidazole), pyrrolidine, substituted pyrrolidine (e.g., 1-alkyl pyrrolidine, 1-methyl pyrrolidine, 1- (2-hydroxy-ethyl)-pyrrolidine), piperidine or substituted piperidine (e.g., 1-alkyl piperidine, 1- methyl piperidine), piperazine or substituted piperazine (e.g., 1-alkyl piperazine, 1-methyl piperazine, 1,4-dialkyl piperazine, 1,4-dimethyl piperazine), morpholine, substituted morpholine (e.g., N-substituted morpholine, N-methyl morpholine or 4-(2-hydroxyethyl)-morpholine), basic amino acid such as arginine, lysine, or histidine. aminoguanidine, guanidine derivatives and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate. In some embodiments, the cationic component is choline. In some embodiments, the cationic component is not choline.

[0007] In some embodiments, the cationic component is betaine. In some embodiments, the cationic component comprises the structure of:. In some embodiments, the cationic component has the structure of:.

[0008] As used herein, the term “betaine” (alternatively known as “glycine betaine”) refers to a compound having a central methylene carbon (-CH2-) attached to an anionic carboxylate group - (CO2-) on one side and a positively charged cationic quaternary ammonium group -(N(CH3)3+) on the other, where the compound acts as a zwitterion having both positive and negative charges within the same molecule, as shown herein.WSGR Docket No.: 56017-735.601

[0009] In some embodiments, the cationic component and anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component and anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component and anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is from about 1:1 to about 1:12. In some embodiments, the cationic component is selected from the group of cationic components described herein or listed in the preceding paragraph, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is selected from the group of cationic components described herein or listed in the preceding paragraph, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is selected from the group of cationic components described herein or listed in the preceding paragraph, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is from about 1:1 to about 1:12. In some embodiments, the cationic component is selected from the group of cationic components listed in Tables 1A, 1B, 1C, 1D, 1E, 1F and 1G. In some embodiments, the cationic component is selected from the group of cationic components listed in Tables 1A, 1B, 1C, 1D, 1E, 1F and 1G, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is selected from the group of cationic components listed in Tables 1A, 1B, 1C, 1D, 1E, 1F and 1G, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is selected from the group of cationic components listed in Tables 1A, 1B, 1C, 1D, 1E, 1F and 1G, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is from about 1:1 to about 1:12. In some embodiments, the cationic component is selected from the group of cationic components listed inWSGR Docket No.: 56017-735.601 Tables 1A, 1B, 1C, 1D, 1E, 1F and 1G, further provided in a weight % (wt. %) ratio relative to the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) as listed in Tables 1A, 1B, 1C, 1D, 1E, 1F and 1G.

[0010] In some embodiments, the quaternary ammonium has the structure of , wherein: R8, R9, R10, and R11are each independently a substituted or unsubstituted group selected from C1-6aliphatic, phenyl, cycloalkyl, 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, and 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0011] In some embodiments, the quaternary ammonium has the structure of , wherein: R8, R9, R10, and R11are each independently a substituted or unsubstituted C1-6aliphatic.

[0012] In some embodiments, the quaternary ammonium has the structure of , wherein: (i) R8, R9, R10, and R11are independently C1-C6alkyl; (ii) R8, R9, R10, and R11are independently C1-C4alkyl; (iii) R8, R9, and R10are C2 alkyl and R11is C1 alkyl; (iv) R8, R9, and R10are C4alkyl and R11is C1alkyl; (v) all of R8, R9, R10, and R11are C1alkyl; (vi) all of R8, R9, R10, and R11are C2 alkyl; (vii) all of R8, R9, R10, and R11are C3 alkyl; or (viii) all of R8, R9, R10, and R11are C4alkyl.

[0013] In some embodiments, the cationic component is a quaternary ammonium, wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7,WSGR Docket No.: 56017-735.601 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is from about 1:1 to about 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of , wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of , further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of , further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is from about 1:1 to about 1:12.

[0014] In some embodiments, the quaternary ammonium has the structure of.

[0015] In some embodiments, the quaternary ammonium has the structure of or.

[0016] In some embodiments, the quaternary ammonium has the structure of.WSGR Docket No.: 56017-735.601

[0017] In some embodiments, the cationic component is a quaternary ammonium having the,wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the,, , further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of, , further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is from about 1:1 to about 1:12.

[0018] In some embodiments, provided is a hydrate of the compound of the structure of Formula I. The term “hydrate”, as used herein, refers to a solid or a semi-solid form of a chemical compound containing water in a molecular complex. The water is generally in a stoichiometric amount with respect to the chemical compound. Exemplary hydrates include (compound of Formula I • ZH2O), wherein Z is from 1 to 50 equivalents of H2O.

[0019] In another aspect, provided herein is a compound comprising the structure of Formula IIa, Formula IIb, Formula IIc, or any combination thereof:WSGR Docket No.: 56017-735.601 Formula IIa,Formula IIb,Formula IIc, wherein: (a) is a cation of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide;H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide;H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19-WSGR Docket No.: 56017-735.601 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein the N-terminal amino group of any one of (i), (ii), (iii), (iv), (v), (vi) and (vii) is in the formis a cation of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl1]ami no]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]aminoWSGR Docket No.: 56017-735.601 ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein one or more Arg residues of (i), (ii), (iii), (iv), (v), (vi) and (vii) are in the formcation of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide;WSGR Docket No.: 56017-735.601 (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein one or more His residues of (i), (ii), (iii), (iv), (v), (vi) and (vii) are in the form.

[0020] In some embodiments, provided herein is a compound consisting, or consisting essentially, of the structure of Formula IIa, Formula IIb, Formula IIc, or any combination thereof.WSGR Docket No.: 56017-735.601

[0021] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) derive from the structure of the compound in Tables 1A-1G.

[0022] In some embodiments, the anionic component is selected from the group consisting of besylate, mesylate, tosylate, sulfonate, sulfate, methylsulfate, camsylate, isethionate, edisylate, 1- hydroxy-2-naphthoate, 2,2-dichloroacetate, 2-hydroxyethanesulfonate, 2-oxoglutarate, 4- acetamidobenzoate, 4-aminosalicylate, acetate, trifluoroacetate, adipate, ascorbate, aspartate, benzenesulfonate, benzoate, bromide, chloride, camphorate, camphor-10-sulfonate, caprate (decanoate), caproate (hexanoate), caprylate (octanoate), carbonate, cinnamate, citrate, cyclamate, dodecylsulfate, dodecylsulfurate, ethanesulfonate, ethane-1,2-disulfonate, ethanesulfonate, formate, fumarate, galactarate, gentisate, glucoheptonate, gluconate, glutantate, glucuronate, glutamate, glutarate, glycerophosphorate, glycine, glycolate, hippurate, hydrobromate, hydroiodide, hydrochlorate, isobutyrate, lactate, lactobionate, laurate, lysine, maleate, malate, malonate, mandelate, methanesulfonate , naphthalene-1,5-disulfonate, naphthalene-2-sulfonate, nicotinate, nitrate, oleate, orotate, oxalate, palmitate, pamoate, phosphorate, proprionate, pyroglutamate, salicylate, sebacate, stearate, succinate, sulfurate, tannate, tartarate, thiocyanate, toluenesulfonate, undecylenate, α-lipoate, 12-hydroxystearate, 2-(4-isobutylphenyl)propionate, 2- (4,4-dimethyl-2-pentanyl)-5,7,7-trimethyloctanoate, 2-aminoethanesulfonate, 2-hexyldecanoate, 2-hydroxyhippurate, 3-(4-hydroxyphenyl)propionate, 3-methylcrotonate, 3,3- diphenylpropionate, 3,4-dihydroxbenzoate, ,5-dihydroxybenzoate, 4-acetamido-benzoate, 3,7- dimethyloctanoate, 4-hydroxybenzenesulfonate, 4-hydroxybenzoate, 4-methylhexanoate, 4- methyloctanoate, valerate salts including 4-methylvalerate, 5-norbornene-2-carboxylate, 8-[(2- hydroxybenzoyl)amino]octanoate, abietate, acetylcysteine, aconitate, arachidonate, behenate, caffeate, chenodeoxycholate, citronellate, crotonate, galactonate, deoxycholate, dihydrocaffeate, 2-phenylpropionate (hydratropate), tropate, eicosanedioate, eicosapentanoate (EPA), elaidate, ellagate, erucate, ethylenediaminetetraacetate (EDTA), geranate, heptanoate, hydrocinnamate (3- phenylpropionate), isovalerate, glutathione reduced, lactate, laurate, levulinate, linoleate, linolenate, lithocholate, mesaconate, nonanoate, oxalate, coumarate, palmitate, perillate, pimelate, 3–phenylpropionate, pivalate, propionate, pyruvate, ricinoleate, salicylate, 2-hydroxybenzoate, sinapinate (3,5-dimethoxy-4-hydroxycinnamate), sorbate, syringate, tiglate, 2-decenoate, 2- hexenoate, 2-octenoate, 3-octenoate, 7-octenoate, ferulate, undecanoate, valerate, vanillate, perchlorate, alginate, bisulfate, borate, butyrate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecylsulfate, glycerophosphate, hemisulfate, hydroiodide, lauryl sulfate, 2– naphthalenesulfonate, pectinate, persulfate, phosphate, tartrate, o-(4-hydroxybenzoyl)benzoate, 1,2,-ethanedisulfonate, chlorobenzenesulfonate, 4-methylbicyclo[2.2.2]oct-2-ene-carboxylate, 4.4’-methylenebis(3-hydroxy-2- ene-1-carboxylate), trimethylacetate, tertiary butylacetate, laurylWSGR Docket No.: 56017-735.601 sulfurate, hydroxynaphthoate, muconate, α-ketoglutarate, p-toluenesulfonate, p-coumarate, and p- chlorobenzenesulfonate.

[0023] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and anionic component are provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7 or 1:8. In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and anionic component are provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7 or 1:8. In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and anionic component are provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is from about 1:1 to about 1:8. In some embodiments, the anionic component is selected from the group of anionic components described herein or listed in the preceding paragraph, further provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7 or 1:8. In some embodiments, the anionic component is selected from the group of anionic components described herein or listed in the preceding paragraph, provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7 or 1:8. In some embodiments, the anionic component is selected from the group of anionic components described herein or listed in the preceding paragraph, provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is from about 1:1 to about 1:8. In some embodiments, the anionic component is selected from the group of cationic components listed in Tables 2A-2G. In some embodiments, the anionic component is selected from the group of anionic components listed in Tables 2A-2G, further provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7 or 1:8. In some embodiments, the anionic component is selected from the group of cationic components listed in Tables 2A-2G, provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7 or 1:8. In some embodiments, the anionic component is selected from the group of cationic components listed in Tables 2A-2G, provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is from about 1:1 to about 1:8. In some embodiments, the anionic component is selected from the group of anionic components listed in Tables 2A-2G, furtherWSGR Docket No.: 56017-735.601 provided in a weight % (wt. %) ratio relative to the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) as listed in Tables 2A-2G.

[0024] In some embodiments, provided is a hydrate of the compound of the structure of Formula IIa, Formula IIb, Formula IIc. Exemplary hydrates include (compound of Formula IIa, Formula IIb, Formula IIc or any combination thereof • ZH2O), wherein Z is from 1 to 50.

[0025] In some embodiments, (i) a weight % (wt. %) ratio of : is from about 0.1 wt. %: 99.9 wt. % to about 20.0 wt. %: 80.0 wt. %; or(ii) a weight % (wt. %) ratioany combination thereofis from about 0.1 wt. %: 99.9 wt. % to about 20.0 wt. %: 80.0 wt. %.

[0026] In some embodiments, (i) a molar ratio of : is from about 2:1 to about 10:1; or(ii) a molar ratio of, or any combination thereof is fromabout 2:1 to about 10:1.

[0027] In some embodiments, (i) a molar ratio of :is from about 2:1 to about 7:1; or(ii) a molar ratio of, or any combination thereof is fromabout 2:1 to about 7:1.

[0028] In some embodiments, (i) a molar ratio of : is from about 3:1 to about 7:1; orWSGR Docket No.: 56017-735.601(ii) a molar ratioany combination thereof is fromabout 3:1 to about 7:1.

[0029] In some embodiments, (i) a molar ratio of : is from about 4:1 to about 7:1; or(ii) a molar ratioany combination thereof is fromabout 4:1 to about 7:1.

[0030] In some embodiments, (i) a molar ratio of : is from about 3:1 to about 7:1; or(ii) a molar ratio of, or any combination thereof is about4:1.

[0031] In another aspect, provided herein is a compound comprising the structure of Formula III:Formula III or a pharmaceutically acceptable salt thereof, wherein: is a covalent derivative of one or more carboxyl groups of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt thereof; and each R100is as defined herein.WSGR Docket No.: 56017-735.601

[0032] In another aspect, provided herein is a compound comprising the structure of Formula IV:Formula IV or a pharmaceutically acceptable salt thereof, wherein:is a covalent derivative of one or more hydroxyl groups of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt thereof; and each R101is as defined herein.

[0033] In another aspect, provided herein is a compound comprising the structure of Formula V or Formula VI:Formula VFormula VI or a pharmaceutically acceptable salt of each thereof; wherein:each a covalent derivative of one or more amino or imidazole groups of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt thereof; and each of R102and R103is as defined herein.

[0034] In one aspect, provided is a compound comprising the structure of Formula X:WSGR Docket No.: 56017-735.601Formula X, wherein:anion; and (b) is a cation of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2- [2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]et hoxy]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; wherein the compound has a: molar ratio of from about 1:1 to about 8:1.

[0035] In some embodiments, is a cation of:.

[0036] In some embodiments,is an anion selected from the group consisting of formate, acetate, and trifluoroacetate. In some embodiments,is formate. In some embodiments, is acetate. In some embodiments, is trifluoroacetate.

[0037] In some embodiments, the: molar ratio is from about 1:1 to about 8:1. Insome embodiments, the: molar ratio is from about 2:1 to about 8:1. In someembodiments, the : molar ratio is from about 3:1 to about 8:1. In some embodiments,WSGR Docket No.: 56017-735.601the : molar ratio is from about 4:1 to about 8:1. In some embodiments, the :molar ratio is from about 5:1 to about 8:1. In some embodiments, the : molar ratio isfrom about 6:1 to about 8:1. In some embodiments, the : molar ratio is from about 7:1to about 8:1. In some embodiments, the : molar ratio is about 1:1. In someembodiments, the : molar ratio is about 2:1. In some embodiments, the :molar ratio is about 3:1. In some embodiments, the : molar ratio is about 4:1. In someembodiments, the : molar ratio is about 5:1. In some embodiments, the :molar ratio is about 6:1. In some embodiments, the : molar ratio is about 7:1. In someembodiments, the : molar ratio is about 8:1.

[0038] In some embodiments, is formate. In some embodiments, is formate, where the weight percentage (%) of formate relative to the weight of the compound is from about 0.5% to about 5.0%. In some embodiments,is formate. In some embodiments, the weight percentage (%) of formate relative to the weight of the compound is from about 0.5% to about 4.7%. In some embodiments, the weight percentage (%) of formate relative to the weight of the compound is from about 1.1% to about 4.7%. In some embodiments, the weight percentage (%) of formate relative to the weight of the compound is from about 1.7% to about 4.7%. In some embodiments, the weight percentage (%) of formate relative to the weight of the compound is from about 2.3% to about 4.7%. In some embodiments, the weight percentage (%) of formate relative to the weight of the compound is from about 2.9% to about 4.7%. In some embodiments, the weight percentage (%) of formate relative to the weight of the compound is from about 3.5% to about 4.7%. In some embodiments, the weight percentage (%) of formate relative to the weight of the compound is from about 4.1% to about 4.7%.WSGR Docket No.: 56017-735.601

[0039] In some embodiments, is acetate, where the weight percentage (%) of acetate relative to the weight of the compound is from about 0.7% to about 6.1%. In some embodiments, the weight percentage (%) of acetate relative to the weight of the compound is from about 1.5% to about 6.1%. In some embodiments, the weight percentage (%) of acetate relative to the weight of the compound is from about 2.2% to about 6.1%. In some embodiments, the weight percentage (%) of acetate relative to the weight of the compound is from about 3.0% to about 6.1%. In some embodiments, the weight percentage (%) of acetate relative to the weight of the compound is from about 3.7% to about 6.1%. In some embodiments, the weight percentage (%) of acetate relative to the weight of the compound is from about 4.5% to about 6.1%. In some embodiments, the weight percentage (%) of acetate relative to the weight of the compound is from about 5.2% to about 6.1%.

[0040] In some embodiments, is trifluoroacetate, where the weight percentage (%) of trifluoroacetate relative to the weight of the compound is from about 1.4% to about 11.7%. In some embodiments, the weight percentage (%) of trifluoroacetate relative to the weight of the compound is from about 2.9% to about 11.7%. In some embodiments, the weight percentage (%) of trifluoroacetate relative to the weight of the compound is from about 4.3% to about 11.7%. In some embodiments, the weight percentage (%) of trifluoroacetate relative to the weight of the compound is from about 5.8% to about 11.7%. In some embodiments, the weight percentage (%) of trifluoroacetate relative to the weight of the compound is from about 7.2% to about 11.7%. In some embodiments, the weight percentage (%) of trifluoroacetate relative to the weight of the compound is from about 8.7% to about 11.7%. In some embodiments, the weight percentage (%) of trifluoroacetate relative to the weight of the compound is from about 10.1% to about 11.7%.

[0041] In one aspect, provided is a compound comprising the structure of Formula XX: Formula XX, wherein: (a)is an anion of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2- [2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]et hoxy]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; andWSGR Docket No.: 56017-735.601 (b) is an anion; wherein the compound has a : molar ratio of from about 1:1 to about 1:12.

[0042] In some embodiments,is an anion of:.

[0043] In some embodiments, is a cation selected from the group consisting of choline andbetaine.

[0044] In some embodiments, is choline. In some embodiments, is betaine.

[0045] In some embodiments, the : molar ratio is from about 1:1 to about 1:12. Insome embodiments, the : molar ratio is from about 1:2 to about 1:12. In someembodiments, the : molar ratio is from about 1:3 to about 1:12. In some embodiments,the : molar ratio is from about 1:4 to about 1:12. In some embodiments, the :molar ratio is from about 1:5 to about 1:12. In some embodiments, the : molar ratiois from about 1:6 to about 1:12. In some embodiments, the : molar ratio is from about1:7 to about 1:12. In some embodiments, the : molar ratio is from about 1:8 to about1:12. In some embodiments, the : molar ratio is from about 1:9 to about 1:12. In someWSGR Docket No.: 56017-735.601embodiments, the : molar ratio is from about 1:10 to about 1:12. In some embodiments,the: molar ratio is from about 1:11 to about 1:12.In some embodiments, the : molar ratio is about 1:1. In some embodiments, the: molar ratio is about 1:2. In some embodiments, the : molar ratio is about1:3. In some embodiments, the : molar ratio is about 1:4. In some embodiments, the: molar ratio is about 1:5. In some embodiments, the : molar ratio is about1:6. In some embodiments, the : molar ratio is about 1:7. In some embodiments, the:some : molar ratio is about1:9. In some embodiments, the : molar ratio is about 1:10. In some embodiments,the : molar ratio is about 1:11. In some embodiments, the : molar ratio isabout 1:12.

[0046] In some embodiments, is choline, where the weight percentage (%) of choline relative to the weight of the compound is from about 1.3% to about 16.0%. In some embodiments, the weight percentage (%) of choline relative to the weight of the compound is from about 2.6% to about 16.0%. In some embodiments, the weight percentage (%) of choline relative to the weight of the compound is from about 3.9% to about 16.0%. In some embodiments, the weight percentage (%) of choline relative to the weight of the compound is from about 5.3% to about 16.0%. In some embodiments, the weight percentage (%) of choline relative to the weight of the compound is from about 6.6% to about 16.0%. In some embodiments, the weight percentage (%) of choline relative to the weight of the compound is from about 7.9% to about 16.0%. In some embodiments, the weight percentage (%) of choline relative to the weight of the compound is from about 9.2% to about 16.0%. In some embodiments, the weight percentage (%) of choline relative to the weight of the compound is from about 10.6% to about 16.0%. In some embodiments, theWSGR Docket No.: 56017-735.601 weight percentage (%) of choline relative to the weight of the compound is from about 11.9% to about 16.0%. In some embodiments, the weight percentage (%) of choline relative to the weight of the compound is from about 13.2% to about 16.0%. In some embodiments, the weight percentage (%) of choline relative to the weight of the compound is from about 14.6% to about 16.0%.

[0047] In some embodiments, is betaine, where the weight percentage (%) of betaine relative to the weight of the compound is from about 1.4% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 2.9% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 4.4% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 5.9% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 7.4% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 8.9% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 10.4% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 11.9% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 13.4% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 14.9% to about 18.0%. In some embodiments, the weight percentage (%) of betaine relative to the weight of the compound is from about 16.4% to about 18.0%.

[0048] As used herein, the term “pharmaceutically acceptable salt” refers to any of the cationic components or anionic components described herein.

[0049] In another aspect, provided herein is a pharmaceutical composition comprising the compound as provided herein, and a pharmaceutically acceptable excipient.

[0050] In some embodiments, the pharmaceutical composition is formulated for parenteral administration, oral administration, or implantable administration.

[0051] In some embodiments, the pharmaceutical composition is formulated for subcutaneous administration or intravenous administration.

[0052] In another aspect, provided herein is a drug delivery device comprising the compound as provided herein, or the pharmaceutical composition as provided herein.

[0053] In some embodiments, the drug delivery device is a syringe, a single-dose pen with an injection needle, or an autoinjector with an injection needle.WSGR Docket No.: 56017-735.601

[0054] In some embodiments, the drug delivery device is an implantable osmotic drug delivery device.

[0055] In another aspect, provided herein is a kit comprising the compound as provided herein, the pharmaceutical composition as provided herein, or the drug delivery device as provided herein.

[0056] In some embodiments, the kit as provided herein further comprises an instruction for use.

[0057] In another aspect, provided herein is a method of treating a disease or disorder in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the compound as provided herein, or the pharmaceutical composition as provided herein, wherein the administering is effective to treat the disease or disorder in the subject.

[0058] In some embodiments, the compound or the pharmaceutical composition is administered to the subject using the drug delivery device as provided herein.

[0059] In some embodiments, the disease or disorder is a metabolic disease or disorder, a cardiovascular disease or disorder, chronic kidney disease, or a neurological disease or disorder.

[0060] In some embodiments, the disease or disorder is selected from the group consisting of type 1 diabetes, type 2 diabetes, obesity, overweight, metabolic dysfunction–associated fatty liver disease (MAFLD), metabolic dysfunction-associated steatohepatitis (MASH), and nonalcoholic steatohepatitis (NASH).

[0061] In some embodiments, the disease or disorder is selected from the group consisting of arrhythmia, coronary artery disease, heart failure, valve disease, aortic disease, congenital heart disease, heart attack, angina, cardiomyopathy, peripheral arterial disease, atherosclerosis, cardiac dysrhythmias, pericarditis, pulmonary hypertension, stroke, cerebrovascular disease, rheumatic heart disease, atrial fibrillation, Brugada syndrome, aortic stenosis, bradycardia, endocarditis, high cholesterol, and long QT syndrome.

[0062] In some embodiments, the disease or disorder is Parkinson’s disease or Alzheimer disease.

[0063] In some embodiments, the subject is human.

[0064] In some embodiments, the compound or the pharmaceutical composition is administered to the subject via parenteral administration, oral administration, or implantable administration.

[0065] In some embodiments, the compound or the pharmaceutical composition is administered to the subject via subcutaneous administration or intravenous administration.

[0066] In another aspect, provided herein is a method of reducing weight in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the compound as provided herein or the pharmaceutical composition as provided herein, wherein the administering is effective to reduce weight in the subject.WSGR Docket No.: 56017-735.601

[0067] In some embodiments, the compound or the pharmaceutical composition is administered to the subject using the drug delivery device as provided herein.

[0068] In some embodiments, the subject is human.

[0069] In some embodiments, the subject has obesity or is overweight.

[0070] In some embodiments, the compound or the pharmaceutical composition is administered to the subject via parenteral administration, oral administration, or implantable administration.

[0071] In some embodiments, the compound or the pharmaceutical composition is administered to the subject via subcutaneous administration or intravenous administration. DETAILED DESCRIPTION

[0072] Provided herein is a compound comprising an ionic form (i.e., salt form), ester or prodrug of a therapeutic agent, particularly a dual GLP-1 / amylin receptor agonist (“RA”), such as any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). In some embodiments, provided is a compound comprising an ionic form (i.e., salt form) of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), and a counterion thereof. In some embodiments, any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is in a cationic form and the counterion is an anion. In some embodiments, any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is in an anionic form and the counterion is a cation. In some embodiments, the compound is a salt composed of an ionic form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and a counterion thereof. In some embodiments, any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is a cationic component of the salt and the counterion is an anionic component of the salt. In some embodiments, any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is an anionic component of the salt and the counterion is a cationic component of the salt. Further provided herein is a compound comprising an ester of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), or a pharmaceutically acceptable salt thereof. Still further provided herein is a compound comprising a prodrug of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), or a pharmaceutically acceptable salt thereof.

[0073] Applicant has discovered that any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), despite being optimized for “drug-likeness” with respect to its amino acid sequence and chemical structure, is nonetheless unoptimized for drug-likeness with respect to potential ionic salt forms, esters and / or prodrug derivatives of this peptide. Not only is the choice of salt form, ester and / or prodrug, among numerous possibilities, critical to enhancement of certain drug like properties of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), but so too is the ratio (i.e.,) stoichiometry of salt, ester and / or prodrug form employed, particularly for such complex peptides as those of (i), (ii), (iii), (iv), (v), (vi) or (vii), each having twelve (12) carboxylic acid residues and eight (8) basic residues. The ratio of salt, ester and / or prodrug form employed and optimized can be basedWSGR Docket No.: 56017-735.601 on weight / weight ratio (i.e., wt. % or % w / w) of any given salt counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), generally ranging from 0.1 wt. % to 50.0 wt. % salt relative to 99.9 wt. % to 50.0 wt. % any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), or molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to any given salt counterion, and / or ester or prodrug moiety, generally ranging from 1:1 to 1:12 cations or ester or moieties or 1:1 to 1:8 anions or prodrug moieties. Optimization of the ratio of peptide to counterion can be used to further “tune” certain desired drug like properties of this peptide relative to those, for example, of the unoptimized free acid of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). Similarly, the choice, location and molar equivalents of ester or prodrug derivatives, or pharmaceutically acceptable salts thereof, of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) can also be used to further tune certain desired drug like properties of this peptide relative to those, for example, of the unoptimized free acid.

[0074] From myriad potential permutations, Applicant conducted comparative experimentation and analyses of the resulting data to identify certain ionic salt forms, esters and prodrugs of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), in certain wt. % ratios of salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), generally ranging from 0.1 wt. % to 50.0 wt. % salt relative to 99.9 wt. % to 50.0 wt. % any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), or salt, ester and / or prodrug forms in certain molar ratios of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), that provide surprising advantages including enhanced stability and improved solubility in an aqueous environment relative to known injectable and oral administrations of, for example, the free acid of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii).

[0075] Accordingly, provided are improved compounds corresponding to disclosed salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to any given salt counterion, generally ranging from 1:1 to 1:12 cations or 1:1 to 1:8 anions, and in some embodiments having wt. % ratios of salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.1 wt. % to 50.0 wt. % salt relative to 99.9 wt. % to 50.0 wt. % any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). Further provided are improved compounds corresponding to disclosed ester and prodrug forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), that have been optimized to selectively reduce the propensity for detrimental qualities, including poor solubility in an aqueous environment at any given dose relative to existing “free acid” formulation of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). As such, improved pharmaceutical compositions comprising disclosed prodrug and / or ester and / or salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) of the present invention may permit lower dosing (and reduced cost of goods, i.e., COGs) as an additional means to achieve greater efficacy than existing “free acid”WSGR Docket No.: 56017-735.601 formulations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). In some embodiments, from 1 to 12 esters are formed from 1 to 12 carboxylic acid moieties of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). Definitions

[0076] Certain specific details of this description are set forth in order to provide a thorough understanding of various embodiments. However, one skilled in the art will understand that the present disclosure may be practiced without these details. In other instances, well-known structures have not been shown or described in detail to avoid unnecessarily obscuring descriptions of the embodiments.

[0077] Unless the context requires otherwise, throughout the specification and claims which follow, the word “comprise” and variations thereof, such as, “comprises” and “comprising,” as used herein, are to be construed in an open, inclusive sense, that is, as “including, but not limited to.” Further, headings provided herein are for convenience only and do not interpret the scope or meaning of the claimed disclosure.

[0078] As used in this specification and the appended claims, the singular forms “a,” “an,” and “the,” as used herein, include plural referents unless the content clearly dictates otherwise. The use of the words “a” or “an,” as used herein, when used in conjunction with the term “comprising” herein may mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.”

[0079] It should also be noted that the term “or,” as used herein, is generally employed in its sense including “and / or” unless the content clearly dictates otherwise.

[0080] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described below.

[0081] The term “about,” as used herein, when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ±20% or in some instances ±10%, or in some instances ±5%, or in some instances ±1%, or in some instances ±0.1% from the specified value, as such variations are appropriate to perform the disclosed methods. As used herein, “about” and “approximately” generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given range of values.WSGR Docket No.: 56017-735.601

[0082] The terms “polypeptide”, “peptide” and “protein” (if single chain) are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. The polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.

[0083] The terms “nucleic acid,” “nucleic acid sequence,” “nucleotide sequence,” or “polynucleotide sequence,” and “polynucleotide” are used interchangeably. As used herein, they refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. The polynucleotide may be either single-stranded or double- stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component. The nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a non-natural arrangement.

[0084] The compositions and methods as provided herein encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%. 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% identical or higher to the sequence specified. In the context of an amino acid sequence, the term “substantially identical” is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and / or common functional activity. For example, amino acid sequences that contain a common structural domain having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%.97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to a reference sequence, e.g., a sequence provided herein. In the context of nucleotide sequence, the term “substantially identical” is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequencesWSGR Docket No.: 56017-735.601 encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity. For example, nucleotide sequences having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%. 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% sequence identity to a reference sequence, e.g., a sequence provided herein.

[0085] Calculations of homology or sequence identity between sequences (the terms are used interchangeably herein) are performed as follows. To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”).

[0086] The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453 ) algorithm which has been incorporated into the GAP program in the GCG software package (available at http: / / www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http: / / www.gcg.com), using a NWSgapdna. CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. A particularly preferred set of parameters (and the one that should be used unless otherwise specified) are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.

[0087] The percent identity between two amino acid or nucleotide sequences can be determinedWSGR Docket No.: 56017-735.601 using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The nucleic acid and protein sequences described herein can be used as a “query sequence” to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score = 100, wordlength = 12 to obtain nucleotide sequences homologous to a nucleic acid molecule . BLAST protein searches can be performed with the XBLAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to protein molecules . To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.

[0088] The term “agonist,” as used herein, refers to a molecule or an agent that activates a receptor to produce a biological response. In contrast, the term “antagonist,” as used herein, refers to a molecule or an agent that blocks the action of the agonist, and the term “inverse agonist,” as used herein, refers to a molecule or an agent that causes an action opposite to that of the agonist. In some embodiments, the agonist may be an endogenous agonist. In some embodiments, the agonist may be an exogenous agonist. In some embodiments, the agonist may be a polypeptide. In some embodiments, the agonist may be a polynucleotide, a nucleoside, an amino acid, a sugar, a carbohydrate, a lipid, or any combination thereof. In some embodiments, the agonist may be a chemical.

[0089] The term “variant,” as used herein, refers to a polypeptide that has a substantially identical amino acid sequence to a reference amino acid sequence, or is encoded by a substantially identical nucleotide sequence. In some embodiments, the variant is a functional variant. In some embodiments, a GLP-1 / amylin analog variant can bind to both the GLP-1 and amylin receptors and activate receptor signaling in both.

[0090] The term “functional variant,” as used herein, refers to a polypeptide that has a substantially identical amino acid sequence to a reference amino acid sequence, or is encoded by a substantially identical nucleotide sequence, and is capable of having one or more activities of the reference amino acid sequence.

[0091] The term “functional fragment,” as used herein, refers to a polypeptide that has a partial amino acid sequence of a reference amino acid sequence, and is capable of having one or more activities of the reference amino acid sequence. In some embodiments, the functional fragment comprises at least about 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%,WSGR Docket No.: 56017-735.601 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% amino acid sequence of a reference amino acid sequence. In some embodiments, the functional fragment comprises an amino acid sequence that has at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acid deletion from the reference amino acid sequence. In some embodiments, the functional fragment comprises an amino acid sequence that has at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 350, 400, 450, or 500 amino acids of the reference amino acid sequence.

[0092] It is understood that the polypeptide as described herein may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.

[0093] The term “amino acid,” as used herein, is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids. Exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing. As used herein the term “amino acid” includes both the D- or L- optical isomers and peptidomimetics.

[0094] A “conservative amino acid substitution,” as used herein, is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).

[0095] As used herein, the term “molecule” as used in, e.g., agonist molecule, polypeptide molecule, or receptor molecule, includes full-length, naturally-occurring molecules, as well as variants, e.g., functional variants (e.g., truncations, fragments, mutated (e.g., substantially similar sequences) or derivatized form thereof), so long as at least one function and / or activity of the unmodified (e.g., naturally-occurring) molecule remains.

[0096] The term “salt” and “salt form” as used interchangeably herein, refer to a compound comprising an ionic assembly of positively charged cationic components (also known as positiveWSGR Docket No.: 56017-735.601 ions and cations) and negatively charged anionic components (also known as negative ions and anions). In some embodiments, the salt is a neutral compound with no net electric charge. In some embodiments, the cationic components and the anionic components are held together by electrostatic forces termed ionic bonds. Compounds, Derivatives and Salts

[0097] Compounds and salts of the present invention include those described generally herein. As used herein, the following definitions shall apply unless otherwise indicated. For purposes of this invention, the chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75thEd. Additionally, general principles of organic chemistry are described in “Organic Chemistry”, Thomas Sorrell, University Science Books, Sausalito: 1999, and “March’s Advanced Organic Chemistry”, 5thEd., Ed.: Smith, M.B. and March, J., John Wiley & Sons, New York: 2001, the entire contents of which are hereby incorporated by reference.

[0098] The term “aliphatic” or “aliphatic group”, as used herein, means a straight-chain (i.e., unbranched) or branched, substituted or unsubstituted hydrocarbon chain that is completely saturated or that contains one or more units of unsaturation, or a monocyclic hydrocarbon or bicyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic (also referred to herein as "carbocycle," “cycloaliphatic” or “cycloalkyl”), that has a single point of attachment to the rest of the molecule. Unless otherwise specified, aliphatic groups contain 1-6 aliphatic carbon atoms. In some embodiments, aliphatic groups contain 1-5 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-4 aliphatic carbon atoms. In still other embodiments, aliphatic groups contain 1-3 aliphatic carbon atoms, and in yet other embodiments, aliphatic groups contain 1-2 aliphatic carbon atoms. In some embodiments, “cycloaliphatic” (or “carbocycle” or “cycloalkyl”) refers to a monocyclic C3-C6 hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, that has a single point of attachment to the rest of the molecule. Suitable aliphatic groups include, but are not limited to, linear or branched, substituted or unsubstituted alkyl, alkenyl, alkynyl groups and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl.

[0099] The term “lower alkyl” refers to a C1-4 straight or branched alkyl group. Exemplary lower alkyl groups are methyl, ethyl, propyl, isopropyl, butyl, isobutyl, and tert-butyl.

[0100] The term “lower haloalkyl” refers to a C1-4straight or branched alkyl group that is substituted with one or more halogen atoms.

[0101] The term “heteroatom” means one or more of oxygen, sulfur, nitrogen, phosphorus, orWSGR Docket No.: 56017-735.601 silicon (including, any oxidized form of nitrogen, sulfur, phosphorus, or silicon; the quaternized form of any basic nitrogen or; a substitutable nitrogen of a heterocyclic ring, for example N (as in 3,4-dihydro-2H-pyrrolyl), NH (as in pyrrolidinyl) or NR+(as in N-substituted pyrrolidinyl)).

[0102] The term "unsaturated," as used herein, means that a moiety has one or more units of unsaturation.

[0103] As used herein, the term “bivalent C1-8(or C1-6) saturated or unsaturated, straight or branched, hydrocarbon chain”, refers to bivalent alkylene, alkenylene, and alkynylene chains that are straight or branched as defined herein.

[0104] As used herein, the term “cyclopropylenyl” refers to a bivalent cyclopropyl group of the following structure:.

[0105] The term “halogen” means F, Cl, Br, or I.

[0106] The term “aryl” used alone or as part of a larger moiety as in “aralkyl,” “aralkoxy,” or “aryloxyalkyl,” refers to monocyclic or bicyclic ring systems having a total of five to fourteen ring members, wherein at least one ring in the system is aromatic and wherein each ring in the system contains 3 to 7 ring members. The term “aryl” may be used interchangeably with the term “aryl ring.” In certain embodiments of the present invention, “aryl” refers to an aromatic ring system which includes, but not limited to, phenyl, biphenyl, naphthyl, anthracyl and the like, which may bear one or more substituents. Also included within the scope of the term “aryl,” as it is used herein, is a group in which an aromatic ring is fused to one or more non–aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like.

[0107] The terms “heteroaryl” and “heteroar–,” used alone or as part of a larger moiety, e.g., “heteroaralkyl,” or “heteroaralkoxy,” refer to groups having 5 to 10 ring atoms, preferably 5, 6, or 9 ring atoms; having 6, 10, or 14 ^ electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to five heteroatoms. The term “heteroatom” refers to nitrogen, oxygen, or sulfur, and includes any oxidized form of nitrogen or sulfur, and any quaternized form of a basic nitrogen. Heteroaryl groups include, without limitation, thienyl, furanyl, pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl. The terms “heteroaryl” and “heteroar–”, as used herein, also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the heteroaromatic ring. Nonlimiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4H–quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl,WSGR Docket No.: 56017-735.601 tetrahydroisoquinolinyl, and pyrido[2,3–b]–1,4–oxazin–3(4H)–one. A heteroaryl group may be mono– or bicyclic. The term “heteroaryl” may be used interchangeably with the terms “heteroaryl ring,” “heteroaryl group,” or “heteroaromatic,” any of which terms include rings that are optionally substituted. The term “heteroaralkyl” refers to an alkyl group substituted by a heteroaryl, wherein the alkyl and heteroaryl portions independently are optionally substituted.

[0108] As used herein, the terms “heterocycle,” “heterocyclyl,” “heterocyclic radical,” and “heterocyclic ring” are used interchangeably and refer to a stable 5– to 7–membered monocyclic or 7–10–membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above. When used in reference to a ring atom of a heterocycle, the term "nitrogen" includes a substituted nitrogen. As an example, in a saturated or partially unsaturated ring having 0–3 heteroatoms selected from oxygen, sulfur or nitrogen, the nitrogen may be N (as in 3,4– dihydro–2H–pyrrolyl), NH (as in pyrrolidinyl), or+NR (as in N–substituted pyrrolidinyl).

[0109] A heterocyclic ring can be attached to its pendant group at any heteroatom or carbon atom that results in a stable structure and any of the ring atoms can be optionally substituted. Examples of such saturated or partially unsaturated heterocyclic radicals include, without limitation, tetrahydrofuranyl, tetrahydrothiophenyl pyrrolidinyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, and quinuclidinyl. The terms “heterocycle,” “heterocyclyl,” “heterocyclyl ring,” “heterocyclic group,” “heterocyclic moiety,” and “heterocyclic radical,” are used interchangeably herein, and also include groups in which a heterocyclyl ring is fused to one or more aryl, heteroaryl, or cycloaliphatic rings, such as indolinyl, 3H–indolyl, chromanyl, phenanthridinyl, or tetrahydroquinolinyl. A heterocyclyl group may be mono– or bicyclic. The term “heterocyclylalkyl” refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted.

[0110] As used herein, the term “partially unsaturated” refers to a ring moiety that includes at least one double or triple bond. The term “partially unsaturated” is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties, as herein defined.

[0111] As described herein, compounds of the invention may contain “optionally substituted” moieties. In general, the term “substituted,” whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent. Unless otherwise indicated, an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group,WSGR Docket No.: 56017-735.601 the substituent may be either the same or different at every position. Combinations of substituents envisioned by this invention are preferably those that result in the formation of stable or chemically feasible compounds. The term “stable,” as used herein, refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein.

[0112] Suitable monovalent substituents on a substitutable carbon atom of an “optionally substituted” group are independently halogen; –(CH2)0–4R^; –(CH2)0–4OR^; -O(CH2)0-4Ro, –O– (CH2)0–4C(O)OR°; –(CH2)0–4CH(OR^)2; –(CH2)0–4SR^; –(CH2)0–4Ph, which may be substituted with R°; –(CH2)0–4O(CH2)0–1Ph which may be substituted with R°; –CH=CHPh, which may be substituted with R°; –(CH2)0–4O(CH2)0–1-pyridyl which may be substituted with R°; –NO2; –CN; –N3; -(CH2)0–4N(R^)2; –(CH2)0–4N(R^)C(O)R^; –N(R^)C(S)R^; –(CH2)0–4N(R^)C(O)NR^2; -N(R^)C(S)NR^2; –(CH2)0–4N(R^)C(O)OR^; – N(R^)N(R^)C(O)R^; -N(R^)N(R^)C(O)NR^2; -N(R^)N(R^)C(O)OR^; –(CH2)0–4C(O)R^; – C(S)R^; –(CH2)0–4C(O)OR^; –(CH2)0–4C(O)SR^; -(CH2)0–4C(O)OSiR^3; –(CH2)0–4OC(O)R^; – OC(O)(CH2)0–4SR–, SC(S)SR°; –(CH2)0–4SC(O)R^; –(CH2)0–4C(O)NR^2; –C(S)NR^2; –C(S)SR°; –SC(S)SR°, -(CH2)0–4OC(O)NR^2; -C(O)N(OR^)R^; –C(O)C(O)R^; –C(O)CH2C(O)R^; – C(NOR^)R^; -(CH2)0–4SSR^; –(CH2)0–4S(O)2R^; –(CH2)0–4S(O)2OR^; –(CH2)0–4OS(O)2R^; – S(O)2NR^2; -(CH2)0–4S(O)R^; -N(R^)S(O)2NR^2; –N(R^)S(O)2R^; –N(OR^)R^; –C(NH)NR^2; – P(O)2R^; -P(O)R^2; -OP(O)R^2; –OP(O)(OR^)2; SiR^3; –(C1–4 straight or branched alkylene)O– N(R^)2; or –(C1–4 straight or branched alkylene)C(O)O–N(R^)2, wherein each R^ may be substituted as defined below and is independently hydrogen, C1–6 aliphatic, –CH2Ph, –O(CH2)0–1Ph, -CH2-(5-6 membered heteroaryl ring), or a 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or, notwithstanding the definition above, two independent occurrences of R^, taken together with their intervening atom(s), form a 3–12–membered saturated, partially unsaturated, or aryl mono– or bicyclic ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, which may be substituted as defined below.

[0113] Suitable monovalent substituents on R^ (or the ring formed by taking two independent occurrences of R^ together with their intervening atoms), are independently halogen, –(CH2)0–2R^, –(haloR^), –(CH2)0–2OH, –(CH2)0–2OR^, –(CH2)0–2CH(OR^)2; -O(haloR^), –CN, –N3, – (CH2)0–2C(O)R^, –(CH2)0–2C(O)OH, –(CH2)0–2C(O)OR^, –(CH2)0–2SR^, –(CH2)0–2SH, –(CH2)0– NH , –(CH ) NHR^, –(CH ) NR^ , –NO , –SiR^ ^ ^ 2 2 2 0–2 2 0–2 2 2 3, –OSiR 3, -C(O)SR , –(C1–4 straight or branched alkylene)C(O)OR^, or –SSR^wherein each R^is unsubstituted or where preceded byWSGR Docket No.: 56017-735.601 “halo” is substituted only with one or more halogens, and is independently selected from C1–4 aliphatic, –CH2Ph, –O(CH2)0–1Ph, or a 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, or sulfur. Suitable divalent substituents on a saturated carbon atom of R^ include =O and =S.

[0114] Suitable divalent substituents on a saturated carbon atom of an “optionally substituted” group include the following: =O, =S, =NNR*2, =NNHC(O)R*, =NNHC(O)OR*, =NNHS(O)2R*, =NR*, =NOR*, –O(C(R*2))2–3O–, or –S(C(R*2))2–3S–, wherein each independent occurrence of R*is selected from hydrogen, C1–6aliphatic which may be substituted as defined below, or an unsubstituted 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, or sulfur. Suitable divalent substituents that are bound to vicinal substitutable carbons of an “optionally substituted” group include: –O(CR*2)2–3O–, wherein each independent occurrence of R*is selected from hydrogen, C1–6 aliphatic which may be substituted as defined below, or an unsubstituted 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.

[0115] Suitable substituents on the aliphatic group of R*include halogen, –R^, -(haloR^), -OH, –OR^, –O(haloR^), –CN, –C(O)OH, –C(O)OR^, –NH2, –NHR^, –NR^2, or –NO2, wherein each R^is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently C1–4 aliphatic, –CH2Ph, –O(CH2)0–1Ph, or a 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.

[0116] Suitable substituents on a substitutable nitrogen of an “optionally substituted” group include–C(O)R†, –C(O)OR†, –C(O)C(O)R†, – C(O)CH2C(O)R†, -S(O)2R†, -S(O)2NR†2, –C(S)NR†2, –C(NH)NR†2, or –N(R†)S(O)2R†; wherein each R†is independently hydrogen, C1–6 aliphatic which may be substituted as defined below, unsubstituted –OPh, or an unsubstituted 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or, notwithstanding the definition above, two independent occurrences of R†, taken together with their intervening atom(s) form an unsubstituted 3–12–membered saturated, partially unsaturated, or aryl mono– or bicyclic ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.

[0117] Suitable substituents on the aliphatic group of R†are independently halogen, – R^, -(haloR^), –OH, –OR^, –O(haloR^), –CN, –C(O)OH, –C(O)OR^, –NH2, –NHR^, –NR^2, or -NO2, wherein each R^is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently C1–4 aliphatic, –CH2Ph, –O(CH2)0–1Ph, or a 5–6–WSGR Docket No.: 56017-735.601 membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.

[0118] In another aspect, provided herein is a compound comprising the structure of Formula I: Formula I, wherein: (a) is an anion of a peptide comprising the sequence of: H-Aib- X1X2X3X4X5X6X7X8X9X10X11X12X13X14X15X16X17X18X19X20X21X22X23X24X25X26X27X28X29X30X31X32X33X34X35X36X37X38X39X40X41X42X43X44X45X46X47X48X49X50X51X52X53X 54X55X56X57X58X59X60X61X62X63X64X65X66X67X68X69X70X71-amide, wherein: X1is Glu, X71, X72, X73, X74, or X75; X2 is Gly, X71, X72, X73, X74, or X75; X3 is Thr, X71, X72, X73, X74, or X75; X4is Phe, X71, X72, X73, X74, or X75; X5 is Thr, X71, X72, X73, X74, or X75; X6 is Ser, X71, X72, X73, X74, or X75; X7is Asp, X71, X72, X73, X74, or X75; X8is Val, X71, X72, X73, X74, or X75; X9 is Ser, X71, X72, X73, X74, or X75; X10 is Ser, X71, X72, X73, X74, or X75; X11is Tyr, X71, X72, X73, X74, or X75; X12 is Leu, X71, X72, X73, X74, or X75; X13 is Glu, X71, X72, X73, X74, or X75; X14is Glu, X71, X72, X73, X74, or X75; X15 is Gln, X71, X72, X73, X74, or X75; X16 is Ala, X71, X72, X73, X74, or X75; X17is Ala, X71, X72, X73, X74, or X75; X18is Arg, X71, X72, X73, X74, or X75; X19 is Glu, X71, X72, X73, X74, or X75; X20is Phe, X71, X72, X73, X74, or X75; X21is Ile, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X22 is Ala, X71, X72, X73, X74, or X75; X23is Trp, X71, X72, X73, X74, or X75; X24is Leu, X71, X72, X73, X74, or X75; X25 is Val, X71, X72, X73, X74, or X75; X26 is Arg, X71, X72, X73, X74, or X75; X27is Gly, X71, X72, X73, X74, or X75; X28 is Arg, X71, X72, X73, X74, or X75; X29 is Gly, X71, X72, X73, X74, or X75; X30is Gly, X71, X72, X73, X74, X75, or absent; X31is Gly, X71, X72, X73, X74, X75, or absent; X32 is Gly, X71, X72, X73, X74, X75, or absent; X33is Gly, X71, X72, X73, X74, X75, or absent; X34is Gly, Ser, X71, X72, X73, X74, or X75; X35 is Gly, X71, X72, X73, X74, or X75; X36 is Gly, X71, X72, X73, X74, or X75; X37is Gly, X71, X72, X73, X74, or X75; X38 is Glu, X71, X72, X73, X74, or X75; X39 is Ala, X71, X72, X73, X74, or X75; X40is Ser, X71, X72, X73, X74, or X75; X41is Glu, X71, X72, X73, X74, or X75; X42 is Leu, X71, X72, X73, X74, or X75; X43is Ser, X71, X72, X73, X74, or X75; X44is Thr, X71, X72, X73, X74, or X75; X45 is Ala, X71, X72, X73, X74, or X75; X46 is Ala, X71, X72, X73, X74, or X75; X47is Leu, X71, X72, X73, X74, or X75; X48is Gly, X71, X72, X73, X74, or X75; X49 is Arg, X71, X72, X73, X74, or X75; X50is Leu, X71, X72, X73, X74, or X75; X51is Ser, X71, X72, X73, X74, or X75; X52 is Ala, X71, X72, X73, X74, or X75; X53 is Glu, X71, X72, X73, X74, or X75; X54is Leu, X71, X72, X73, X74, or X75; X55 is His, X71, X72, X73, X74, or X75; X56 is Glu, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X57 is Leu, X71, X72, X73, X74, or X75; X58is Ala, X71, X72, X73, X74, or X75; X59is Thr, X71, X72, X73, X74, or X75;X71 is Lys([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethox y]ethoxy]acetyl]); X72 is Lys([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]); X73 is Lys([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]); X74 is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl]); and X75is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]amino]hexanoyl]); wherein one or more carboxyl groups of the C18 diacid, C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues of the peptide are in the formand (b) is a cationic component.

[0119] In another aspect, provided herein is a compound comprising the structure of FormulaWSGR Docket No.: 56017-735.601 IIa, Formula IIb, Formula IIc, or any combination thereof: Formula IIa,Formula IIb,Formula IIc, wherein: (a) is a cation of a peptide comprising the sequence of: H-Aib- X1X2X3X4X5X6X7X8X9X10X11X12X13X14X15X16X17X18X19X20X21X22X23X24X25X26X27X28X29X30X31X32X33X34X35X36X37X38X39X40X41X42X43X44X45X46X47X48X49X50X51X52X53X 54X55X56X57X58X59X60X61X62X63X64X65X66X67X68X69X70X71-amide, wherein: X1 is Glu, X71, X72, X73, X74, or X75; X2 is Gly, X71, X72, X73, X74, or X75; X3is Thr, X71, X72, X73, X74, or X75; X4is Phe, X71, X72, X73, X74, or X75; X5 is Thr, X71, X72, X73, X74, or X75; X6 is Ser, X71, X72, X73, X74, or X75; X7is Asp, X71, X72, X73, X74, or X75; X8 is Val, X71, X72, X73, X74, or X75; X9 is Ser, X71, X72, X73, X74, or X75; X10is Ser, X71, X72, X73, X74, or X75; X11is Tyr, X71, X72, X73, X74, or X75; X12 is Leu, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X13 is Glu, X71, X72, X73, X74, or X75; X14is Glu, X71, X72, X73, X74, or X75; X15is Gln, X71, X72, X73, X74, or X75; X16 is Ala, X71, X72, X73, X74, or X75; X17 is Ala, X71, X72, X73, X74, or X75; X18is Arg, X71, X72, X73, X74, or X75; X19 is Glu, X71, X72, X73, X74, or X75; X20 is Phe, X71, X72, X73, X74, or X75; X21is Ile, X71, X72, X73, X74, or X75; X22is Ala, X71, X72, X73, X74, or X75; X23 is Trp, X71, X72, X73, X74, or X75; X24is Leu, X71, X72, X73, X74, or X75; X25is Val, X71, X72, X73, X74, or X75; X26 is Arg, X71, X72, X73, X74, or X75; X27 is Gly, X71, X72, X73, X74, or X75; X28is Arg, X71, X72, X73, X74, or X75; X29 is Gly, X71, X72, X73, X74, or X75; X30 is Gly, X71, X72, X73, X74, X75, or absent; X31is Gly, X71, X72, X73, X74, X75, or absent; X32is Gly, X71, X72, X73, X74, X75, or absent; X33 is Gly, X71, X72, X73, X74, X75, or absent; X34is Gly, Ser, X71, X72, X73, X74, or X75; X35is Gly, X71, X72, X73, X74, or X75; X36 is Gly, X71, X72, X73, X74, or X75; X37 is Gly, X71, X72, X73, X74, or X75; X38is Glu, X71, X72, X73, X74, or X75; X39is Ala, X71, X72, X73, X74, or X75; X40 is Ser, X71, X72, X73, X74, or X75; X41is Glu, X71, X72, X73, X74, or X75; X42is Leu, X71, X72, X73, X74, or X75; X43 is Ser, X71, X72, X73, X74, or X75; X44 is Thr, X71, X72, X73, X74, or X75; X45is Ala, X71, X72, X73, X74, or X75; X46 is Ala, X71, X72, X73, X74, or X75; X47 is Leu, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X48 is Gly, X71, X72, X73, X74, or X75;carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethox y]ethoxy]acetyl]); X72is Lys([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]); X73is Lys([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]); X74is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl]); andWSGR Docket No.: 56017-735.601 X75 is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]amino]hexanoyl]); wherein the N-terminal amino group of the peptide is in the form of ;is a cation of the peptide, wherein one or more Arg residues of the peptide are in the formcation of the peptide, wherein one or more His residues of the peptide are in the form.

[0120] In another aspect, provided herein is a compound comprising the structure of Formula III:Formula III or a pharmaceutically acceptable salt thereof, wherein:is a covalent derivative of one or more carboxyl groups of a peptide comprising the sequence of: H-Aib- X1X2X3X4X5X6X7X8X9X10X11X12X13X14X15X16X17X18X19X20X21X22X23X24X25X26X27X28X29X30X31X32X33X34X35X36X37X38X39X40X41X42X43X44X45X46X47X48X49X50X51X52X53X 54X55X56X57X58X59X60X61X62X63X64X65X66X67X68X69X70X71-amide,WSGR Docket No.: 56017-735.601 wherein: X1is Glu, X71, X72, X73, X74, or X75; X2is Gly, X71, X72, X73, X74, or X75; X3 is Thr, X71, X72, X73, X74, or X75; X4 is Phe, X71, X72, X73, X74, or X75; X5is Thr, X71, X72, X73, X74, or X75; X6 is Ser, X71, X72, X73, X74, or X75; X7 is Asp, X71, X72, X73, X74, or X75; X8is Val, X71, X72, X73, X74, or X75; X9is Ser, X71, X72, X73, X74, or X75; X10 is Ser, X71, X72, X73, X74, or X75; X11is Tyr, X71, X72, X73, X74, or X75; X12is Leu, X71, X72, X73, X74, or X75; X13 is Glu, X71, X72, X73, X74, or X75; X14 is Glu, X71, X72, X73, X74, or X75; X15is Gln, X71, X72, X73, X74, or X75; X16 is Ala, X71, X72, X73, X74, or X75; X17 is Ala, X71, X72, X73, X74, or X75; X18is Arg, X71, X72, X73, X74, or X75; X19is Glu, X71, X72, X73, X74, or X75; X20 is Phe, X71, X72, X73, X74, or X75; X21is Ile, X71, X72, X73, X74, or X75; X22is Ala, X71, X72, X73, X74, or X75; X23 is Trp, X71, X72, X73, X74, or X75; X24 is Leu, X71, X72, X73, X74, or X75; X25is Val, X71, X72, X73, X74, or X75; X26is Arg, X71, X72, X73, X74, or X75; X27 is Gly, X71, X72, X73, X74, or X75; X28is Arg, X71, X72, X73, X74, or X75; X29is Gly, X71, X72, X73, X74, or X75; X30 is Gly, X71, X72, X73, X74, X75, or absent; X31 is Gly, X71, X72, X73, X74, X75, or absent; X32is Gly, X71, X72, X73, X74, X75, or absent; X33 is Gly, X71, X72, X73, X74, X75, or absent; X34 is Gly, Ser, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X35 is Gly, X71, X72, X73, X74, or X75; X36is Gly, X71, X72, X73, X74, or X75; X37is Gly, X71, X72, X73, X74, or X75; X38 is Glu, X71, X72, X73, X74, or X75; X39 is Ala, X71, X72, X73, X74, or X75; X40is Ser, X71, X72, X73, X74, or X75; X41 is Glu, X71, X72, X73, X74, or X75; X42 is Leu, X71, X72, X73, X74, or X75; X43is Ser, X71, X72, X73, X74, or X75; X44is Thr, X71, X72, X73, X74, or X75; X45 is Ala, X71, X72, X73, X74, or X75; X46is Ala, X71, X72, X73, X74, or X75; X47is Leu, X71, X72, X73, X74, or X75; X48 is Gly, X71, X72, X73, X74, or X75; X49 is Arg, X71, X72, X73, X74, or X75; X50is Leu, X71, X72, X73, X74, or X75; X51 is Ser, X71, X72, X73, X74, or X75; X52 is Ala, X71, X72, X73, X74, or X75; X53is Glu, X71, X72, X73, X74, or X75; X54is Leu, X71, X72, X73, X74, or X75; X55 is His, X71, X72, X73, X74, or X75; X56is Glu, X71, X72, X73, X74, or X75; X57is Leu, X71, X72, X73, X74, or X75; X58 is Ala, X71, X72, X73, X74, or X75; X59 is Thr, X71, X72, X73, X74, or X75; X60is Leu, X71, X72, X73, X74, or X75; X61is Pro, X71, X72, X73, X74, or X75; X62 is Arg, X71, X72, X73, X74, or X75; X63is Thr, X71, X72, X73, X74, or X75; X64is Glu, X71, X72, X73, X74, or X75; X65 is Thr, X71, X72, X73, X74, or X75; X66 is Gly, X71, X72, X73, X74, or X75; X67is Ser, X71, X72, X73, X74, or X75; X68 is Gly, X71, X72, X73, X74, or X75; X69 is Ser, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X70 is Pro, X71, X72, X73, X74, or X75; X71is Lys([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethox y]ethoxy]acetyl]); X72 is Lys([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]); X73 is Lys([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]); X74 is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl]); and X75 is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]amino]hexanoyl]); or a pharmaceutically acceptable salt thereof; and each R100is as defined herein.

[0121] In another aspect, provided herein is a compound comprising the structure of Formula IV:Formula IV or a pharmaceutically acceptable salt thereof, wherein:is a covalent derivative of one or more hydroxyl groups of a peptide comprising the sequence of: H-Aib- X1X2X3X4X5X6X7X8X9X10X11X12X13X14X15X16X17X18X19X20X21X22X23X24X25X26X27X28X29X30X31X32X33X34X35X36X37X38X39X40X41X42X43X44X45X46X47X48X49X50X51X52X53X 54X55X56X57X58X59X60X61X62X63X64X65X66X67X68X69X70X71-amide, wherein: X1is Glu, X71, X72, X73, X74, or X75; X2 is Gly, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X3 is Thr, X71, X72, X73, X74, or X75; X4is Phe, X71, X72, X73, X74, or X75; X5is Thr, X71, X72, X73, X74, or X75; X6 is Ser, X71, X72, X73, X74, or X75; X7 is Asp, X71, X72, X73, X74, or X75; X8is Val, X71, X72, X73, X74, or X75; X9 is Ser, X71, X72, X73, X74, or X75; X10 is Ser, X71, X72, X73, X74, or X75; X11is Tyr, X71, X72, X73, X74, or X75; X12is Leu, X71, X72, X73, X74, or X75; X13 is Glu, X71, X72, X73, X74, or X75; X14is Glu, X71, X72, X73, X74, or X75; X15is Gln, X71, X72, X73, X74, or X75; X16 is Ala, X71, X72, X73, X74, or X75; X17 is Ala, X71, X72, X73, X74, or X75; X18is Arg, X71, X72, X73, X74, or X75; X19 is Glu, X71, X72, X73, X74, or X75; X20 is Phe, X71, X72, X73, X74, or X75; X21is Ile, X71, X72, X73, X74, or X75; X22is Ala, X71, X72, X73, X74, or X75; X23 is Trp, X71, X72, X73, X74, or X75; X24is Leu, X71, X72, X73, X74, or X75; X25is Val, X71, X72, X73, X74, or X75; X26 is Arg, X71, X72, X73, X74, or X75; X27 is Gly, X71, X72, X73, X74, or X75; X28is Arg, X71, X72, X73, X74, or X75; X29is Gly, X71, X72, X73, X74, or X75; X30 is Gly, X71, X72, X73, X74, X75, or absent; X31is Gly, X71, X72, X73, X74, X75, or absent; X32is Gly, X71, X72, X73, X74, X75, or absent; X33 is Gly, X71, X72, X73, X74, X75, or absent; X34 is Gly, Ser, X71, X72, X73, X74, or X75; X35is Gly, X71, X72, X73, X74, or X75; X36 is Gly, X71, X72, X73, X74, or X75; X37 is Gly, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X38 is Glu, X71, X72, X73, X74, or X75; X39is Ala, X71, X72, X73, X74, or X75; X40is Ser, X71, X72, X73, X74, or X75; X41 is Glu, X71, X72, X73, X74, or X75; X42 is Leu, X71, X72, X73, X74, or X75; X43is Ser, X71, X72, X73, X74, or X75; X44 is Thr, X71, X72, X73, X74, or X75; X45 is Ala, X71, X72, X73, X74, or X75; X46is Ala, X71, X72, X73, X74, or X75; X47is Leu, X71, X72, X73, X74, or X75; X48 is Gly, X71, X72, X73, X74, or X75; X49is Arg, X71, X72, X73, X74, or X75; X50is Leu, X71, X72, X73, X74, or X75; X51 is Ser, X71, X72, X73, X74, or X75; X52 is Ala, X71, X72, X73, X74, or X75; X53is Glu, X71, X72, X73, X74, or X75; X54 is Leu, X71, X72, X73, X74, or X75; X55 is His, X71, X72, X73, X74, or X75; X56is Glu, X71, X72, X73, X74, or X75; X57is Leu, X71, X72, X73, X74, or X75; X58 is Ala, X71, X72, X73, X74, or X75; X59is Thr, X71, X72, X73, X74, or X75; X60is Leu, X71, X72, X73, X74, or X75; X61 is Pro, X71, X72, X73, X74, or X75; X62 is Arg, X71, X72, X73, X74, or X75; X63is Thr, X71, X72, X73, X74, or X75; X64is Glu, X71, X72, X73, X74, or X75; X65 is Thr, X71, X72, X73, X74, or X75; X66is Gly, X71, X72, X73, X74, or X75; X67is Ser, X71, X72, X73, X74, or X75; X68 is Gly, X71, X72, X73, X74, or X75; X69 is Ser, X71, X72, X73, X74, or X75; X70is Pro, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X71 is Lys([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethox y]ethoxy]acetyl]); X72 is Lys([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]); X73 is Lys([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]); X74is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl]); and X75is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]amino]hexanoyl]); or a pharmaceutically acceptable salt thereof; and each R101is as defined herein.

[0122] In another aspect, provided herein is a compound comprising the structure of Formula V or Formula VI: Formula VFormula VI or a pharmaceutically acceptable salt of each thereof; wherein:WSGR Docket No.: 56017-735.601each a covalent derivative of one or more amino or imidazole groups of a peptide comprising the sequence of: H-Aib- X1X2X3X4X5X6X7X8X9X10X11X12X13X14X15X16X17X18X19X20X21X22X23X24X25X26X27X2 8X29X30X31X32X33X34X35X36X37X38X39X40X41X42X43X44X45X46X47X48X49X50X51X52X53X 54X55X56X57X58X59X60X61X62X63X64X65X66X67X68X69X70X71-amide, wherein: X1is Glu, X71, X72, X73, X74, or X75; X2is Gly, X71, X72, X73, X74, or X75; X3 is Thr, X71, X72, X73, X74, or X75; X4 is Phe, X71, X72, X73, X74, or X75; X5is Thr, X71, X72, X73, X74, or X75; X6 is Ser, X71, X72, X73, X74, or X75; X7 is Asp, X71, X72, X73, X74, or X75; X8is Val, X71, X72, X73, X74, or X75; X9is Ser, X71, X72, X73, X74, or X75; X10 is Ser, X71, X72, X73, X74, or X75; X11 is Tyr, X71, X72, X73, X74, or X75; X12is Leu, X71, X72, X73, X74, or X75; X13 is Glu, X71, X72, X73, X74, or X75; X14 is Glu, X71, X72, X73, X74, or X75; X15is Gln, X71, X72, X73, X74, or X75; X16 is Ala, X71, X72, X73, X74, or X75; X17 is Ala, X71, X72, X73, X74, or X75; X18is Arg, X71, X72, X73, X74, or X75; X19is Glu, X71, X72, X73, X74, or X75; X20 is Phe, X71, X72, X73, X74, or X75; X21 is Ile, X71, X72, X73, X74, or X75; X22is Ala, X71, X72, X73, X74, or X75; X23 is Trp, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X24 is Leu, X71, X72, X73, X74, or X75; X25is Val, X71, X72, X73, X74, or X75; X26is Arg, X71, X72, X73, X74, or X75; X27 is Gly, X71, X72, X73, X74, or X75; X28 is Arg, X71, X72, X73, X74, or X75; X29is Gly, X71, X72, X73, X74, or X75; X30 is Gly, X71, X72, X73, X74, X75, or absent; X31 is Gly, X71, X72, X73, X74, X75, or absent; X32is Gly, X71, X72, X73, X74, X75, or absent; X33is Gly, X71, X72, X73, X74, X75, or absent; X34 is Gly, Ser, X71, X72, X73, X74, or X75; X35is Gly, X71, X72, X73, X74, or X75; X36is Gly, X71, X72, X73, X74, or X75; X37 is Gly, X71, X72, X73, X74, or X75; X38 is Glu, X71, X72, X73, X74, or X75; X39is Ala, X71, X72, X73, X74, or X75; X40 is Ser, X71, X72, X73, X74, or X75; X41 is Glu, X71, X72, X73, X74, or X75; X42is Leu, X71, X72, X73, X74, or X75; X43is Ser, X71, X72, X73, X74, or X75; X44 is Thr, X71, X72, X73, X74, or X75; X45is Ala, X71, X72, X73, X74, or X75; X46is Ala, X71, X72, X73, X74, or X75; X47 is Leu, X71, X72, X73, X74, or X75; X48 is Gly, X71, X72, X73, X74, or X75; X49is Arg, X71, X72, X73, X74, or X75; X50is Leu, X71, X72, X73, X74, or X75; X51 is Ser, X71, X72, X73, X74, or X75; X52is Ala, X71, X72, X73, X74, or X75; X53is Glu, X71, X72, X73, X74, or X75; X54 is Leu, X71, X72, X73, X74, or X75; X55 is His, X71, X72, X73, X74, or X75; X56is Glu, X71, X72, X73, X74, or X75; X57 is Leu, X71, X72, X73, X74, or X75; X58 is Ala, X71, X72, X73, X74, or X75;WSGR Docket No.: 56017-735.601 X59 is Thr, X71, X72, X73, X74, or X75; X60is Leu, X71, X72, X73, X74, or X75; X61is Pro, X71, X72, X73, X74, or X75; X62 is Arg, X71, X72, X73, X74, or X75; X63 is Thr, X71, X72, X73, X74, or X75; X64is Glu, X71, X72, X73, X74, or X75; X65 is Thr, X71, X72, X73, X74, or X75; X66 is Gly, X71, X72, X73, X74, or X75; X67is Ser, X71, X72, X73, X74, or X75; X68is Gly, X71, X72, X73, X74, or X75; X69 is Ser, X71, X72, X73, X74, or X75; X70is Pro, X71, X72, X73, X74, or X75; X71is Lys([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethox y]ethoxy]acetyl]); X72is Lys([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]); X73is Lys([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]); X74is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino ]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl]); and X75 is Lys([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy ]ethoxy]acetyl]amino]hexanoyl]); or a pharmaceutically acceptable salt thereof; and each of R102and R103is as defined herein. Compound Derivatives From any one of Peptides (i), (ii), (iii), (iv), (v), (vi) or (vii)

[0123] Disclosed herein, in some embodiments, are compounds comprising certain ionic salt forms (i.e., pharmaceutically acceptable salts), esters and prodrugs of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), having improved qualities, including enhanced stability and improved solubility in an aqueous environment, relative to the free acid form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). Also disclosed are other derivatives of any one of theWSGR Docket No.: 56017-735.601 peptides (i), (ii), (iii), (iv), (v), (vi) or (vii).

[0124] As used herein, the terms “salt,” “salt form,” “ionic salt form” and “pharmaceutically acceptable salt,” as used herein, refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response, and the like, and are commensurate with a reasonable benefit / risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge et al., describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1–19, incorporated herein by reference. Pharmaceutically acceptable salts of the compounds as provided herein include those derived from suitable inorganic and organic acids and bases. Further pharmaceutically acceptable salts are discussed, for example, by P. Stahl et al., Camille G. (eds.) Handbook of Pharmaceutical Salts. Properties, Selection and Use. (2002) Zurich: Wiley-VCH; S. Berge et al., Journal of Pharmaceutical Sciences (1977) 66(1) 1-19; P. Gould, International J. of Pharmaceutics (1986) 33201-217; Anderson et al., The Practice of Medicinal Chemistry (1996), Academic Press, New York; and in The Orange Book (Food & Drug Administration, Washington, D.C. on their website). These disclosures are incorporated herein by reference.

[0125] In certain embodiments, the compound, or pharmaceutically acceptable salt thereof, is a prodrug. As used herein, the term "prodrug" refers to compounds that are transformed in vivo to yield a disclosed compound or a pharmaceutically acceptable form of the compound. A prodrug is converted in vivo to an active compound, for example, by hydrolysis (e.g., hydrolysis in blood). In certain cases, a prodrug has improved physical and / or delivery properties over the parent compound. Prodrugs are typically designed to enhance pharmaceutically and / or pharmacokinetically based properties associated with the parent compound. The prodrug compound often offers advantages of solubility, tissue compatibility or delayed release in a mammalian organism (see, e.g., Bundgard, H., Design of Prodrugs (1985), pp. 7-9, 21-24 (Elsevier, Amsterdam). A discussion of prodrugs is provided in Higuchi, T., et al., "Pro-drugs as Novel Delivery Systems," A.C.S. Symposium Series, Vol. 14, and in Bioreversible Carriers in Drug Design, ed. Edward B. Roche, American Pharmaceutical Association and Pergamon Press, 1987. Exemplary advantages of a prodrug can include, but are not limited to, its physical properties, such as enhanced water solubility for parenteral administration at physiological pH compared to the parent compound, or it enhances absorption from the digestive tract, or it can enhance drug stability for long-term storage.

[0126] The term "prodrug" is also meant to include any covalently bonded carriers, which release the active compound in vivo when such prodrug is administered to a subject. Prodrugs of an active compound, as described herein, can be prepared by modifying functional groups presentWSGR Docket No.: 56017-735.601 in the active compound in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent active compound. Prodrugs include compounds wherein a hydroxy, amino or mercapto group is bonded to any group that, when the prodrug of the active compound is administered to a subject, cleaves to form a free hydroxy, free amino or free mercapto group, respectively. Examples of prodrugs include, but are not limited to, acetate, trifluoroacetate, formate and benzoate derivatives of an alcohol or acetamide, formamide and benzamide derivatives of an amine functional group in the active compound and the like.

[0127] In an aspect, provided herein is, inter alia, a compound comprising the structure of Formula I:Formula I, wherein: (a) is an anion of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-WSGR Docket No.: 56017-735.601 [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein one or more carboxyl groups of the C18 diacid, C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) are in the form of ; and (b) is a cationic component.

[0128] In some embodiments, provided herein is a compound consisting, or consisting essentially, of the structure of Formula I.

[0129] In another aspect, provided herein is, inter alia, a compound comprising an ionic salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) having the structure of Formula I: wherein:an anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii); and wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are in the form of ; andWSGR Docket No.: 56017-735.601 is a cationic component.

[0130] As used herein, the term “C18 diacid” refers to fatty acid side chain of any one of the peptides (i) or (ii) having the structure –CO(CH2)16CO2.

[0131] As used herein, the term “C20 diacid” refers to fatty acid side chain of any one of the peptides (iii), (iv), (v), (vi) or (vii) having the structure –CO(CH2)18CO2.

[0132] As used herein, the term “^-Glu linker” refers to the bivalent linker moiety of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) having the structure –CO(CH2)2CH(CO2)NH-.

[0133] In some embodiments, provided herein is a compound having the structure of Formula I, whereinis an anion of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2- [[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein one or more carboxyl groups of the C18 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

[0134] In some embodiments, provided herein is a compound having the structure of FormulaI, wherein is an anion of H-Aib-EGTFTSDVS-K([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide, and H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17-WSGR Docket No.: 56017-735.601 carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide has the structure of:, wherein one or more carboxyl groups of the C18 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form

[0135] In some embodiments, provided herein is a compound having the structure of Formula I, whereinis an anion of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2- [[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the formWSGR Docket No.: 56017-735.601

[0136] In some embodiments, provided herein is a compound having the structure of Formula I, whereinis an anion of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2- [[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

[0137] In some embodiments, provided herein is a compound having the structure of Formula I, whereinis an anion of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2- amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4- carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])-WSGR Docket No.: 56017-735.601 GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

[0138] In some embodiments, provided herein is a compound having the structure of Formula I, whereinis an anion of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2- amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H- Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)- 4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure ofWSGR Docket No.: 56017-735.601, wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form

[0139] In some embodiments, provided herein is a compound having the structure of Formula I, whereinis an anion of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2- [[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of, wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

[0140] In some embodiments, provided herein is a compound having the structure of FormulaWSGR Docket No.: 56017-735.601 I, wherein the compound has a ratio of to of from about 1:1 to about 1:12. In some embodiments, the compound has a ratio of to selected from the group consisting of about 1:1, about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, about 1:10, about 1:11 and about 1:12. In some embodiments, the compound has a ratio of to selected from between any two of the group consisting of about 1:1, about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, about 1:10, about 1:11 and about 1:12. In some embodiments, the compound has a ratioto selected from the group consisting of from about 1:1 to about 1:2, from about 1:2 to about 1:3, about 1:3 to about 1:4, about 1:4 to about 1:5, about 1:5 to about 1:6, about 1:6 to about 1:7, about 1:7 to about 1:8, about 1:8 to about 1:9, about 1:9 to about 1:10, about 1:10 to about 1:11, about 1:11 to about 1:12. In some embodiments, the compound has a ratio of to selected from the group consisting of about 1:0.1 to about 1:1.

[0141] In some embodiments, R2does not have the structure of , wherein R8, R9, and R10are independently C1-C5alkyl, and R11is C2-C5alkyl that is unsubstituted or substituted with one or more hydroxyl. In some embodiments, R2is choline. In some embodiments, R2is not choline.

[0142] In some embodiments, provided herein is a compound consisting, or consisting essentially, of the structure of Formula I.

[0143] As used herein, “an anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii),”having the structure , is meant to encompass from one (1) to twelve (12) carboxylate anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) corresponding to at least one carboxylate anion and up to twelve carboxylate anions, the total number of carboxylic acid moieties on each of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), , has from one (1) to twelve (12) anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented byWSGR Docket No.: 56017-735.601 Formula Ib:Formula Ib.

[0144] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii),is one anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented by Formula Ib-1:Formula Ib-1.

[0145] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii),is two anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) , as represented by Formula Ib-2:Formula Ib-2.

[0146] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii),is three anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) , as represented by Formula Ib-3:Formula Ib-3.

[0147] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii),is four anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) , as represented by Formula Ib-4:WSGR Docket No.: 56017-735.601 Formula Ib-4.

[0148] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), is five anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented by Formula Ib-5:Formula Ib-5.

[0149] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), is six anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented by Formula Ib-6:Formula Ib-6.

[0150] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), is seven anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented by Formula Ib-7:Formula Ib-7.

[0151] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), is eight anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented by Formula Ib-8:Formula Ib-8.

[0152] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) orWSGR Docket No.: 56017-735.601 (vii), is nine anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented by Formula Ib-9:Formula Ib-9.

[0153] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), is ten anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented by Formula Ib-10: Formula Ib-10.

[0154] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), is eleven anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented by Formula Ib-11:Formula Ib-11.

[0155] In some embodiments, the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), is twelve anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), as represented by Formula Ib-12:Formula Ib-12.

[0156] Accordingly, a “cationic component,” having the structure is meant to encompass from one (1) to twelve (12) cations corresponding to at least one cation and up to twelve cations, provided as counterion(s) to the total potential number of carboxylate moieties on the any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). In some embodiments, the cationic component isWSGR Docket No.: 56017-735.601 one cation, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:1 to 1:12. In some embodiments, the cationic component is one cation, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of between any two of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is one cation, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:1. In some embodiments, the cationic component is two cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:2. In some embodiments, the cationic component is three cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:3. In some embodiments, the cationic component is four cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:4. In some embodiments, the cationic component is five cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:5. In some embodiments, the cationic component is six cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:6. In some embodiments, the cationic component is seven cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:7. In some embodiments, the cationic component is eight cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:8. In some embodiments, the cationic component is nine cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:9. In some embodiments, the cationic component is ten cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:10. In some embodiments, the cationic component is eleven cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:11. In some embodiments, the cationic component is twelve cations, corresponding to a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of 1:12. In some embodiments, the compound has a molar ratio of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) anion to cationic component of from 1:01 to 1:1, from 1:0.1 to 1:1, from 1:0.5 to 1:1, from 1:1 to 1:2, from 1:2 to 1:3, from 1:3 to 1:4, from 1:4 to 1:5, from 1:5 to 1:6, from 1:6 to 1:7, from 1:7 to 1:8, from 1:8 to 1:9, from 1:9 to 1:10, from 1:10 to 1:11, from 1:11 to 1:12.

[0157] In an aspect, provided herein is a compound comprising the structure of Formula Ia:WSGR Docket No.: 56017-735.601Formula Ia, wherein:is from one to twelve anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii); and( )1-12 is a cationic component of from one to twelve cations.

[0158] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-1:Formula Ia-1.

[0159] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-2:Formula Ia-2.

[0160] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-3:Formula Ia-3.

[0161] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-4:Formula Ia-4.

[0162] In some embodiments, the compound of Formula 1A is a compound having the structureWSGR Docket No.: 56017-735.601 of Formula Ia-5:Formula Ia-5.

[0163] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-6:Formula Ia-6.

[0164] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-7:Formula Ia-7.

[0165] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-8:Formula Ia-8.

[0166] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-9:Formula Ia-9.

[0167] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-10:Formula Ia-10.

[0168] In some embodiments, the compound of Formula 1A is a compound having the structureWSGR Docket No.: 56017-735.601 of Formula Ia-11:Formula Ia-11.

[0169] In some embodiments, the compound of Formula 1A is a compound having the structure of Formula Ia-12:Formula Ia-12.

[0170] In some embodiments, the cationic component of R2derives from appropriate bases and is selected from the group consisting of alkali metal, alkaline earth metal, a metal ion such as aluminum, sodium, lithium, potassium, magnesium, calcium, and zinc, ammonium (NH4+), a protonated or positively (+) charged ion from an aliphatic primary amine, secondary amine or tertiary amine such as 2-aminoethanol, tromethamine, dimethylamine, diethylamine, N-ethyl- glucamine, hydrabamine, trimethylamine, triethylamine, dicyclohexylamine, ethanolamine, diethanolamine, triethanolamine, dimethylethanolamine, (2,2′,2″-nitrilotris(ethanol)), 2- diethylaminoethanol, procaine or substituted procaine (e.g., chloroprocaine), meglumine, carnitine, ethylenediamine, choline, acetylcholine, aralkyl amine such as Ν,Ν- dibenzylethylenediamine, benzathine, benethamine; heterocyclic aromatic amine such as pyridine, pyrimidine, picoline, quinoline or isoquinoline, quaternary ammonium (e.g., NH4+) such as betaine, nontoxic quaternary ammonium (e.g., NMe4+, N+(C1–4alkyl)4,), tetramethylammonium, tetraethylammonium, benzyltrimethylammonium, benzyltriethylammonium, benzyltributylammonium, methyltrioctylammonium or tetrabutylammonium; 1H-imidazole, substituted-imidazole (e.g., N-alkyl imidazole, N-methyl imidazole), pyrrolidine, substituted pyrrolidine (e.g., 1-alkyl pyrrolidine, 1-methyl pyrrolidine, 1- (2-hydroxy-ethyl)-pyrrolidine), piperidine or substituted piperidine (e.g., 1-alkyl piperidine, 1- methyl piperidine), piperazine or substituted piperazine (e.g., 1-alkyl piperazine, 1-methyl piperazine, 1,4-dialkyl piperazine, 1,4-dimethyl piperazine), morpholine, substituted morpholine (e.g., N-substituted morpholine, N-methyl morpholine or 4-(2-hydroxyethyl)-morpholine), basic amino acid such as arginine, lysine, or histidine. aminoguanidine, guanidine derivatives and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate. In some embodiments, the cationic component of R2is choline.WSGR Docket No.: 56017-735.601

[0171] In some embodiments, the cationic component and anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is selected from the group of cationic components described herein or listed in the preceding paragraph, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is selected from the group of cationic components listed in Tables 1A-1G. In some embodiments, the cationic component is selected from the group of cationic components listed in Tables 1A-1G, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is selected from the group of cationic components listed in Tables 1A-1G, further provided in a weight % (wt. %) ratio relative to the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) as listed in Tables 1A-1G.

[0172] In some embodiments, representative alkali or alkaline earth metal salts include, but are not limited to, aluminum, sodium, lithium, potassium, calcium, magnesium, zinc and the like.

[0173] In some embodiments, N(C1–4alkyl)4+), includes tetramethyl ammonium, tetraethyl ammonium, acetylcholine, tetrapropyl ammonium and tetrabutyl ammonium.

[0174] In some embodiments, the quaternary ammonium has the structure ofwherein: R8, R9, R10, and R11are each independently a substituted or unsubstituted group selected from C1-6aliphatic, phenyl, cycloalkyl, 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0175] In some embodiments, the quaternary ammonium has the structure of wherein: three of R8, R9, R10, and R11are each independently a substituted or unsubstituted C1-6 aliphatic, and one of R8, R9, R10, and R11is substituted or unsubstituted phenyl, cycloalkyl, 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatomsWSGR Docket No.: 56017-735.601 independently selected from nitrogen, oxygen, and sulfur, or 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0176] In some embodiments, the quaternary ammonium has the structure of wherein: two of R8, R9, R10, and R11are each independently a substituted or unsubstituted C1-6 aliphatic, and two of R8, R9, R10, and R11is each independently substituted or unsubstituted phenyl, cycloalkyl, 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0177] In some embodiments, the quaternary ammonium has the structure of wherein: one of R8, R9, R10, and R11is a substituted or unsubstituted C1-6 aliphatic, and three of R8, R9, R10, and R11is each independently substituted or unsubstituted phenyl, cycloalkyl, 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0178] In some embodiments, the quaternary ammonium has the structure ofwherein: R8, R9, R10, and R11are each independently a substituted or unsubstituted C1-6aliphatic.

[0179] In some embodiments, the quaternary ammonium has the structure of wherein: (i) R8, R9, R10, and R1are independently substituted or unsubstituted C1-C6alkyl; (ii) R8, R9, R10, and R11are independently C1-C4alkyl; (iii) R8, R9, and R10are C2 and R11is C1 alkyl; (iv) R8, R9, and R10are C4 and R11is C1 alkyl; (v) all of R8, R9, R10, and R11are C1alkyl; (vi) all of R8, R9, R10, and R11are C2 alkyl;WSGR Docket No.: 56017-735.601 (vii) all of R8, R9, R10, and R11are C3 alkyl; or (viii) all of R8, R9, R10, and R11are C4alkyl.

[0180] In some embodiments, the quaternary ammonium has the structure of , wherein R8, R9, R10, and R11are each independently substituted or unsubstituted C1-C20alkyl or an aryl.

[0181] In some embodiments, the cationic component is a quaternary ammonium, with the proviso that the cationic component does not have the structure, wherein R8, R9, and R10are independently C1-C5alkyl, and R11is C2-C5alkyl that is unsubstituted or substituted with 1 or more hydroxyl. In some embodiments, the cationic component is a quaternary ammonium comprising substituted or unsubstituted C6-C20 alkyl or an aryl.

[0182] In some embodiments, the cationic component is a quaternary ammonium, wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium, further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is from about 1:1 to about 1:12.

[0183] In some embodiments, the cationic component is a quaternary ammonium having the structure of , wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of , further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic componentWSGR Docket No.: 56017-735.601 that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of , further provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to cationic component that is from about 1:1 to about 1:12.

[0184] In some embodiments, the quaternary ammonium has the structure of, wherein: R15, R16, R17are each independently a substituted or unsubstituted group selected from C1-6aliphatic, phenyl, cycloalkyl, 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur; R18, R19, R20, and R21are each independently hydrogen, halogen, substituted or unsubstituted C1- 6 aliphatic; and R22is hydrogen, or substituted or unsubstituted group selected from -C(O)-C1-6aliphatic, C1-6aliphatic, phenyl, cycloalkyl, 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0185] In some embodiments, R22is selected from the group consisting of -C(O)CH3, -C(O)CF3, -C(O)CH2F, -C(O)CHF2, -CH3, -CF3, -CH2F, -CHF2, -CH2CH3, and -CH2CH2CH3, and CH(CH3)2

[0186] In some embodiments, the quaternary ammonium has the structure of, wherein R15, R16, R17are each independently a substituted or unsubstituted group selected from C1-6 aliphatic, phenyl, cycloalkyl, 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independentlyWSGR Docket No.: 56017-735.601 selected from nitrogen, oxygen, and sulfur; R18, R19, R20, and R21are each independently hydrogen, halogen, substituted or unsubstituted C1-6aliphatic; and R23is hydrogen, or substituted or unsubstituted group selected from C1-6 aliphatic, phenyl, cycloalkyl, 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0187] In some embodiments, R23is selected from the group consisting of -CH3, -CF3, -CH2F, and -CHF2.

[0188] In some embodiments, the cationic component is a quaternary ammonium having the structurewherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of or , wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structurewherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is between 1:1 and 1:12.

[0189] In some embodiments, the cationic component is a quaternary ammonium having the structure of.WSGR Docket No.: 56017-735.601

[0190] In some embodiments, the cationic component is a quaternary ammonium having the structure of, wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is from about 1:1 to about 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of, wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is selected from the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of, wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium havingthe structure of the anion is of peptide (i), wherein the anion of peptide (i) and quaternary ammonium are provided in a ratio of peptide (i) to quaternary ammonium that is from about 1:1 to about 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (i), wherein the anion of peptide (i) and quaternary ammonium are provided in a ratio of peptide (i) to quaternary ammonium that is selected from or between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (ii), wherein the anion of peptide (ii) and quaternary ammonium are provided in a ratio of peptide (ii) to quaternary ammonium that is from about 1:1 to about 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (ii), whereinWSGR Docket No.: 56017-735.601 the anion of peptide (ii) and quaternary ammonium are provided in a ratio of peptide (ii) to quaternary ammonium that is selected from or between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (iii), wherein the anion of peptide (iii) and quaternary ammonium are provided in a ratio of peptide (iii) to quaternary ammonium that is from about 1:1 to about 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (iii), wherein the anion of peptide (iii) and quaternary ammonium are provided in a ratio of peptide (iii) to quaternary ammonium that is selected from or between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (iv), wherein the anion of peptide (iv) and quaternary ammonium are provided in a ratio of peptide (iv) to quaternary ammonium that is from about 1:1 to about 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (iv), wherein the anion of peptide (iv) and quaternary ammonium are provided in a ratio of peptide (iv) to quaternary ammonium that is selected from or between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (v), wherein the anion of peptide (v) and quaternary ammonium are provided in a ratio of peptide (v) to quaternary ammonium that is from about 1:1 to about 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (v), wherein the anion of peptide (v) and quaternary ammonium are provided in a ratio of peptide (v) to quaternary ammonium that is selected from or between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationicWSGR Docket No.: 56017-735.601 component is a quaternary ammonium having the structure ofthe anion is of peptide (vi), wherein the anion of peptide (vi) and quaternary ammonium are provided in a ratio of peptide (vi) to quaternary ammonium that is from about 1:1 to about 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (vi), wherein the anion of peptide (vi) and quaternary ammonium are provided in a ratio of peptide (vi) to quaternary ammonium that is selected from or between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (vii), wherein the anion of peptide (vii) and quaternary ammonium are provided in a ratio of peptide (vii) to quaternary ammonium that is from about 1:1 to about 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure ofthe anion is of peptide (vii), wherein the anion of peptide (vii) and quaternary ammonium are provided in a ratio of peptide (vii) to quaternary ammonium that is selected from or between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12.

[0191] In some embodiments, the quaternary ammonium has the structure selected from the ,

[0192] In some embodiments, the quaternary ammonium has the structure of.

[0193] In some embodiments, the cationic component is a quaternary ammonium having the structure ofWSGR Docket No.: 56017-735.601anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and quaternary ammonium are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is selected from the group consisting of, or that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is a quaternary ammonium having the structure of, provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to quaternary ammonium that is from about 1:1 to about 1:12.

[0194] In some embodiments, the cationic component is choline. In some embodiments, the cationic component is acetylcholine. In some embodiments, the cationic component is choline wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and choline are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to choline that is selected from the group consisting of, or that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12. In some embodiments, the cationic component is acetylcholine wherein the anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and acetylcholine are provided in a ratio of anion of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to acetylcholine that is selected from the group consisting of, or that is selected from between any two of the group consisting of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11 and 1:12.

[0195] In some embodiments, provided is a hydrate of the compound of Formula I. The term “hydrate”, as used herein, means a solid or a semi-solid form of a chemical compound containing water in a molecular complex. The water is generally in a stoichiometric amount with respect to the chemical compound. Exemplary hydrates include (compound of Formula I • ZH2O), wherein Z is from 1 to 50 equivalents of H2O. In some embodiments, Z is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50. In some embodiments, Z is between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 and 50. In some embodiments, provided is a hydrate of the compound of Formula Ia, Ia-1, Ia-2, Ia-3, Ia-4, Ia-5, Ia-WSGR Docket No.: 56017-735.601 6, Ia-7, Ia-8, Ia-9, Ia-10, Ia-11, or Ia-12. Exemplary hydrates include (compound of Formula Ia, Ia-1, Ia-2, Ia-3, Ia-4, Ia-5, Ia-6, Ia-7, Ia-8, Ia-9, Ia-10, Ia-11, or Ia-12 • ZH2O), wherein Z is from 1 to 50 equivalents of H2O. In some embodiments, Z is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50. In some embodiments, Z is between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 and 50.

[0196] In some embodiments, the cationic component is a quaternary ammonium having the structure of , wherein R8, R9, and R10are independently C1-C5alkyl, and R11is C2- C5 alkyl that is unsubstituted or substituted with 1 or more hydroxyl.

[0197] In some embodiments, the quaternary ammonium has the structure of.

[0198] In another aspect, provided herein is a compound comprising an ionic salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) having the structure of Formula IIa, Formula IIb, Formula IIc, or any combination thereof: Formula IIa,Formula IIb,Formula IIc, wherein, , , or any combination thereof is one or more cations ofWSGR Docket No.: 56017-735.601 any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii); and R7is an anionic component.

[0199] In another aspect, provided herein is a compound comprising the structure of Formula IIa, Formula IIb, Formula IIc, or any combination thereof: Formula IIa,Formula IIb,Formula IIc, wherein: (a) is a cation of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide,WSGR Docket No.: 56017-735.601 (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein the N-terminal amino group of any one of (i), (ii), (iii), (iv), (v), (vi) or (vii) is in the form(b)is a cation of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide;WSGR Docket No.: 56017-735.601 (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein one or more Arg residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) are in the form ofWSGR Docket No.: 56017-735.601cation of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19-WSGR Docket No.: 56017-735.601 carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein one or more His residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) are in the form of.

[0200] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, wherein, , , or any combination thereof is a cation of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the formWSGR Docket No.: 56017-735.601 (3) one or more His residues are in the form of; or (4) any combination thereof.

[0201] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, wherein, , , or any combination thereof is a cation of H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide, and H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; orWSGR Docket No.: 56017-735.601 (4) any combination thereof.

[0202] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, wherein, , , or any combination thereof is a cation of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

[0203] In some embodiments, provided is a compound of Formula IIa, Formula IIb, FormulaWSGR Docket No.: 56017-735.601 IIc, or any combination thereof, wherein, , , or any combination thereof is a cation of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

[0204] In some embodiments, provided is a compound of Formula IIa, Formula IIb, FormulaWSGR Docket No.: 56017-735.601 IIc, or any combination thereof, whereinany combination thereof is a cation of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2- [2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4- carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.WSGR Docket No.: 56017-735.601

[0205] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, wherein, , , or any combination thereof is a cation of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2- [2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H- Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)- 4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of ,(1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; orWSGR Docket No.: 56017-735.601 (4) any combination thereof.

[0206] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, whereinany combination thereof is a cation of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

[0207] In some embodiments, provided is a compound of Formula IIa, Formula IIb, FormulaWSGR Docket No.: 56017-735.601 IIc, or any combination thereof, wherein the compound has a ratio of, ,any combination thereof to of from about 1:1 to about 1:8.

[0208] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, wherein the compound has a ratio of, ,, or any combination thereof, to selected from the group consisting of about 1:1, about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, and about 1:8.

[0209] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, wherein the compound has a ratio of, ,, or any combination thereof, to selected from the group consisting of from about 1:1 to about 1:2, from about 1:2 to about 1:3, about 1:3 to about 1:4, about 1:4 to about 1:5, about 1:5 to about 1:6, about 1:6 to about 1:7, about 1:7 to about 1:8.

[0210] In some embodiments, provided is a compound of Formula IIa, Formula IIb, FormulaWSGR Docket No.: 56017-735.601 IIc, or any combination thereof, wherein the compound has a ratio of ,,any combination thereof, to selected from the group consisting of about 1:0.1 to about 1:1.

[0211] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, wherein the compound comprises one or more of:(a) a molar ratio of : of about 1:1;(b) a molar ratiofrom about 1:1 to about 1:5;(c) a molar ratiofrom about 1:1 to about 1:2; or(d) any combination thereof.

[0212] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, wherein the compound comprises one or more of:(a) a molar ratio of : of about 1:1;(b) a molar ratioabout 1:5;(c) a molar ratioabout 1:2; orWSGR Docket No.: 56017-735.601 (d) any combination thereof.

[0213] In some embodiments, provided is a compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof, wherein the compound comprises one or more of:(a) a molar ratio of : of about 1:1;(b) a molar ratioabout 1:1;(c) a molar ratioabout 1:1; or(d) any combination thereof.

[0214] In some embodiments, provided herein is a compound consisting, or consisting essentially, of the structure of Formula IIa, Formula IIb, Formula IIc, or any combination thereof.

[0215] As used herein, “one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v),(vi) or (vii),” having the structureany combination thereof,is meant to encompass from one (1) to eight (8) cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) corresponding to at least one protonated amino moiety and up to eight protonated amino moieties of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), the total number of basic amino moieties on the any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v),(vi) or (vii), having the structureany combination thereof,has from one (1) to eight (8) cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), for example, as represented by:WSGR Docket No.: 56017-735.601Formula IId.

[0216] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is one cation of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), for example, as represented by:Formula IId-1.

[0217] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is two cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), for example, as represented by:.Formula IId-2

[0218] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is three cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), for example, as represented by:Formula IId-3.

[0219] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is four cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), for example, as represented by:WSGR Docket No.: 56017-735.601Formula IId-4.

[0220] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is five cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), for example, as represented by:Formula IId-5.

[0221] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is six cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), for example, as represented by:Formula IId-6.

[0222] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is seven cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), for example, as represented by:Formula IId-7.

[0223] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) is eight cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), for example, as represented by:WSGR Docket No.: 56017-735.601Formula IId-8.

[0224] Accordingly, the “anionic component,” having the structure , is meant to encompass from one (1) to eight (8) anions corresponding to at least one anion and up to eight anions, provided as counterion(s) to the total potential number of protonated basic amino moieties on the any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). In some embodiments, the anionic component of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) has from one (1) to eight (8) anions of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). In some embodiments, the anionic component is one anion, corresponding to a molar ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:1. In some embodiments, the anionic component is two anions, corresponding to a molar ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:2. In some embodiments, the anionic component is three anions, corresponding to a molar ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:3. In some embodiments, the anionic component is four anions, corresponding to a molar ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:4. In some embodiments, the anionic component is four anions, corresponding to a molar ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:5. In some embodiments, the anionic component is four anions, corresponding to a molar ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:6. In some embodiments, the anionic component is four anions, corresponding to a molar ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:7. In some embodiments, the anionic component is four anions, corresponding to a molar ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:8.

[0225] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) derive from the structure of the compound in Tables 1A-1G.

[0226] In some embodiments, the anionic component of R7is selected from the group consisting of besylate, mesylate, tosylate, sulfonate, sulfate, methylsulfate, camsylate, isethionate, edisylate, 1-hydroxy-2-naphthoate, 2,2-dichloroacetate, 2-hydroxyethanesulfonate, 2-oxoglutarate, 4-WSGR Docket No.: 56017-735.601 acetamidobenzoate, 4-aminosalicylate, acetate, trifluoroacetate, adipate, ascorbate, aspartate, benzenesulfonate, benzoate, bromide, chloride, camphorate, camphor-10-sulfonate, caprate (decanoate), caproate (hexanoate), caprylate (octanoate), carbonate, cinnamate, citrate, cyclamate, dodecylsulfate, dodecylsulfurate, ethanesulfonate, ethane-1,2-disulfonate, ethanesulfonate, formate, fumarate, galactarate, gentisate, glucoheptonate, gluconate, glutantate, glucuronate, glutamate, glutarate, glycerophosphorate, glycine, glycolate, hippurate, hydrobromate, hydroiodide, hydrochlorate, isobutyrate, lactate, lactobionate, laurate, lysine, maleate, malate, malonate, mandelate, methanesulfonate , naphthalene-1,5-disulfonate, naphthalene-2-sulfonate, nicotinate, nitrate, oleate, orotate, oxalate, palmitate, pamoate, phosphorate, proprionate, pyroglutamate, salicylate, sebacate, stearate, succinate, sulfurate, tannate, tartarate, thiocyanate, toluenesulfonate, undecylenate, α-lipoate, 12-hydroxystearate, 2-(4-isobutylphenyl)propionate, 2- (4,4-dimethyl-2-pentanyl)-5,7,7-trimethyloctanoate, 2-aminoethanesulfonate, 2-hexyldecanoate, 2-hydroxyhippurate, 3-(4-hydroxyphenyl)propionate, 3-methylcrotonate, 3,3- diphenylpropionate, 3,4-dihydroxbenzoate, ,5-dihydroxybenzoate, 4-acetamido-benzoate, 3,7- dimethyloctanoate, 4-hydroxybenzenesulfonate, 4-hydroxybenzoate, 4-methylhexanoate, 4- methyloctanoate, valerate salts including 4-methylvalerate, 5-norbornene-2-carboxylate, 8-[(2- hydroxybenzoyl)amino]octanoate, abietate, acetylcysteine, aconitate, arachidonate, behenate, caffeate, chenodeoxycholate, citronellate, crotonate, galactonate, deoxycholate, dihydrocaffeate, 2-phenylpropionate (hydratropate), tropate, eicosanedioate, eicosapentanoate (EPA), elaidate, ellagate, erucate, ethylenediaminetetraacetate (EDTA), geranate, heptanoate, hydrocinnamate (3- phenylpropionate), isovalerate, glutathione reduced, lactate, laurate, levulinate, linoleate, linolenate, lithocholate, mesaconate, nonanoate, oxalate, coumarate, palmitate, perillate, pimelate, 3–phenylpropionate, pivalate, propionate, pyruvate, ricinoleate, salicylate, 2-hydroxybenzoate, sinapinate (3,5-dimethoxy-4-hydroxycinnamate), sorbate, syringate, tiglate, 2-decenoate, 2- hexenoate, 2-octenoate, 3-octenoate, 7-octenoate, ferulate, undecanoate, valerate, vanillate, perchlorate, alginate, bisulfate, borate, butyrate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecylsulfate, glycerophosphate, hemisulfate, hydroiodide, lauryl sulfate, 2– naphthalenesulfonate, pectinate, persulfate, phosphate, tartrate, o-(4-hydroxybenzoyl)benzoate, 1,2,-ethanedisulfonate, chlorobenzenesulfonate, 4-methylbicyclo[2.2.2]oct-2-ene-carboxylate, 4.4’-methylenebis(3-hydroxy-2- ene-1-carboxylate), trimethylacetate, tertiary butylacetate, lauryl sulfurate, hydroxynaphthoate, muconate, αKetoglutarate, p-toluenesulfonate, p-coumarate, and p- chlorobenzenesulfonate. In some embodiments, is 8-[(2-hydroxybenzoyl)amino]octanoate.

[0227] In some embodiments, the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) and anionic component are provided in a ratio of one or more cations of anyWSGR Docket No.: 56017-735.601 one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7 or 1:8, or of between any two of these ratios. In some embodiments, the anionic component is selected from the group of anionic components described herein, further provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7 or 1:8, or of between any two of these ratios. In some embodiments, the anionic component is selected from the group of cationic components listed in Tables 2A-2G. In some embodiments, the anionic component is selected from the group of anionic components listed in Tables 2A-2G, further provided in a ratio of one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) to anionic component that is 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7 or 1:8, or of between any two of these ratios. In some embodiments, the anionic component is selected from the group of anionic components listed in Tables 2A-2G, further provided in a weight % (wt. %) ratio relative to the one or more cations of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) as listed in Tables 2A-2G.

[0228] In some embodiments, provided is a hydrate of the compound of Formula IIa, Formula IIb, Formula IIc, or any combination thereof. Exemplary hydrates include (compound of Formula IIa, Formula IIb Formula IIc, or any combination thereof • ZH2O), wherein Z is from 1 to 50. In some embodiments, Z is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50. In some embodiments, Z is between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 and 50. In some embodiments, provided is a hydrate of the compound of Formula IId, IId-1, IId-2, IId-3, IId-4, IId-5, IId-6, IId-7, or IId-8. Exemplary hydrates include (compound of Formula IId, IId-1, IId-2, IId-3, IId-4, IId-5, IId-6, IId-7, or IId-8 • ZH2O), wherein Z is from 1 to 50. In some embodiments, Z is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50. In some embodiments, Z is between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 and 50.

[0229] In an aspect, provided herein is, inter alia, a compound comprising the structure of Formula III: or a pharmaceutically acceptable salt thereof; Formula III wherein:WSGR Docket No.: 56017-735.601 is a covalent derivative of one or more carboxyl groups of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii), or a pharmaceutically acceptable salt thereof, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker, or Asp residue of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii); and each R100is independently selected from an optionally substituted group consisting of C1-6aliphatic, (C1-22)alkyl, (C1-22)alkenyl, -C(O)R, -C(O)OR, -C(O)N(R)2, phenyl, 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur; and each occurrence of R is independently hydrogen or an optionally substituted group selected from C1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0230] In an aspect, provided herein is, inter alia, a compound comprising the structure of Formula III: Formula III, or a pharmaceutically acceptable salt thereof, wherein: (a)is a covalent derivative of one or more carboxyl groups of any onecompound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17-WSGR Docket No.: 56017-735.601 carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, or a pharmaceutically acceptable salt thereof,WSGR Docket No.: 56017-735.601 wherein the covalent derivative of one or more carboxyl groups are of the C18 diacid, C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) and are in the form of; and (b) each R100is independently selected from an optionally substituted group consisting of C1-6aliphatic, (C1-22)alkyl, (C1-22)alkenyl, -C(O)R, -C(O)OR, -C(O)N(R)2, phenyl, 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur; and each occurrence of R is independently hydrogen or an optionally substituted group selected from C1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0231] In some embodiments, R100is substituted C1-6aliphatic, unsubstituted C1-6aliphatic, substituted (C1-22)alkyl, unsubstituted (C1-22)alkyl, substituted (C1-22)alkenyl, unsubstituted (C1- 22)alkenyl, substituted phenyl, unsubstituted phenyl, substituted -C(O)R, unsubstituted -C(O)R, substituted -C(O)OR, unsubstituted -C(O)OR, substituted -C(O)N(R)2, or unsubstituted - C(O)N(R)2.

[0232] In some embodiments, R100is methyl, ethyl, n-propyl, iso-propyl, n-butyl, iso-butyl, tert- butyl, or pentyl. In some embodiments, R100is fluoromethyl, difluoromethyl, or trifluoromethyl. In some embodiments, R100is CHCH3OC(O)OCH2CH3. In some embodiments, R100is -CH3, -CH2CH3, -CH(CH3)2, CH2CH2CH2CH3, C(CH3)3, - CH2CH2N(CH3)3+.

[0233] In some embodiments, R100is (C2-C12)alkanoyloxymethyl, 1-(alkanoyloxy)ethyl having from 4 to 9 carbon atoms, 1-methyl-1-(alkanoyloxy)-ethyl having from 5 to 10 carbon atoms, alkoxycarbonyloxymethyl having from 3 to 6 carbon atoms, 1-(alkoxycarbonyloxy)ethyl havingWSGR Docket No.: 56017-735.601 from 4 to 7 carbon atoms, 1-methyl-1-(alkoxycarbonyloxy)ethyl having from 5 to 8 carbon atoms, N-(alkoxycarbonyl)aminomethyl having from 3 to 9 carbon atoms, 1-(N- (alkoxycarbonyl)amino)ethyl having from 4 to 10 carbon atoms, 3-phthalidyl, 4-crotonolactonyl, gamma-butyrolacton-4-yl, di-N,N-(C1-C2)alkylamino(C2-C3)alkyl (such as β- dimethylaminoethyl), carbamoyl-(C1-C2)alkyl, N,N-di(C1-C2)alkylcarbamoyl-(C1-C2)alkyl and piperidino-, pyrrolidino- or morpholino(C2-C3)alkyl.

[0234] In some embodiments, the compound of Formula III is formed from the terminal carboxyl moiety of the –CO(CH2)16CO2 diacid moiety, the (^Glu) linker, and / or the side chain carboxyl moiety of one or more aspartic acid or glutamic acid residues of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii).

[0235] In some embodiments, the compound of Formula III is formed from the carboxyl of the –CO(CH2)18CO2 diacid moiety of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii).

[0236] In some embodiments, the compound of Formula III is formed from the carboxyl of the (^Glu) linker of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii).

[0237] In some embodiments, the compound of Formula III is formed from the side chain carboxyl of one or more aspartic acid or glutamic acid residues of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii).

[0238] In some embodiments, provided is a compound of Formula III, wherein is a covalent derivative of one or more carboxyl groups of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2- [2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:,WSGR Docket No.: 56017-735.601 wherein the covalent derivative of one or more carboxyl groups are of the C18 diacid, ^- Glu linker, Glu residues, and / or Asp residues are in the form of.

[0239] In some embodiments, provided is a compound of Formula III, whereinis a covalent derivative of one or more carboxyl groups of H-Aib-EGTFTSDVSK([2-[2-[2-[[2- [2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide or a pharmaceutically acceptable salt thereof, and H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2- [2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl ])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide has the structure of:, wherein the covalent derivative of one or more carboxyl groups are of the C18 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of.

[0240] In some embodiments, provided is a compound of Formula III, whereinis a covalent derivative of one or more carboxyl groups of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceuticallyWSGR Docket No.: 56017-735.601 acceptable salt thereof, and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2- [2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

[0241] In some embodiments, provided is a compound of Formula III, whereinis a covalent derivative of one or more carboxyl groups of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2- [2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:WSGR Docket No.: 56017-735.601, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of.

[0242] In some embodiments, provided is a compound of Formula III, whereinis a covalent derivative of one or more carboxyl groups of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4- carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof , and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2- amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy]ethox y]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:WSGR Docket No.: 56017-735.601, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of.

[0243] In some embodiments, provided is a compound of Formula III, whereinis a covalent derivative of one or more carboxyl groups of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4- carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4- carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure ofWSGR Docket No.: 56017-735.601, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

[0244] In some embodiments, provided is a compound of Formula III, whereinis a covalent derivative of one or more carboxyl groups of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2- [2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl] )-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker,WSGR Docket No.: 56017-735.601 Glu residues, and / or Asp residues are in the form of.

[0245] In some embodiments, provided is a compound of Formula IIIa:Formula IIIa, or a pharmaceutically acceptable salt or salts thereof.

[0246] In some embodiments, provided is a compound of Formula IIIa, wherein the compound of Formula IIIa is a compound selected from the group consisting of:, , , , Formula IIIa-1 Formula IIIa-2 Formula IIIa-3 Formula IIIa-4, , , , Formula IIIa-5 Formula IIIa-6 Formula IIIa-7 Formula IIIa-8Formula IIIa-9 Formula IIIa-10 Formula IIIa-11 Formula IIIa-12 or a pharmaceutically acceptable salt or salts thereof.

[0247] In some embodiments, the compound of Formula IIIa is a compound comprising the structureFormula IIIa-1, or a pharmaceutically acceptable salt or salts thereof.WSGR Docket No.: 56017-735.601

[0248] In some embodiments, provided herein is a compound comprising the structure of Formula IIIa-1:Formula IIIa-1, or a pharmaceutically acceptable salt thereof.

[0249] In some embodiments, provided herein is a compound comprising the structure of Formula IIIa-1:Formula IIIa-1, or a pharmaceutically acceptable salt thereof, wherein R100is -CH3, -CH2CH3, -CH(CH3)2, CH2CH2CH2CH3, C(CH3)3, or -CH2CH2N(CH3)3+.

[0250] In some embodiments, provided herein is a compound comprising the structure of Formula IIIa:Formula IIIa-1, or a pharmaceutically acceptable salt thereof, wherein R100is -CH3, -CH2CH3, -CH(CH3)2, CH2CH2CH2CH3, C(CH3)3, or -CH2CH2N(CH3)3+, and the compound of Formula IIIa is formed from the terminal carboxyl moiety of the –CO(CH2)16CO2diacid moiety of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii).

[0251] In some embodiments, the compound has the structure of Formula IIIb:Formula IIIb, or a pharmaceutically acceptable salt or salts thereof.

[0252] In some embodiments, the compound has the structure of Formula IIIb-1:WSGR Docket No.: 56017-735.601Formula IIIb-1, or a pharmaceutically acceptable salt or salts thereof.

[0253] In some embodiments, R100is selected from the group consisting of methyl, ethyl, n- propyl, isopropyl, n-butyl, isobutyl, tert-butyl, or pentyl.

[0254] In some embodiments, R100is ethyl.

[0255] In some embodiments, the covalent derivative of one carboxyl group is of the C18 diacid.

[0256] In some embodiments, the covalent derivative of one carboxyl group is of the C20 diacid.

[0257] In some embodiments, the covalent derivative of one carboxyl group is of the ^-Glu linker.

[0258] In some embodiments, the covalent derivative of one carboxyl group is of a Glu residue.

[0259] In some embodiments, the covalent derivative of one carboxyl group is of a Asp residue.

[0260] In some embodiments, provided is a hydrate of the compound of Formula III, IIIa, IIIa- 1, IIIa-2, IIIa-3, IIIa-4, IIIa-5, IIIa-6, IIIa-7, IIIa-8, IIIa-9, IIIa-10, IIIa-11, IIIa-12, IIIb, or IIIb-1. Exemplary hydrates include (compound of Formula III, IIIa, IIIa-1, IIIa-2, IIIa-3, IIIa-4, IIIa-5, IIIa-6, IIIa-7, IIIa-8, IIIa-9, IIIa-10, IIIa-11, IIIa-12, IIIb, or IIIb-1 • ZH2O), wherein Z is from 1 to 50. In some embodiments, Z is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50. In some embodiments, Z is between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 and 50.

[0261] In another aspect, provided herein is a compound comprising the structure of Formula IV:Formula IV, or a pharmaceutically acceptable salt thereof, wherein: is a covalent derivative of one or more hydroxyl groups of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17-WSGR Docket No.: 56017-735.601 carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]et hoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]et hoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELSTAAL GRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]et hoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTETGS GSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]a mino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2- [2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]a mino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2- [2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]et hoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]et hoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, or a pharmaceutically acceptable salt thereof,WSGR Docket No.: 56017-735.601 wherein the covalent derivative of one or more hydroxyl groups are of the Ser, Thr and / or Tyr residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) and are in the form(b) each R101is independently selected from an optionally substituted group consisting of -CH2R, -C(O)R (such as -C(O)CH3or -C(O)H), -C(O)OR (such as -C(O)OH2), -C(O)N(R)2(such as - C(O)NH2or -C(O)N(CH3)2), -OP(O)OROR (such as -OP(O)OHOH); and each occurrence of R is independently hydrogen or an optionally substituted group selected from C1-6aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0262] In some embodiments, R101is -CH2OCH2CH2OH, unsubstituted C(O)C1-6alkyl such as COCH3, COCH2CH3, or COCH(CH3)2). In some embodiments, R101is substituted C(O)C1-6alkyl such as COCF3, COCHCF2, or -COCH2CF. In some embodiments, R101is substituted C(O)phenyl or unsubstituted C(O)phenyl. In some embodiments, R101is -(C1-C6)alkanoyloxymethyl, -1-((C1- C6)alkanoyloxy)ethyl, -1-methyl-1-((C1-C6)alkanoyloxy)ethyl, -(C1- C6)alkoxycarbonyloxymethyl, -N-(C1-C6)alkoxycarbonylaminomethyl, -succinoyl, -(C1- C6)alkanoyl, -α-amino(C1-C4)alkanoyl, -arylacyl and -α-aminoacyl, or -α-aminoacyl-α- aminoacyl, where each α-aminoacyl group is independently selected from the naturally occurring L-amino acids, P(O)(OH)2, -P(O)(O(C1-C6)alkyl)2 or glycosyl (the radical resulting from the removal of a hydroxyl group of the hemiacetal form of a carbohydrate). In some embodiments, R101is CHCH3OC(O)OCH2CH3.

[0263] In some embodiments, the compound of Formula IV is formed from the side chain hydroxyl moiety of one or more serine residues of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii).

[0264] In some embodiments, the compound of Formula IV is formed from the side chain hydroxyl moiety of one or more threonine residues of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii). In some embodiments, the compound of Formula IV is formed from the side chain hydroxyl moiety of one or more tyrosine residues of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii).

[0265] In some embodiments, provided herein is a compound comprising the structure of Formula IVa:WSGR Docket No.: 56017-735.601Formula IVa, or a pharmaceutically acceptable salt thereof.

[0266] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-1:Formula IVa-1, or a pharmaceutically acceptable salt thereof.

[0267] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-2:Formula IVa-2, or a pharmaceutically acceptable salt thereof.

[0268] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-3:Formula IVa-3, or a pharmaceutically acceptable salt thereof.

[0269] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-4:Formula IVa-4, or a pharmaceutically acceptable salt thereof.

[0270] In some embodiments, provided herein is a compound comprising the structure ofWSGR Docket No.: 56017-735.601 Formula IVa-5:Formula IVa-5, or a pharmaceutically acceptable salt thereof.

[0271] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-6:Formula IVa-6, or a pharmaceutically acceptable salt thereof.

[0272] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-7:Formula IVa-7, or a pharmaceutically acceptable salt thereof.

[0273] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-8:Formula IVa-8, or a pharmaceutically acceptable salt thereof.

[0274] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-9:Formula IVa-9,WSGR Docket No.: 56017-735.601 or a pharmaceutically acceptable salt thereof.

[0275] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-10:Formula IVa-10, or a pharmaceutically acceptable salt thereof.

[0276] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-11:Formula IVa-11, or a pharmaceutically acceptable salt thereof.

[0277] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-12:Formula IVa-12, or a pharmaceutically acceptable salt thereof.

[0278] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-13:Formula IVa-13, or a pharmaceutically acceptable salt thereof.

[0279] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-14:WSGR Docket No.: 56017-735.601 Formula IVa-14, or a pharmaceutically acceptable salt thereof.

[0280] In some embodiments, provided herein is a compound comprising the structure of Formula IVa-15:Formula IVa-15, or a pharmaceutically acceptable salt thereof.

[0281] In some embodiments, provided is a hydrate of the compound of the structure of Formula IV, IVa, IVa-1, IVa-2, IVa-3, IVa-4, IVa-5, IVa-6, IVa-7, IVa-8, IVa-9, IVa-10, IVa-11, IVa-12, IVa-13, IVa-14, or IVa-15. Exemplary hydrates include the compound of Formula IV, IVa, IVa- 1, IVa-2, IVa-3, IVa-4, IVa-5, IVa-6, IVa-7, IVa-8, IVa-9, IVa-10, IVa-11, IVa-12, IVa-13, IVa- 14, or IVa-15 • ZH2O, wherein Z is from 1 to 50. In some embodiments, Z is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50. In some embodiments, Z is between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 and 50.

[0282] In an aspect, provided herein is a compound comprising the structure of Formula V or Formula VI:Formula VFormula VI, or a pharmaceutically acceptable salt of each thereof; wherein:WSGR Docket No.: 56017-735.601is each a covalent derivative of one or more amino or imidazole groups of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt thereof; and wherein the one or more amino groups of the Arg residues and / or terminal amino group of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are in the form of ;is a covalent derivative of the imidazole group of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt thereof; wherein the one or more imidazole groups of the His residues of any one of the peptides (i), (ii),(iii), (iv), (v), (vi) or (vii) is in the form of ; and each R102and R103is independently selected from an optionally substituted group consisting of - CH2R, -C(O)R (such as -C(O)CH3-C(O) CH2CH3or -C(O)H), -C(O)OR (such as -C(O)OH2), - C(O)N(R)2 (such as -C(O)NH2 or -C(O)NHR), -OP(O)OROR (such as -OP(O)OHOH); and each occurrence of R is independently hydrogen or an optionally substituted group selected from C1-6aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an 8-10 memberedWSGR Docket No.: 56017-735.601 bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

[0283] In some embodiments, each R102and R103is independently -CH2OCH2CH2OH, unsubstituted C(O)C1-6alkyl such as COCH3, COCH2CH3, or COCH(CH3)2). In some embodiments, R102is substituted C(O)C1-6alkyl such as COCF3, COCHCF2, or -COCH2CF. In some embodiments, R102is substituted C(O)phenyl or unsubstituted C(O)phenyl. In some embodiments, R102is CHCH3OC(O)OCH2CH3.

[0284] In some embodiments, each R102and R103is independently C(O)R, C(O)OR, C(O)NR’R”, where R’ and R” are each independently (C1-C10)alkyl, (C3-C7)cycloalkyl, benzyl, or C(O)R’ is a natural α-aminoacyl or natural α-aminoacyl-natural α-aminoacyl, - C(OH)C(O)OY1wherein Y1is H, (C1-C6)alkyl or benzyl, -C(OY2)Y3wherein Y2is (C1-C4) alkyl and Y3is (C1-C6)alkyl, carboxy(C1-C6)alkyl, amino(C1-C4)alkyl or mono-N-or di-N,N-(C1- C6)alkylaminoalkyl, -C(Y4)Y5wherein Y4is H or methyl and Y5is mono-N- or di-N,N-( C1- C6)alkylamino, morpholino, piperidin-1-yl or pyrrolidin-1-yl.

[0285] In some embodiments, provided herein is a compound comprising the structure of Formula Va:Formula Va or a pharmaceutically acceptable salt thereof.

[0286] In some embodiments, provided herein is a compound comprising the structure of Formula Va-1:Formula Va-1 or a pharmaceutically acceptable salt thereof.

[0287] In some embodiments, provided herein is a compound comprising the structure of Formula Va-2:WSGR Docket No.: 56017-735.601 Formula Va-2 or a pharmaceutically acceptable salt thereof.

[0288] In some embodiments, provided herein is a compound comprising the structure of Formula Va-3:Formula Va-3 or a pharmaceutically acceptable salt thereof.

[0289] In some embodiments, provided herein is a compound comprising the structure of Formula Va-4:Formula Va-4 or a pharmaceutically acceptable salt thereof.

[0290] In some embodiments, provided herein is a compound comprising the structure of Formula Va-5:Formula Va-5 or a pharmaceutically acceptable salt thereof.

[0291] In some embodiments, provided herein is a compound comprising the structure of Formula Va-6:Formula Va-6 or a pharmaceutically acceptable salt thereof.

[0292] In some embodiments, provided herein is a compound comprising the structure of Formula VIa:WSGR Docket No.: 56017-735.601Formula VIa, or a pharmaceutically acceptable salt thereof.

[0293] In some embodiments, provided herein is a compound comprising the structure of Formula VIa-1:Formula VIa-1, or a pharmaceutically acceptable salt thereof.

[0294] In some embodiments, provided herein is a compound comprising the structure of Formula VIa:Formula VIa-2, or a pharmaceutically acceptable salt thereof.

[0295] In some embodiments, provided is a hydrate of the compound of Formula V, Va, VI and / or VIa. Exemplary hydrates include (compound of Formula V, Va, VI and / or VIa • ZH2O), wherein Z is from 1 to 50. In some embodiments, Z is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50. In some embodiments, Z is between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 and 50. In some embodiments,WSGR Docket No.: 56017-735.601 provided is a hydrate of the compound of Formula V, Va, Va-1, Va-2, Va-3, Va-4, Va-5, Va-6, VI, VIa VIa-1, and / or VIa-2. Exemplary hydrates include (compound of Formula V, Va, Va-1, Va-2, Va-3, Va-4, Va-5, Va-6, VI, VIa VIa-1, and / or VIa-2 • ZH2O), wherein Z is from 1 to 50. In some embodiments, Z is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50. In some embodiments, Z is between any two of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 and 50. Ratios of Counterion(s) to Ionic Salt Form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii)

[0296] In some embodiments, (i) a weight % (wt. %) ratio ofis from about 0.1 wt. %: 99.9 wt. % to about 20.0 wt. %: 80.0 wt. %; or(ii) a weight % (wt. %) ratioany combination thereofis from about 0.1 wt. %: 99.9 wt. % to about 20.0 wt. %: 80.0 wt. %.

[0297] In some embodiments, (i) a molar ratio of : is from about 2:1 to about 10:1; or(ii) a molar ratio ofor any combination thereof is fromabout 2:1 to about 10:1.

[0298] In some embodiments, (i) a molar ratio of : is from about 2:1 to about 7:1; orWSGR Docket No.: 56017-735.601(ii) a molar ratio ofor any combination thereof is fromabout 2:1 to about 7:1.

[0299] In some embodiments, (i) a molar ratio of : is from about 3:1 to about 7:1; or(ii) a molar ratio ofor any combination thereof is fromabout 3:1 to about 7:1.

[0300] In some embodiments, (i) a molar ratio of : is from about 4:1 to about 7:1; or(ii) a molar ratioor any combination thereof is fromabout 4:1 to about 7:1.

[0301] In some embodiments,(i) a molar ratio of : is from about 3:1 to about 7:1; orRatios of Counterion to Ionic Salt Form of Any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii)

[0302] In some embodiments, a weight % (wt. %) ratio of :is from about 0.1 wt. %:WSGR Docket No.: 56017-735.601 99.9 wt. % to about 20.0 wt. %: 80.0 wt. %.

[0303] In some embodiments, a weight % (wt. %) ratio of :is from about 0.2 wt. %: 99.8 wt. %, from about 0.3 wt. %: 99.7 wt. %, from about 0.4 wt. %: 99.6 wt. %, from about 0.5 wt. %: 99.5 wt. %, from about 0.6 wt. %: 99.4 wt. %, from about 0.7 wt. %: 99.3 wt. %, from about 0.8 wt. %: 99.2 wt. %, from about 0.9 wt. %: 99.1 wt. %, from about 1.0 wt. %: 99.0 wt. %, from about 1.1 wt. %: 98.9 wt. %, from about 1.2 wt. %: 98.8 wt. %, from about 1.3 wt. %: 98.7 wt. %, from about 1.4 wt. %: 98.6 wt. %, from about 1.5 wt. %: 98.5 wt. %, from about 1.6 wt. %: 98.4 wt. %, from about 1.7 wt. %: 98.3 wt. %, from about 1.8 wt. %: 98.2 wt. %, from about 1.9 wt. %: 98.1 wt. %, from about 2.0 wt. %: 98.0 wt. %, from about 3.0 wt. %: 97.0 wt. %, from about 4.0 wt. %: 96.0 wt. %, from about 5.0 wt. %: 95.0 wt. %, from about 6.0 wt. %: 94.0 wt. %, from about 7.0 wt. %: 93.0 wt. %, from about 8.0 wt. %: 92.0 wt. %, from about 9.0 wt. %: 91.0 wt. %, from about 10 wt. %: 90 wt. %, from about 11 wt. %: 89 wt. %, from about 12 wt. %: 88 wt. %, from about 13 wt. %: 87 wt. %, from about 14 wt. %: 86 wt. %, from about 15 wt. %: 85 wt. %, from about 16 wt. %: 84 wt. %, from about 17 wt. %: 83 wt. %, from about 18 wt. %: 82 wt. %, from about 19 wt. %: 81 wt. %, from about 20 wt. %: 80 wt. %, from about 21 wt. %: 79 wt. %, from about 22 wt. %: 78 wt. %, from about 23 wt. %: 77 wt. %, from about 24 wt. %: 76 wt. %, from about 25 wt. %: 75 wt. %, from about 26 wt. %: 74 wt. %, from about 27 wt. %: 73 wt. %, from about 28 wt. %: 72 wt. %, from about 29 wt. %: 71 wt. %, from about 30 wt. %: 70 wt. %, from about 35 wt. %: 65 wt. %, from about 40 wt. %: 60 wt. %, from about 45 wt. %: 55 wt. %, from about 50 wt. %: 50 wt. %, from about 55 wt. %: 45 wt. %, from about 60 wt. %: 40 wt. %, from about 65 wt. %: 35 wt. %, from about 70 wt. %: 30 wt. %, from about 75 wt. %: 25 wt. %, from about 80 wt. %: 20 wt. %, from about 85 wt. %: 15 wt. %, from about 90 wt. %: 10 wt. %, or from about 95 wt. %: 5 wt. %.

[0304] In some embodiments, a weight % (wt. %) ratio of : is to about 20.0 wt. %: 80.0 wt. %. In some embodiments, a weight % (wt. %) ratio of :is to about 0.2 wt. %: 99.8 wt. %, to about 0.3 wt. %: 99.7 wt. %, to about 0.4 wt. %: 99.6 wt. %, to about 0.5 wt. %: 99.5 wt. %, to about 0.6 wt. %: 99.4 wt. %, to about 0.7 wt. %: 99.3 wt. %, to about 0.8 wt. %: 99.2 wt. %, to about 0.9 wt. %: 99.1 wt. %, to about 1.0 wt. %: 99.0 wt. %, to about 1.1 wt. %: 98.9 wt. %, to about 1.2 wt. %: 98.8 wt. %, to about 1.3 wt. %: 98.7 wt. %, to about 1.4 wt. %: 98.6 wt. %, to about 1.5 wt. %: 98.5 wt. %, to about 1.6 wt. %: 98.4 wt. %, to about 1.7 wt. %: 98.3 wt. %, to about 1.8 wt. %: 98.2 wt. %, to about 1.9 wt. %: 98.1 wt. %, to about 2.0 wt. %:WSGR Docket No.: 56017-735.601 98.0 wt. %, to about 3.0 wt. %: 97.0 wt. %, to about 4.0 wt. %: 96.0 wt. %, to about 5.0 wt. %: 95.0 wt. %, to about 6.0 wt. %: 94.0 wt. %, to about 7.0 wt. %: 93.0 wt. %, to about 8.0 wt. %: 92.0 wt. %, to about 9.0 wt. %: 91.0 wt. %, to about 10 wt. %: 90 wt. %, to about 11 wt. %: 89 wt. %, to about 12 wt. %: 88 wt. %, to about 13 wt. %: 87 wt. %, to about 14 wt. %: 86 wt. %, to about 15 wt. %: 85 wt. %, to about 16 wt. %: 84 wt. %, to about 17 wt. %: 83 wt. %, to about 18 wt. %: 82 wt. %, to about 19 wt. %: 81 wt. %, to about 20 wt. %: 80 wt. %, to about 21 wt. %: 79 wt. %, to about 22 wt. %: 78 wt. %, to about 23 wt. %: 77 wt. %, to about 24 wt. %: 76 wt. %, to about 25 wt. %: 75 wt. %, to about 26 wt. %: 74 wt. %, to about 27 wt. %: 73 wt. %, to about 28 wt. %: 72 wt. %, to about 29 wt. %: 71 wt. %, to about 30 wt. %: 70 wt. %, to about 35 wt. %: 65 wt. %, to about 40 wt. %: 60 wt. %, to about 45 wt. %: 55 wt. %, to about 50 wt. %: 50 wt. %, to about 55 wt. %: 45 wt. %, to about 60 wt. %: 40 wt. %, to about 65 wt. %: 35 wt. %, to about 70 wt. %: 30 wt. %, to about 75 wt. %: 25 wt. %, to about 80 wt. %: 20 wt. %, to about 85 wt. %: 15 wt. %, to about 90 wt. %: 10 wt. %, or to about 95 wt. %: 5 wt. %.

[0305] In some embodiments, a weight % (wt. %) ratio of : is from about 0.2 wt. %: 99.8 wt. % to about 95 wt. %: 5 wt. % , from about 0.3 wt. %: 99.7 wt. % to about 95 wt. %: 5 wt. %, from about 0.4 wt. %: 99.6 wt. % to about 95 wt. %: 5 wt. %, from about 0.5 wt. %: 99.5 wt. % to about 95 wt. %: 5 wt. %, from about 0.6 wt. %: 99.4 wt. % to about 95 wt. %: 5 wt. %, from about 0.7 wt. %: 99.3 wt. % to about 95 wt. %: 5 wt. %, from about 0.8 wt. %: 99.2 wt. % to about 95 wt. %: 5 wt. %, from about 0.9 wt. %: 99.1 wt. % to about 95 wt. %: 5 wt. %, from about 1.0 wt. %: 99.0 wt. % to about 95 wt. %: 5 wt. %, from about 1.1 wt. %: 98.9 wt. % to about 95 wt. %: 5 wt. %, from about 1.2 wt. %: 98.8 wt. % to about 95 wt. %: 5 wt. %, from about 1.3 wt. %: 98.7 wt. % to about 95 wt. %: 5 wt. %, from about 1.4 wt. %: 98.6 wt. % to about 95 wt. %: 5 wt. %, from about 1.5 wt. %: 98.5 wt. % to about 95 wt. %: 5 wt. %, from about 1.6 wt. %: 98.4 wt. % to about 95 wt. %: 5 wt. %, from about 1.7 wt. %: 98.3 wt. % to about 95 wt. %: 5 wt. %, from about 1.8 wt. %: 98.2 wt. % to about 95 wt. %: 5 wt. %, from about 1.9 wt. %: 98.1 wt. % to about 95 wt. %: 5 wt. %, from about 2.0 wt. %: 98.0 wt. % to about 95 wt. %: 5 wt. %, from about 3.0 wt. %: 97.0 wt. % to about 95 wt. %: 5 wt. %, from about 4.0 wt. %: 96.0 wt. % to about 95 wt. %: 5 wt. %, from about 5.0 wt. %: 95.0 wt. % to about 95 wt. %: 5 wt. %, from about 6.0 wt. %: 94.0 wt. % to about 95 wt. %: 5 wt. %, from about 7.0 wt. %: 93.0 wt. % to about 95 wt. %: 5 wt. %, from about 8.0 wt. %: 92.0 wt. % to about 95 wt. %: 5 wt. %, from about 9.0 wt. %: 91.0 wt. % to about 95 wt. %: 5 wt. %, from about 10 wt. %: 90 wt. % to about 95 wt. %: 5 wt. %, from about 11 wt. %: 89 wt. % to about 95 wt. %: 5 wt. %, from about 12 wt. %: 88 wt. % to about 95 wt. %: 5 wt. %, from about 13 wt. %: 87 wt. % to about 95 wt. %: 5 wt. %, from about 14 wt. %: 86 wt. % to about 95 wt. %: 5 wt. %, from about 15 wt. %: 85 wt. % to about 95 wt. %: 5 wt. %,WSGR Docket No.: 56017-735.601 from about 16 wt. %: 84 wt. % to about 95 wt. %: 5 wt. %, from about 17 wt. %: 83 wt. % to about 95 wt. %: 5 wt. %, from about 18 wt. %: 82 wt. % to about 95 wt. %: 5 wt. %, from about 19 wt. %: 81 wt. % to about 95 wt. %: 5 wt. %, from about 20 wt. %: 80 wt. % to about 95 wt. %: 5 wt. %, from about 21 wt. %: 79 wt. % to about 95 wt. %: 5 wt. %, from about 22 wt. %: 78 wt. % to about 95 wt. %: 5 wt. %, from about 23 wt. %: 77 wt. % to about 95 wt. %: 5 wt. %, from about 24 wt. %: 76 wt. % to about 95 wt. %: 5 wt. %, from about 25 wt. %: 75 wt. % to about 95 wt. %: 5 wt. %, from about 26 wt. %: 74 wt. % to about 95 wt. %: 5 wt. %, from about 27 wt. %: 73 wt. % to about 95 wt. %: 5 wt. %, from about 28 wt. %: 72 wt. % to about 95 wt. %: 5 wt. %, from about 29 wt. %: 71 wt. % to about 95 wt. %: 5 wt. %, from about 30 wt. %: 70 wt. % to about 95 wt. %: 5 wt. %, from about 35 wt. %: 65 wt. % to about 95 wt. %: 5 wt. %, from about 40 wt. %: 60 wt. % to about 95 wt. %: 5 wt. %, from about 45 wt. %: 55 wt. % to about 95 wt. %: 5 wt. %, from about 50 wt. %: 50 wt. % to about 95 wt. %: 5 wt. %, from about 55 wt. %: 45 wt. % to about 95 wt. %: 5 wt. %, from about 60 wt. %: 40 wt. % to about 95 wt. %: 5 wt. %, from about 65 wt. %: 35 wt. % to about 95 wt. %: 5 wt. %, from about 70 wt. %: 30 wt. % to about 95 wt. %: 5 wt. %, from about 75 wt. %: 25 wt. % to about 95 wt. %: 5 wt. %, from about 80 wt. %: 20 wt. % to about 95 wt. %: 5 wt. %, from about 85 wt. %: 15 wt. % to about 95 wt. %: 5 wt. %, or from about 90 wt. %: 10 wt. % to about 95 wt. %: 5 wt. %.

[0306] In some embodiments, a weight % (wt. %) ratio of : is from about 0.1 wt. %: 99.9 wt. % to about 0.2 wt. %: 99.8 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.3 wt. %: 99.7 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.4 wt. %: 99.6 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.5 wt. %: 99.5 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.6 wt. %: 99.4 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.7 wt. %: 99.3 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.8 wt. %: 99.2 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.9 wt. %: 99.1 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.0 wt. %: 99.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.1 wt. %: 98.9 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.2 wt. %: 98.8 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.3 wt. %: 98.7 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.4 wt. %: 98.6 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.5 wt. %: 98.5 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.6 wt. %: 98.4 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.7 wt. %: 98.3 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.8 wt. %: 98.2 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.9 wt. %: 98.1 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 2.0 wt. %: 98.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 3.0 wt. %: 97.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 4.0 wt. %: 96.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 5.0 wt. %: 95.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 6.0 wt. %: 94.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 7.0 wt. %:WSGR Docket No.: 56017-735.601 93.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 8.0 wt. %: 92.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 9.0 wt. %: 91.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 10 wt. %: 90 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 11 wt. %: 89 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 12 wt. %: 88 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 13 wt. %: 87 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 14 wt. %: 86 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 15 wt. %: 85 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 16 wt. %: 84 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 17 wt. %: 83 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 18 wt. %: 82 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 19 wt. %: 81 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 20 wt. %: 80 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 21 wt. %: 79 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 22 wt. %: 78 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 23 wt. %: 77 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 24 wt. %: 76 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 25 wt. %: 75 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 26 wt. %: 74 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 27 wt. %: 73 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 28 wt. %: 72 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 29 wt. %: 71 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 30 wt. %: 70 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 35 wt. %: 65 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 40 wt. %: 60 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 45 wt. %: 55 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 50 wt. %: 50 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 55 wt. %: 45 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 60 wt. %: 40 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 65 wt. %: 35 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 70 wt. %: 30 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 75 wt. %: 25 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 80 wt. %: 20 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 85 wt. %: 15 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 90 wt. %: 10 wt. %, or from about 0.1 wt. %: 99.9 wt. % to about 95 wt. %: 5 wt. %.

[0307] In some embodiments, a weight % (wt. %) ratio of : is from about 0.1 wt. %: 99.9 wt. % to about 95 wt. %: 5 wt. %, from about 0.2 wt. %: 99.8 wt. % to about 90 wt. %: 10 wt. %, from about 0.3 wt. %: 99.7 wt. % to about 85 wt. %: 15 wt. %, from about 0.4 wt. %: 99.6 wt. % to about 80 wt. %: 20 wt. %, from about 0.5 wt. %: 99.5 wt. % to about 75 wt. %: 25 wt. %, from about 0.6 wt. %: 99.4 wt. % to about 70 wt. %: 30 wt. %, from about 0.7 wt. %: 99.3 wt. % to about 65 wt. %: 35 wt. %, from about 0.8 wt. %: 99.2 wt. % to about 60 wt. %: 40 wt. %, from about 0.9 wt. %: 99.1 wt. % to about 55 wt. %: 45 wt. %, from about 1.0 wt. %: 99.0 wt. % to about 50 wt. %: 50 wt. %, from about 1.1 wt. %: 98.9 wt. % to about 45 wt. %: 55 wt. %, from about 1.2 wt. %: 98.8 wt. % to about 40 wt. %: 60 wt. %, from about 1.3 wt. %: 98.7 wt. % to about 35 wt. %: 65 wt. %, from about 1.4 wt. %: 98.6 wt. % to about 30 wt. %: 70 wt. %, fromWSGR Docket No.: 56017-735.601 about 1.5 wt. %: 98.5 wt. % to about 29 wt. %: 71 wt. %, from about 1.6 wt. %: 98.4 wt. % to about 28 wt. %: 72 wt. %, from about 1.7 wt. %: 98.3 wt. % to about 27 wt. %: 73 wt. %, from about 1.8 wt. %: 98.2 wt. % to about 26 wt. %: 74 wt. %, from about 1.9 wt. %: 98.1 wt. % to about 25 wt. %: 75 wt. %, from about 2.0 wt. %: 98.0 wt. % to about 24 wt. %: 76 wt. %, from about 3.0 wt. %: 97.0 wt. % to about 23 wt. %: 77 wt. %, from about 4.0 wt. %: 96.0 wt. % to about 22 wt. %: 78 wt. %, from about 5.0 wt. %: 95.0 wt. % to about 21 wt. %: 79 wt. %, from about 6.0 wt. %: 94.0 wt. % to about 20 wt. %: 80 wt. %, from about 7.0 wt. %: 93.0 wt. % to about 19 wt. %: 81 wt. %, from about 8.0 wt. %: 92.0 wt. % to about 18 wt. %: 82 wt. %, from about 9.0 wt. %: 91.0 wt. % to about 17 wt. %: 83 wt. %, from about 10 wt. %: 90 wt. % to about 16 wt. %: 84 wt. %, from about 11 wt. %: 89 wt. % to about 15 wt. %: 85 wt. %, or from about 12 wt. %: 88 wt. % to about 14 wt. %: 86 wt. %.

[0308] In some embodiments, a weight % (wt. %) ratio of :is about 0.1 wt. %: 99.9 wt. %, about 0.2 wt. %: 99.8 wt. %, about 0.3 wt. %: 99.7 wt. %, about 0.4 wt. %: 99.6 wt. %, about 0.5 wt. %: 99.5 wt. %, about 0.6 wt. %: 99.4 wt. %, about 0.7 wt. %: 99.3 wt. %, about 0.8 wt. %: 99.2 wt. %, about 0.9 wt. %: 99.1 wt. %, about 1.0 wt. %: 99.0 wt. %, about 1.1 wt. %: 98.9 wt. %, about 1.2 wt. %: 98.8 wt. %, about 1.3 wt. %: 98.7 wt. %, about 1.4 wt. %: 98.6 wt. %, about 1.5 wt. %: 98.5 wt. %, about 1.6 wt. %: 98.4 wt. %, about 1.7 wt. %: 98.3 wt. %, about 1.8 wt. %: 98.2 wt. %, about 1.9 wt. %: 98.1 wt. %, about 2.0 wt. %: 98.0 wt. %, about 3.0 wt. %: 97.0 wt. %, about 4.0 wt. %: 96.0 wt. %, about 5.0 wt. %: 95.0 wt. %, about 6.0 wt. %: 94.0 wt. %, about 7.0 wt. %: 93.0 wt. %, about 8.0 wt. %: 92.0 wt. %, about 9.0 wt. %: 91.0 wt. %, about 10 wt. %: 90 wt. %, about 11 wt. %: 89 wt. %, about 12 wt. %: 88 wt. %, about 13 wt. %: 87 wt. %, about 14 wt. %: 86 wt. %, about 15 wt. %: 85 wt. %, about 16 wt. %: 84 wt. %, about 17 wt. %: 83 wt. %, about 18 wt. %: 82 wt. %, about 19 wt. %: 81 wt. %, about 20 wt. %: 80 wt. %, about 21 wt. %: 79 wt. %, about 22 wt. %: 78 wt. %, about 23 wt. %: 77 wt. %, about 24 wt. %: 76 wt. %, about 25 wt. %: 75 wt. %, about 26 wt. %: 74 wt. %, about 27 wt. %: 73 wt. %, about 28 wt. %: 72 wt. %, about 29 wt. %: 71 wt. %, about 30 wt. %: 70 wt. %, about 35 wt. %: 65 wt. %, about 40 wt. %: 60 wt. %, about 45 wt. %: 55 wt. %, about 50 wt. %: 50 wt. %, about 55 wt. %: 45 wt. %, about 60 wt. %: 40 wt. %, about 65 wt. %: 35 wt. %, about 70 wt. %: 30 wt. %, about 75 wt. %: 25 wt. %, about 80 wt. %: 20 wt. %, about 85 wt. %: 15 wt. %, about 90 wt. %: 10 wt. %, or about 95 wt. %: 5 wt. %.WSGR Docket No.: 56017-735.601

[0309] In some embodiments, a weight % (wt. %) ratio, or any combination thereof is from about 0.1 wt. %: 99.9 wt. % to about 20.0 wt. %: 80.0 wt. %.

[0310] In some embodiments, a weight % (wt. %) ratio ofor any combination thereof is from about 0.2 wt. %: 99.8 wt. %, from about 0.3 wt. %: 99.7 wt. %, from about 0.4 wt. %: 99.6 wt. %, from about 0.5 wt. %: 99.5 wt. %, from about 0.6 wt. %: 99.4 wt. %, from about 0.7 wt. %: 99.3 wt. %, from about 0.8 wt. %: 99.2 wt. %, from about 0.9 wt. %: 99.1 wt. %, from about 1.0 wt. %: 99.0 wt. %, from about 1.1 wt. %: 98.9 wt. %, from about 1.2 wt. %: 98.8 wt. %, from about 1.3 wt. %: 98.7 wt. %, from about 1.4 wt. %: 98.6 wt. %, from about 1.5 wt. %: 98.5 wt. %, from about 1.6 wt. %: 98.4 wt. %, from about 1.7 wt. %: 98.3 wt. %, from about 1.8 wt. %: 98.2 wt. %, from about 1.9 wt. %: 98.1 wt. %, from about 2.0 wt. %: 98.0 wt. %, from about 3.0 wt. %: 97.0 wt. %, from about 4.0 wt. %: 96.0 wt. %, from about 5.0 wt. %: 95.0 wt. %, from about 6.0 wt. %: 94.0 wt. %, from about 7.0 wt. %: 93.0 wt. %, from about 8.0 wt. %: 92.0 wt. %, from about 9.0 wt. %: 91.0 wt. %, from about 10 wt. %: 90 wt. %, from about 11 wt. %: 89 wt. %, from about 12 wt. %: 88 wt. %, from about 13 wt. %: 87 wt. %, from about 14 wt. %: 86 wt. %, from about 15 wt. %: 85 wt. %, from about 16 wt. %: 84 wt. %, from about 17 wt. %: 83 wt. %, from about 18 wt. %: 82 wt. %, from about 19 wt. %: 81 wt. %, from about 20 wt. %: 80 wt. %, from about 21 wt. %: 79 wt. %, from about 22 wt. %: 78 wt. %, from about 23 wt. %: 77 wt. %, from about 24 wt. %: 76 wt. %, from about 25 wt. %: 75 wt. %, from about 26 wt. %: 74 wt. %, from about 27 wt. %: 73 wt. %, from about 28 wt. %: 72 wt. %, from about 29 wt. %: 71 wt. %, from about 30 wt. %: 70 wt. %, from about 35 wt. %: 65 wt. %, from about 40 wt. %: 60 wt. %, from about 45 wt. %: 55 wt. %, from about 50 wt. %: 50 wt. %, from about 55 wt. %: 45 wt. %, from about 60 wt. %: 40 wt. %, from about 65 wt. %: 35 wt. %, from about 70 wt. %: 30 wt. %, from about 75 wt. %: 25 wt. %, from about 80 wt. %: 20 wt. %, from about 85 wt. %: 15 wt. %, from about 90 wt. %: 10 wt. %, or from about 95 wt. %: 5 wt. %.

[0311] In some embodiments, a weight % (wt. %) ratioWSGR Docket No.: 56017-735.601 or any combination thereof is to about 20.0 wt. %: 80.0 wt. %. In some embodiments, a weight %(wt. %) ratioany combination thereof is to about0.2 wt. %: 99.8 wt. %, to about 0.3 wt. %: 99.7 wt. %, to about 0.4 wt. %: 99.6 wt. %, to about 0.5 wt. %: 99.5 wt. %, to about 0.6 wt. %: 99.4 wt. %, to about 0.7 wt. %: 99.3 wt. %, to about 0.8 wt. %: 99.2 wt. %, to about 0.9 wt. %: 99.1 wt. %, to about 1.0 wt. %: 99.0 wt. %, to about 1.1 wt. %: 98.9 wt. %, to about 1.2 wt. %: 98.8 wt. %, to about 1.3 wt. %: 98.7 wt. %, to about 1.4 wt. %: 98.6 wt. %, to about 1.5 wt. %: 98.5 wt. %, to about 1.6 wt. %: 98.4 wt. %, to about 1.7 wt. %: 98.3 wt. %, to about 1.8 wt. %: 98.2 wt. %, to about 1.9 wt. %: 98.1 wt. %, to about 2.0 wt. %: 98.0 wt. %, to about 3.0 wt. %: 97.0 wt. %, to about 4.0 wt. %: 96.0 wt. %, to about 5.0 wt. %: 95.0 wt. %, to about 6.0 wt. %: 94.0 wt. %, to about 7.0 wt. %: 93.0 wt. %, to about 8.0 wt. %: 92.0 wt. %, to about 9.0 wt. %: 91.0 wt. %, to about 10 wt. %: 90 wt. %, to about 11 wt. %: 89 wt. %, to about 12 wt. %: 88 wt. %, to about 13 wt. %: 87 wt. %, to about 14 wt. %: 86 wt. %, to about 15 wt. %: 85 wt. %, to about 16 wt. %: 84 wt. %, to about 17 wt. %: 83 wt. %, to about 18 wt. %: 82 wt. %, to about 19 wt. %: 81 wt. %, to about 20 wt. %: 80 wt. %, to about 21 wt. %: 79 wt. %, to about 22 wt. %: 78 wt. %, to about 23 wt. %: 77 wt. %, to about 24 wt. %: 76 wt. %, to about 25 wt. %: 75 wt. %, to about 26 wt. %: 74 wt. %, to about 27 wt. %: 73 wt. %, to about 28 wt. %: 72 wt. %, to about 29 wt. %: 71 wt. %, to about 30 wt. %: 70 wt. %, to about 35 wt. %: 65 wt. %, to about 40 wt. %: 60 wt. %, to about 45 wt. %: 55 wt. %, to about 50 wt. %: 50 wt. %, to about 55 wt. %: 45 wt. %, to about 60 wt. %: 40 wt. %, to about 65 wt. %: 35 wt. %, to about 70 wt. %: 30 wt. %, to about 75 wt. %: 25 wt. %, to about 80 wt. %: 20 wt. %, to about 85 wt. %: 15 wt. %, to about 90 wt. %: 10 wt. %, or to about 95 wt. %: 5 wt. %.

[0312] In some embodiments, a weight % (wt. %) ratioor any combination thereof is from about 0.2 wt. %: 99.8 wt. % to about 95 wt. %: 5 wt. % , from about 0.3 wt. %: 99.7 wt. % to about 95 wt. %: 5 wt. %, from about 0.4 wt. %: 99.6 wt. % to about 95 wt. %: 5 wt. %, from about 0.5 wt. %: 99.5 wt. % to about 95 wt. %: 5 wt. %, from about 0.6 wt. %: 99.4 wt. % to about 95 wt. %: 5 wt. %, from about 0.7 wt. %: 99.3 wt. % to about 95 wt. %: 5 wt. %, from about 0.8 wt. %: 99.2 wt. % to about 95 wt. %: 5 wt. %, from about 0.9 wt. %: 99.1 wt. % to about 95 wt. %: 5 wt. %, from about 1.0 wt. %: 99.0 wt. % to about 95 wt. %: 5 wt.WSGR Docket No.: 56017-735.601 %, from about 1.1 wt. %: 98.9 wt. % to about 95 wt. %: 5 wt. %, from about 1.2 wt. %: 98.8 wt. % to about 95 wt. %: 5 wt. %, from about 1.3 wt. %: 98.7 wt. % to about 95 wt. %: 5 wt. %, from about 1.4 wt. %: 98.6 wt. % to about 95 wt. %: 5 wt. %, from about 1.5 wt. %: 98.5 wt. % to about 95 wt. %: 5 wt. %, from about 1.6 wt. %: 98.4 wt. % to about 95 wt. %: 5 wt. %, from about 1.7 wt. %: 98.3 wt. % to about 95 wt. %: 5 wt. %, from about 1.8 wt. %: 98.2 wt. % to about 95 wt. %: 5 wt. %, from about 1.9 wt. %: 98.1 wt. % to about 95 wt. %: 5 wt. %, from about 2.0 wt. %: 98.0 wt. % to about 95 wt. %: 5 wt. %, from about 3.0 wt. %: 97.0 wt. % to about 95 wt. %: 5 wt. %, from about 4.0 wt. %: 96.0 wt. % to about 95 wt. %: 5 wt. %, from about 5.0 wt. %: 95.0 wt. % to about 95 wt. %: 5 wt. %, from about 6.0 wt. %: 94.0 wt. % to about 95 wt. %: 5 wt. %, from about 7.0 wt. %: 93.0 wt. % to about 95 wt. %: 5 wt. %, from about 8.0 wt. %: 92.0 wt. % to about 95 wt. %: 5 wt. %, from about 9.0 wt. %: 91.0 wt. % to about 95 wt. %: 5 wt. %, from about 10 wt. %: 90 wt. % to about 95 wt. %: 5 wt. %, from about 11 wt. %: 89 wt. % to about 95 wt. %: 5 wt. %, from about 12 wt. %: 88 wt. % to about 95 wt. %: 5 wt. %, from about 13 wt. %: 87 wt. % to about 95 wt. %: 5 wt. %, from about 14 wt. %: 86 wt. % to about 95 wt. %: 5 wt. %, from about 15 wt. %: 85 wt. % to about 95 wt. %: 5 wt. %, from about 16 wt. %: 84 wt. % to about 95 wt. %: 5 wt. %, from about 17 wt. %: 83 wt. % to about 95 wt. %: 5 wt. %, from about 18 wt. %: 82 wt. % to about 95 wt. %: 5 wt. %, from about 19 wt. %: 81 wt. % to about 95 wt. %: 5 wt. %, from about 20 wt. %: 80 wt. % to about 95 wt. %: 5 wt. %, from about 21 wt. %: 79 wt. % to about 95 wt. %: 5 wt. %, from about 22 wt. %: 78 wt. % to about 95 wt. %: 5 wt. %, from about 23 wt. %: 77 wt. % to about 95 wt. %: 5 wt. %, from about 24 wt. %: 76 wt. % to about 95 wt. %: 5 wt. %, from about 25 wt. %: 75 wt. % to about 95 wt. %: 5 wt. %, from about 26 wt. %: 74 wt. % to about 95 wt. %: 5 wt. %, from about 27 wt. %: 73 wt. % to about 95 wt. %: 5 wt. %, from about 28 wt. %: 72 wt. % to about 95 wt. %: 5 wt. %, from about 29 wt. %: 71 wt. % to about 95 wt. %: 5 wt. %, from about 30 wt. %: 70 wt. % to about 95 wt. %: 5 wt. %, from about 35 wt. %: 65 wt. % to about 95 wt. %: 5 wt. %, from about 40 wt. %: 60 wt. % to about 95 wt. %: 5 wt. %, from about 45 wt. %: 55 wt. % to about 95 wt. %: 5 wt. %, from about 50 wt. %: 50 wt. % to about 95 wt. %: 5 wt. %, from about 55 wt. %: 45 wt. % to about 95 wt. %: 5 wt. %, from about 60 wt. %: 40 wt. % to about 95 wt. %: 5 wt. %, from about 65 wt. %: 35 wt. % to about 95 wt. %: 5 wt. %, from about 70 wt. %: 30 wt. % to about 95 wt. %: 5 wt. %, from about 75 wt. %: 25 wt. % to about 95 wt. %: 5 wt. %, from about 80 wt. %: 20 wt. % to about 95 wt. %: 5 wt. %, from about 85 wt. %: 15 wt. % to about 95 wt. %: 5 wt. %, or from about 90 wt. %: 10 wt. % to about 95 wt. %: 5 wt. %.WSGR Docket No.: 56017-735.601

[0313] In some embodiments, a weight % (wt. %) ratioor any combination thereof is from about 0.1 wt. %: 99.9 wt. % to about 0.2 wt. %: 99.8 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.3 wt. %: 99.7 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.4 wt. %: 99.6 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.5 wt. %: 99.5 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.6 wt. %: 99.4 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.7 wt. %: 99.3 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.8 wt. %: 99.2 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 0.9 wt. %: 99.1 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.0 wt. %: 99.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.1 wt. %: 98.9 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.2 wt. %: 98.8 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.3 wt. %: 98.7 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.4 wt. %: 98.6 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.5 wt. %: 98.5 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.6 wt. %: 98.4 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.7 wt. %: 98.3 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.8 wt. %: 98.2 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 1.9 wt. %: 98.1 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 2.0 wt. %: 98.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 3.0 wt. %: 97.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 4.0 wt. %: 96.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 5.0 wt. %: 95.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 6.0 wt. %: 94.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 7.0 wt. %: 93.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 8.0 wt. %: 92.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 9.0 wt. %: 91.0 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 10 wt. %: 90 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 11 wt. %: 89 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 12 wt. %: 88 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 13 wt. %: 87 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 14 wt. %: 86 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 15 wt. %: 85 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 16 wt. %: 84 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 17 wt. %: 83 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 18 wt. %: 82 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 19 wt. %: 81 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 20 wt. %: 80 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 21 wt. %: 79 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 22 wt. %: 78 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 23 wt. %: 77 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 24 wt. %: 76 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 25 wt. %: 75 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 26 wt. %: 74 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 27 wt. %: 73 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 28 wt. %: 72 wt. %, from about 0.1 wt. %: 99.9 wt. % toWSGR Docket No.: 56017-735.601 about 29 wt. %: 71 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 30 wt. %: 70 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 35 wt. %: 65 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 40 wt. %: 60 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 45 wt. %: 55 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 50 wt. %: 50 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 55 wt. %: 45 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 60 wt. %: 40 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 65 wt. %: 35 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 70 wt. %: 30 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 75 wt. %: 25 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 80 wt. %: 20 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 85 wt. %: 15 wt. %, from about 0.1 wt. %: 99.9 wt. % to about 90 wt. %: 10 wt. %, or from about 0.1 wt. %: 99.9 wt. % to about 95 wt. %: 5 wt. %.

[0314] In some embodiments, a weight % (wt. %) ratio ofor any combination thereof is from about 0.1 wt. %: 99.9 wt. % to about 95 wt. %: 5 wt. %, from about 0.2 wt. %: 99.8 wt. % to about 90 wt. %: 10 wt. %, from about 0.3 wt. %: 99.7 wt. % to about 85 wt. %: 15 wt. %, from about 0.4 wt. %: 99.6 wt. % to about 80 wt. %: 20 wt. %, from about 0.5 wt. %: 99.5 wt. % to about 75 wt. %: 25 wt. %, from about 0.6 wt. %: 99.4 wt. % to about 70 wt. %: 30 wt. %, from about 0.7 wt. %: 99.3 wt. % to about 65 wt. %: 35 wt. %, from about 0.8 wt. %: 99.2 wt. % to about 60 wt. %: 40 wt. %, from about 0.9 wt. %: 99.1 wt. % to about 55 wt. %: 45 wt. %, from about 1.0 wt. %: 99.0 wt. % to about 50 wt. %: 50 wt. %, from about 1.1 wt. %: 98.9 wt. % to about 45 wt. %: 55 wt. %, from about 1.2 wt. %: 98.8 wt. % to about 40 wt. %: 60 wt. %, from about 1.3 wt. %: 98.7 wt. % to about 35 wt. %: 65 wt. %, from about 1.4 wt. %: 98.6 wt. % to about 30 wt. %: 70 wt. %, from about 1.5 wt. %: 98.5 wt. % to about 29 wt. %: 71 wt. %, from about 1.6 wt. %: 98.4 wt. % to about 28 wt. %: 72 wt. %, from about 1.7 wt. %: 98.3 wt. % to about 27 wt. %: 73 wt. %, from about 1.8 wt. %: 98.2 wt. % to about 26 wt. %: 74 wt. %, from about 1.9 wt. %: 98.1 wt. % to about 25 wt. %: 75 wt. %, from about 2.0 wt. %: 98.0 wt. % to about 24 wt. %: 76 wt. %, from about 3.0 wt. %: 97.0 wt. % to about 23 wt. %: 77 wt. %, from about 4.0 wt. %: 96.0 wt. % to about 22 wt. %: 78 wt. %, from about 5.0 wt. %: 95.0 wt. % to about 21 wt. %: 79 wt. %, from about 6.0 wt. %: 94.0 wt. % to about 20 wt. %: 80 wt. %, from about 7.0 wt. %: 93.0 wt. % to about 19 wt. %: 81 wt. %, from about 8.0 wt. %: 92.0 wt. % to about 18 wt. %: 82 wt. %, from about 9.0 wt. %: 91.0 wt. % to about 17 wt. %: 83 wt. %, from about 10 wt. %: 90 wt. % to about 16 wt. %: 84 wt. %, from about 11 wt. %: 89 wt. % to about 15 wt. %: 85 wt. %, or from about 12 wt. %: 88 wt. % to about 14 wt. %: 86 wt. %.WSGR Docket No.: 56017-735.601

[0315] In some embodiments, a weight % (wt. %) ratioor any combination thereof is about 0.1 wt. %: 99.9 wt. %, about 0.2 wt. %: 99.8 wt. %, about 0.3 wt. %: 99.7 wt. %, about 0.4 wt. %: 99.6 wt. %, about 0.5 wt. %: 99.5 wt. %, about 0.6 wt. %: 99.4 wt. %, about 0.7 wt. %: 99.3 wt. %, about 0.8 wt. %: 99.2 wt. %, about 0.9 wt. %: 99.1 wt. %, about 1.0 wt. %: 99.0 wt. %, about 1.1 wt. %: 98.9 wt. %, about 1.2 wt. %: 98.8 wt. %, about 1.3 wt. %: 98.7 wt. %, about 1.4 wt. %: 98.6 wt. %, about 1.5 wt. %: 98.5 wt. %, about 1.6 wt. %: 98.4 wt. %, about 1.7 wt. %: 98.3 wt. %, about 1.8 wt. %: 98.2 wt. %, about 1.9 wt. %: 98.1 wt. %, about 2.0 wt. %: 98.0 wt. %, about 3.0 wt. %: 97.0 wt. %, about 4.0 wt. %: 96.0 wt. %, about 5.0 wt. %: 95.0 wt. %, about 6.0 wt. %: 94.0 wt. %, about 7.0 wt. %: 93.0 wt. %, about 8.0 wt. %: 92.0 wt. %, about 9.0 wt. %: 91.0 wt. %, about 10 wt. %: 90 wt. %, about 11 wt. %: 89 wt. %, about 12 wt. %: 88 wt. %, about 13 wt. %: 87 wt. %, about 14 wt. %: 86 wt. %, about 15 wt. %: 85 wt. %, about 16 wt. %: 84 wt. %, about 17 wt. %: 83 wt. %, about 18 wt. %: 82 wt. %, about 19 wt. %: 81 wt. %, about 20 wt. %: 80 wt. %, about 21 wt. %: 79 wt. %, about 22 wt. %: 78 wt. %, about 23 wt. %: 77 wt. %, about 24 wt. %: 76 wt. %, about 25 wt. %: 75 wt. %, about 26 wt. %: 74 wt. %, about 27 wt. %: 73 wt. %, about 28 wt. %: 72 wt. %, about 29 wt. %: 71 wt. %, about 30 wt. %: 70 wt. %, about 35 wt. %: 65 wt. %, about 40 wt. %: 60 wt. %, about 45 wt. %: 55 wt. %, about 50 wt. %: 50 wt. %, about 55 wt. %: 45 wt. %, about 60 wt. %: 40 wt. %, about 65 wt. %: 35 wt. %, about 70 wt. %: 30 wt. %, about 75 wt. %: 25 wt. %, about 80 wt. %: 20 wt. %, about 85 wt. %: 15 wt. %, about 90 wt. %: 10 wt. %, or about 95 wt. %: 5 wt. %

[0316] In some embodiments, a molar ratio of : is from about 2:1 to about 10:1. In some embodiments, a molar ratio of :is from about 2:1 to about 7:1. In some embodiments, a molar ratio of :is from about 3:1 to about 7:1. In some embodiments, a molar ratio of : is from about 3:1 to about 7:1.

[0317] In some embodiments, a molar ratio of : is from about 1:1, from about 1:2, from about 1:3, from about 1:4, from about 1:5, from about 1:6, from about 1:7, from about 1:8, from about 1:9, from about 1:10, from about 1:11, from about 1:12, from about 1:13, from aboutWSGR Docket No.: 56017-735.601 1:14, from about 1:15, from about 1:16, from about 1:17, from about 1:18, from about 1:19, from about 1:20, from about 1:21, from about 1:22, from about 1:23, from about 1:24, from about 1:25, from about 1:26, from about 1:27, from about 1:28, from about 1:29, or from about 1:30, or between any two of these ratios.

[0318] In some embodiments, a molar ratio of : is from about 1:1, from about 2:1, from about 3:1, from about 4:1, from about 5:1, from about 6:1, from about 7:1, from about 8:1, from about 9:1, from about 10:1, from about 11:1, from about 12:1, from about 13:1, from about 14:1, from about 15:1, from about 16:1, from about 17:1, from about 18:1, from about 19:1, from about 20:1, from about 21:1, from about 22:1, from about 23:1, from about 24:1, from about 25:1, from about 26:1, from about 27:1, from about 28:1, from about 29:1, or from about 30:1, or between any two of these ratios.

[0319] In some embodiments, a molar ratio of : is to about 1:2, to about 1:3, to about 1:4, to about 1:5, to about 1:6, to about 1:7, to about 1:8, to about 1:9, to about 1:10, to about 1:11, to about 1:12, to about 1:13, to about 1:14, to about 1:15, to about 1:16, to about 1:17, to about 1:18, to about 1:19, to about 1:20, to about 1:21, to about 1:22, to about 1:23, to about 1:24, to about 1:25, to about 1:26, to about 1:27, to about 1:28, to about 1:29, or to about 1:30, or between any two of these ratios.

[0320] In some embodiments, a molar ratio of : is to about 1:1, to about 2:1, to about 3:1, to about 4:1, to about 5:1, to about 6:1, to about 7:1, to about 8:1, to about 9:1, to about 10:1, to about 11:1, to about 12:1, to about 13:1, to about 14:1, to about 15:1, to about 16:1, to about 17:1, to about 18:1, to about 19:1, to about 20:1, to about 21:1, to about 22:1, to about 23:1, to about 24:1, to about 25:1, to about 26:1, to about 27:1, to about 28:1, to about 29:1, or to about 30:1, or between any two of these ratios.

[0321] In some embodiments, a molar ratio of : is from about 1:1 to about 1:2, from about 1:1 to about 1:3, from about 1:1 to about 1:4, from about 1:1 to about 1:5, from about 1:1 to about 1:6, from about 1:1 to about 1:7, from about 1:1 to about 1:8, from about 1:1 to about 1:9, from about 1:1 to about 1:10, from about 1:1 to about 1:11, from about 1:1 to about 1:12, from about 1:1 to about 1:13, from about 1:1 to about 1:14, from about 1:1 to about 1:15, from about 1:1 to about 1:16, from about 1:1 to about 1:17, from about 1:1 to about 1:18, from about 1:1 to about 1:19, from about 1:1 to about 1:20, from about 1:1 to about 1:21, from about 1:1 toWSGR Docket No.: 56017-735.601 about 1:22, from about 1:1 to about 1:23, from about 1:1 to about 1:24, from about 1:1 to about 1:25, from about 1:1 to about 1:26, from about 1:1 to about 1:27, from about 1:1 to about 1:28, from about 1:1 to about 1:29, or from about 1:1 to about 1:30, or between any two of these ratios.

[0322] In some embodiments, a molar ratio of :is from about 1:1 to about 1:30, from about 1:2 to about 1:30, from about 1:3 to about 1:30, from about 1:4 to about 1:30, from about 1:5 to about 1:30, from about 1:6 to about 1:30, from about 1:7 to about 1:30, from about 1:8 to about 1:30, from about 1:9 to about 1:30, from about 1:10 to about 1:30, from about 1:11 to about 1:30, from about 1:12 to about 1:30, from about 1:13 to about 1:30, from about 1:14 to about 1:30, from about 1:15 to about 1:30, from about 1:16 to about 1:30, from about 1:17 to about 1:30, from about 1:18 to about 1:30, from about 1:19 to about 1:30, from about 1:20 to about 1:30, from about 1:21 to about 1:30, from about 1:22 to about 1:30, from about 1:23 to about 1:30, from about 1:24 to about 1:30, from about 1:25 to about 1:30, from about 1:26 to about 1:30, from about 1:27 to about 1:30, from about 1:28 to about 1:30, or from about 1:29 to about 1:30.

[0323] In some embodiments, a molar ratio of : is from about 1:1 to about 2:1, from about 1:1 to about 3:1, from about 1:1 to about 4:1, from about 1:1 to about 5:1, from about 1:1 to about 6:1, from about 1:1 to about 7:1, from about 1:1 to about 8:1, from about 1:1 to about 9:1, from about 1:1 to about 10:1, from about 1:1 to about 11:1, from about 1:1 to about 12:1, from about 1:1 to about 13:1, from about 1:1 to about 14:1, from about 1:1 to about 15:1, from about 1:1 to about 16:1, from about 1:1 to about 17:1, from about 1:1 to about 18:1, from about 1:1 to about 19:1, from about 1:1 to about 20:1, from about 1:1 to about 21:1, from about 1:1 to about 22:1, from about 1:1 to about 23:1, from about 1:1 to about 24:1, from about 1:1 to about 25:1, from about 1:1 to about 26:1, from about 1:1 to about 27:1, from about 1:1 to about 28:1, from about 1:1 to about 29:1, or from about 1:1 to about 30:1.

[0324] In some embodiments, a molar ratio of : is from about 1:1 to about 30:1, from about 2:1 to about 30:1, from about 3:1 to about 30:1, from about 4:1 to about 30:1, from about 5:1 to about 30:1, from about 6:1 to about 30:1, from about 7:1 to about 30:1, from about 8:1 to about 30:1, from about 9:1 to about 30:1, from about 10:1 to about 30:1, from about 11:1 to about 30:1, from about 12:1 to about 30:1, from about 13:1 to about 30:1, from about 14:1 to about 30:1, from about 15:1 to about 30:1, from about 16:1 to about 30:1, from about 17:1 to about 30:1, from about 18:1 to about 30:1, from about 19:1 to about 30:1, from about 20:1 to about 30:1, from about 21:1 to about 30:1, from about 22:1 to about 30:1, from about 23:1 to about 30:1, from about 24:1WSGR Docket No.: 56017-735.601 to about 30:1, from about 25:1 to about 30:1, from about 26:1 to about 30:1, from about 27:1 to about 30:1, from about 28:1 to about 30:1, or from about 29:1 to about 30:1.

[0325] In some embodiments, a molar ratio of : is from about 1:1 to about 10:1, from about 2:1 to about 10:1, from about 3:1 to about 10:1, from about 4:1 to about 10:1, from about 5:1 to about 10:1, from about 6:1 to about 10:1, from about 7:1 to about 10:1, from about 8:1 to about 10:1, or from about 9:1 to about 10:1. In some embodiments, a molar ratio of : is from about 1:1 to about 10:1, from about 1:1 to about 9:1, from about 1:1 to about 8:1, from about 1:1 to about 7:1, from about 1:1 to about 6:1, from about 1:1 to about 5:1, from about 1:1 to about 4:1, from about 1:1 to about 3:1, or from about 1:1 to about 2:1.

[0326] In some embodiments, a molar ratio of : is from about 1:1 to about 7:1, from about 2:1 to about 7:1, from about 3:1 to about 7:1, from about 4:1 to about 7:1, from about 5:1 to about 7:1, or from about 6:1 to about 7:1. In some embodiments, a molar ratio of : is from about 1:1 to about 7:1, from about 1:1 to about 6:1, from about 1:1 to about 5:1, from about 1:1 to about 4:1, from about 1:1 to about 3:1, or from about 1:1 to about 2:1.

[0327] In some embodiments, a molar ratio of : is about 1:1 , about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, about 1:10, about 1:11, about 1:12, about 1:13, about 1:14, about 1:15, about 1:16, about 1:17, about 1:18, about 1:19, about 1:20, about 1:21, about 1:22, about 1:23, about 1:24, about 1:25, about 1:26, about 1:27, about 1:28, about 1:29, or about 1:30, or between any two of these ratios.

[0328] In some embodiments, a molar ratio of : is about 1:1, about 2:1, about 3:1, about 4:1, about 5:1, about 6:1, about 7:1, about 8:1, about 9:1, about 10:1, about 11:1, about 12:1, about 13:1, about 14:1, about 15:1, about 16:1, about 17:1, about 18:1, about 19:1, about 20:1, about 21:1, about 22:1, about 23:1, about 24:1, about 25:1, about 26:1, about 27:1, about 28:1, about 29:1, or about 30:1, or between any two of these ratios.

[0329] In some embodiments, a molar ratioWSGR Docket No.: 56017-735.601 combination thereof is from about 2:1 to about 10:1. In some embodiments, a molar ratio of :or any combination thereof is from about 2:1 to about 7:1. Insome embodiments, a molar ratioor any combinationthereof is from about 3:1 to about 7:1. In some embodiments, a molar ratio of : ,, or any combination thereof is from about 4:1 to about 7:1. In someembodiments, a molar ratioany combination thereofis about 4:1.

[0330] In some embodiments, a molar ratioanycombination thereof is from about 1:1, from about 1:2, from about 1:3, from about 1:4, from about 1:5, from about 1:6, from about 1:7, from about 1:8, from about 1:9, from about 1:10, from about 1:11, from about 1:12, from about 1:13, from about 1:14, from about 1:15, from about 1:16, from about 1:17, from about 1:18, from about 1:19, from about 1:20, from about 1:21, from about 1:22, from about 1:23, from about 1:24, from about 1:25, from about 1:26, from about 1:27, from about 1:28, from about 1:29, or from about 1:30, or between any two of these ratios.WSGR Docket No.: 56017-735.601

[0331] In some embodiments, a molar ratiocombination thereof is from about 1:1, from about 2:1, from about 3:1, from about 4:1, from about 5:1, from about 6:1, from about 7:1, from about 8:1, from about 9:1, from about 10:1, from about 11:1, from about 12:1, from about 13:1, from about 14:1, from about 15:1, from about 16:1, from about 17:1, from about 18:1, from about 19:1, from about 20:1, from about 21:1, from about 22:1, from about 23:1, from about 24:1, from about 25:1, from about 26:1, from about 27:1, from about 28:1, or from about 29:1, from about 30:1, or between any two of these ratios.

[0332] In some embodiments, a molar ratiocombination thereof is to about 1:2, to about 1:3, to about 1:4, to about 1:5, to about 1:6, to about 1:7, to about 1:8, to about 1:9, to about 1:10, to about 1:11, to about 1:12, to about 1:13, to about 1:14, to about 1:15, to about 1:16, to about 1:17, to about 1:18, to about 1:19, to about 1:20, to about 1:21, to about 1:22, to about 1:23, to about 1:24, to about 1:25, to about 1:26, to about 1:27, to about 1:28, to about 1:29, or to about 1:30, or between any two of these ratios.

[0333] In some embodiments, a molar ratiocombination thereof is to about 1:1, to about 2:1, to about 3:1, to about 4:1, to about 5:1, to about 6:1, to about 7:1, to about 8:1, to about 9:1, to about 10:1, to about 11:1, to about 12:1, to about 13:1, to about 14:1, to about 15:1, to about 16:1, to about 17:1, to about 18:1, to about 19:1, to about 20:1, to about 21:1, to about 22:1, to about 23:1, to about 24:1, to about 25:1, to about 26:1, to about 27:1, to about 28:1, to about 29:1, or to about 30:1, or between any two of these ratios.

[0334] In some embodiments, a molar ratioanycombination thereof is from about 1:1 to about 1:2, from about 1:1 to about 1:3, from about 1:1 to about 1:4, from about 1:1 to about 1:5, from about 1:1 to about 1:6, from about 1:1 to about 1:7,WSGR Docket No.: 56017-735.601 from about 1:1 to about 1:8, from about 1:1 to about 1:9, from about 1:1 to about 1:10, from about 1:1 to about 1:11, from about 1:1 to about 1:12, from about 1:1 to about 1:13, from about 1:1 to about 1:14, from about 1:1 to about 1:15, from about 1:1 to about 1:16, from about 1:1 to about 1:17, from about 1:1 to about 1:18, from about 1:1 to about 1:19, from about 1:1 to about 1:20, from about 1:1 to about 1:21, from about 1:1 to about 1:22, from about 1:1 to about 1:23, from about 1:1 to about 1:24, from about 1:1 to about 1:25, from about 1:1 to about 1:26, from about 1:1 to about 1:27, from about 1:1 to about 1:28, from about 1:1 to about 1:29, or from about 1:1 to about 1:30.

[0335] In some embodiments, a molar ratioanycombination thereof is from about 1:1 to about 1:30, from about 1:2 to about 1:30, from about 1:3 to about 1:30, from about 1:4 to about 1:30, from about 1:5 to about 1:30, from about 1:6 to about 1:30, from about 1:7 to about 1:30, from about 1:8 to about 1:30, from about 1:9 to about 1:30, from about 1:10 to about 1:30, from about 1:11 to about 1:30, from about 1:12 to about 1:30, from about 1:13 to about 1:30, from about 1:14 to about 1:30, from about 1:15 to about 1:30, from about 1:16 to about 1:30, from about 1:17 to about 1:30, from about 1:18 to about 1:30, from about 1:19 to about 1:30, from about 1:20 to about 1:30, from about 1:21 to about 1:30, from about 1:22 to about 1:30, from about 1:23 to about 1:30, from about 1:24 to about 1:30, from about 1:25 to about 1:30, from about 1:26 to about 1:30, from about 1:27 to about 1:30, from about 1:28 to about 1:30, or from about 1:29 to about 1:30.

[0336] In some embodiments, a molar ratio ofanycombination thereof is from about 1:1 to about 2:1, from about 1:1 to about 3:1, from about 1:1 to about 4:1, from about 1:1 to about 5:1, from about 1:1 to about 6:1, from about 1:1 to about 7:1, from about 1:1 to about 8:1, from about 1:1 to about 9:1, from about 1:1 to about 10:1, from about 1:1 to about 11:1, from about 1:1 to about 12:1, from about 1:1 to about 13:1, from about 1:1 to about 14:1, from about 1:1 to about 15:1, from about 1:1 to about 16:1, from about 1:1 to about 17:1, from about 1:1 to about 18:1, from about 1:1 to about 19:1, from about 1:1 to about 20:1, from about 1:1 to about 21:1, from about 1:1 to about 22:1, from about 1:1 to about 23:1, from about 1:1 to about 24:1, from about 1:1 to about 25:1, from about 1:1 to about 26:1, from aboutWSGR Docket No.: 56017-735.601 1:1 to about 27:1, from about 1:1 to about 28:1, from about 1:1 to about 29:1, or from about 1:1 to about 30:1.

[0337] In some embodiments, a molar ratiocombination thereof is from about 1:1 to about 30:1, from about 2:1 to about 30:1, from about 3:1 to about 30:1, from about 4:1 to about 30:1, from about 5:1 to about 30:1, from about 6:1 to about 30:1, from about 7:1 to about 30:1, from about 8:1 to about 30:1, from about 9:1 to about 30:1, from about 10:1 to about 30:1, from about 11:1 to about 30:1, from about 12:1 to about 30:1, from about 13:1 to about 30:1, from about 14:1 to about 30:1, from about 15:1 to about 30:1, from about 16:1 to about 30:1, from about 17:1 to about 30:1, from about 18:1 to about 30:1, from about 19:1 to about 30:1, from about 20:1 to about 30:1, from about 21:1 to about 30:1, from about 22:1 to about 30:1, from about 23:1 to about 30:1, from about 24:1 to about 30:1, from about 25:1 to about 30:1, from about 26:1 to about 30:1, from about 27:1 to about 30:1, from about 28:1 to about 30:1, or from about 29:1 to about 30:1.

[0338] In some embodiments, a molar ratio ofanycombination thereof is from about 1:1 to about 10:1, from about 2:1 to about 10:1, from about 3:1 to about 10:1, from about 4:1 to about 10:1, from about 5:1 to about 10:1, from about 6:1 to about 10:1, from about 7:1 to about 10:1, from about 8:1 to about 10:1, or from about 9:1 to about 10:1.

[0339] In some embodiments, a molar ratiocombination thereof is from about 1:1 to about 10:1, from about 1:1 to about 9:1, from about 1:1 to about 8:1, from about 1:1 to about 7:1, from about 1:1 to about 6:1, from about 1:1 to about 5:1, from about 1:1 to about 4:1, from about 1:1 to about 3:1, or from about 1:1 to about 2:1.

[0340] In some embodiments, a molar ratioWSGR Docket No.: 56017-735.601 combination thereof is from about 1:1 to about 7:1, from about 2:1 to about 7:1, from about 3:1 to about 7:1, from about 4:1 to about 7:1, from about 5:1 to about 7:1, or from about 6:1 to about7:1. In some embodiments, a molar ratio ofor anycombination thereof is from about 1:1 to about 7:1, from about 1:1 to about 6:1, from about 1:1 to about 5:1, from about 1:1 to about 4:1, from about 1:1 to about 3:1, or from about 1:1 to about 2:1.

[0341] In some embodiments, a molar ratiocombination thereof is about 1:1 , about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, about 1:10, about 1:11, about 1:12, about 1:13, about 1:14, about 1:15, about 1:16, about 1:17, about 1:18, about 1:19, about 1:20, about 1:21, about 1:22, about 1:23, about 1:24, about 1:25, about 1:26, about 1:27, about 1:28, about 1:29, or about 1:30, or between any two of these ratios.

[0342] In some embodiments, a molar ratiocombination thereof is about 1:1, about 2:1, about 3:1, about 4:1, about 5:1, about 6:1, about 7:1, about 8:1, about 9:1, about 10:1, about 11:1, about 12:1, about 13:1, about 14:1, about 15:1, about 16:1, about 17:1, about 18:1, about 19:1, about 20:1, about 21:1, about 22:1, about 23:1, about 24:1, about 25:1, about 26:1, about 27:1, about 28:1, about 29:1, or about 30:1, or between any two of these ratios. Weight % Ratios of Any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii):Counterion

[0343] In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.1 wt. % to 50.0 wt. % counterion relative to 99.9 wt. % to 50.0 wt. % any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compoundsWSGR Docket No.: 56017-735.601 as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.1 wt. % to 0.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.5 wt. % to 1.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.0 wt. % to 1.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.5 wt. % to 2.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.0 wt. % to 2.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.5 wt. % to 3.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.0 wt. % to 3.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.5 wt. % to 4.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.0 wt. % to 4.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.5 wt. % to 5.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.0 wt. % to 5.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.5 wt. % to 6.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptidesWSGR Docket No.: 56017-735.601 (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.0 wt. % to 7.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.5 wt. % to 7.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.0 wt. % to 7.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.5 wt. % to 8.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 8.0 wt. % to 8.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 8.5 wt. % to 9.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 9.0 wt. % to 9.5 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 9.5 wt. % to 10.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 10.0 wt. % to 15.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 15.0 wt. % to 20.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 20.0 wt. % to 30.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 30.0 wt. % to 40.0 wt. % salt. In some embodiments, the compounds as provided herein, e.g., the salt forms of any one of the peptides (i), (ii), (iii), (iv),WSGR Docket No.: 56017-735.601 (v), (vi) or (vii) are formulated in wt. % ratios of a counterion to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 40.0 wt. % to 50.0 wt. % salt. Exemplary Pharmaceutically Acceptable Salt Forms of Any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii)

[0344] In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises an aluminum salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises a sodium salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises a lithium salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises a potassium salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises a calcium salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises a magnesium salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises a zinc salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises an ammonium (i.e., NH4+) salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein,WSGR Docket No.: 56017-735.601 e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises an NMe4+salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises an N(C1–4alkyl)4+salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof, comprises an amine cation salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof.

[0345] In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) comprises an aluminum salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) formulated in a wt. % ratio of from 0.1 wt. % to 50.0 wt. % aluminum cation relative to 99.9 wt. % to 50.0 wt. % any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.1 wt. % to 0.5 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.5 wt. % to 1.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.0 wt. % to 1.5 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.5 wt. % to 2.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.0 wt. % to 2.5 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.5 wt. % to 3.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.0 wt. % to 3.5 wt. %WSGR Docket No.: 56017-735.601 aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.5 wt. % to 4.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.0 wt. % to 4.5 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.5 wt. % to 5.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.0 wt. % to 5.5 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.5 wt. % to 6.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.0 wt. % to 7.5 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.5 wt. % to 7.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.0 wt. % to 7.5 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.5 wt. % to 8.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 8.0 wt. % to 8.5 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 8.5 wt. % to 9.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 9.0 wt. % to 9.5 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of theWSGR Docket No.: 56017-735.601 peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 9.5 wt. % to 10.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 10.0 wt. % to 15.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 15.0 wt. % to 20.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 20.0 wt. % to 30.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 30.0 wt. % to 40.0 wt. % aluminum salt. In some embodiments, certain aluminum salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of aluminum salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 40.0 wt. % to 50.0 wt. % aluminum salt.

[0346] In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) comprises a sodium salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) formulated in a wt. % ratio of from 0.1 wt. % to 50.0 wt. % sodium cation relative to 99.9 wt. % to 50.0 wt. % any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.1 wt. % to 0.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.5 wt. % to 1.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.0 wt. % to 1.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.5 wt. % to 2.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.0 wt. % to 2.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptidesWSGR Docket No.: 56017-735.601 (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.5 wt. % to 3.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.0 wt. % to 3.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.5 wt. % to 4.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.0 wt. % to 4.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.5 wt. % to 5.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.0 wt. % to 5.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.5 wt. % to 6.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.0 wt. % to 7.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.5 wt. % to 7.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.0 wt. % to 7.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.5 wt. % to 8.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 8.0 wt. % to 8.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 8.5 wt. % to 9.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) orWSGR Docket No.: 56017-735.601 (vii) from 9.0 wt. % to 9.5 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 9.5 wt. % to 10.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 10.0 wt. % to 15.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 15.0 wt. % to 20.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 20.0 wt. % to 30.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 30.0 wt. % to 40.0 wt. % sodium salt. In some embodiments, certain sodium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of sodium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 40.0 wt. % to 50.0 wt. % sodium salt.

[0347] In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) comprises a lithium salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) formulated in a wt. % ratio of from 0.1 wt. % to 50.0 wt. % lithium cation relative to 99.9 wt. % to 50.0 wt. % any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.1 wt. % to 0.5 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.5 wt. % to 1.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.0 wt. % to 1.5 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.5 wt. % to 2.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.0 wt. % to 2.5 wt. %WSGR Docket No.: 56017-735.601 lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.5 wt. % to 3.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.0 wt. % to 3.5 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.5 wt. % to 4.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.0 wt. % to 4.5 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.5 wt. % to 5.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.0 wt. % to 5.5 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.5 wt. % to 6.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.0 wt. % to 7.5 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.5 wt. % to 7.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.0 wt. % to 7.5 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.5 wt. % to 8.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 8.0 wt. % to 8.5 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 8.5 wt. % to 9.0 wt. % lithium salt. In some embodiments,WSGR Docket No.: 56017-735.601 certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 9.0 wt. % to 9.5 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 9.5 wt. % to 10.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 10.0 wt. % to 15.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 15.0 wt. % to 20.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 20.0 wt. % to 30.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 30.0 wt. % to 40.0 wt. % lithium salt. In some embodiments, certain lithium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of lithium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 40.0 wt. % to 50.0 wt. % lithium salt.

[0348] In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) comprises a potassium salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) formulated in a wt. % ratio of from 0.1 wt. % to 50.0 wt. % potassium cation relative to 99.9 wt. % to 50.0 wt. % any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.1 wt. % to 0.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.5 wt. % to 1.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.0 wt. % to 1.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 1.5 wt. % to 2.0 wt. % potassium salt. In someWSGR Docket No.: 56017-735.601 embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.0 wt. % to 2.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 2.5 wt. % to 3.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.0 wt. % to 3.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 3.5 wt. % to 4.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.0 wt. % to 4.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 4.5 wt. % to 5.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.0 wt. % to 5.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 5.5 wt. % to 6.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.0 wt. % to 7.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 6.5 wt. % to 7.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.0 wt. % to 7.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 7.5 wt. % to 8.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii),WSGR Docket No.: 56017-735.601 (iv), (v), (vi) or (vii) from 8.0 wt. % to 8.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 8.5 wt. % to 9.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 9.0 wt. % to 9.5 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 9.5 wt. % to 10.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 10.0 wt. % to 15.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 15.0 wt. % to 20.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 20.0 wt. % to 30.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 30.0 wt. % to 40.0 wt. % potassium salt. In some embodiments, certain potassium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of potassium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 40.0 wt. % to 50.0 wt. % potassium salt.

[0349] In some embodiments, the compound as provided herein, e.g., the salt form of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) comprises a calcium salt of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) formulated in a wt. % ratio of from 0.1 wt. % to 50.0 wt. % calcium cation relative to 99.9 wt. % to 50.0 wt. % any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) or a pharmaceutically acceptable salt, ester or prodrug thereof. In some embodiments, certain calcium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of calcium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) from 0.1 wt. % to 0.5 wt. % calcium salt. In some embodiments, certain calcium salt forms of any one of the peptides (i), (ii), (iii), (iv), (v), (vi) or (vii) are formulated in wt. % ratios of calcium salt to any one of the peptides (i), (ii), (iii), (iv), (v), (vi)...

Claims

WSGR Docket No.: 56017-735.601 CLAIMS WHAT IS CLAIMED IS:

1. A compound comprising the structure of Formula I: Formula I, wherein: (a) is an anion of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19-WSGR Docket No.: 56017-735.601 carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein one or more carboxyl groups of the C18 diacid, C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) are in the form(b) is a cationic component.

2. The compound of claim 1, whereinis an anion of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H- Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy- 4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:,WSGR Docket No.: 56017-735.601 wherein one or more carboxyl groups of the C18 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

3. The compound of claim 1, wherein is an anion of H-Aib-EGTFTSDVSK([2-[2- [2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPR TETGSGSP-amide, and H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPR TETGSGSP-amide has the structure of:, wherein one or more carboxyl groups of the C18 diacid, ^-Glu linker, Glu residues,and / or Asp residues are in the form of .

4. The compound of claim 1, wherein is an anion of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxyWSGR Docket No.: 56017-735.601 ]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

5. The compound of claim 1, whereinis an anion of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4- [(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4- [(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:,WSGR Docket No.: 56017-735.601 wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of . The compound of claim 1, wherein is an anion of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of . The compound of claim 1, wherein is an anion of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl]amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-WSGR Docket No.: 56017-735.601 amide, and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2- [2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl]amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide has the structure of, wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

8. The compound of claim 1, whereinis an anion of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4- carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure ofWSGR Docket No.: 56017-735.601, wherein one or more carboxyl groups of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

9. The compound of any one of claims 1 to 8, wherein the compound has a ratio of to of from about 1:1 to about 1:

12.

10. The compound of any one of claims 1 to 8, wherein the compound has a ratio of to selected from the group consisting of about 1:1, about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, about 1:10, about 1:11 and about 1:12, or of between any two of these ratios.

11. The compound of any one of claims 1 to 8, wherein the compound has a ratio of to selected from the group consisting of from about 1:1 to about 1:2, from about 1:2 to about 1:3, about 1:3 to about 1:4, about 1:4 to about 1:5, about 1:5 to about 1:6, about 1:6 to about 1:7, about 1:7 to about 1:8, about 1:8 to about 1:9, about 1:9 to about 1:10, about 1:10 to about 1:11, about 1:11 to about 1:

12.

12. The compound of any one of claims 1 to 8, wherein the compound has a ratio of to selected from the group consisting of about 1:0.1 to about 1:

1.

13. The compound of any one of claims 1 to 12, wherein is a cation of any one selected from the group consisting of a metal ion such as aluminum, sodium, lithium, potassium, magnesium, calcium, and zinc, ammonium (NH4+), a protonated or positively (+)WSGR Docket No.: 56017-735.601 charged ion from an aliphatic primary amine, secondary amine or tertiary amine such as 2-aminoethanol, tromethamine, dimethylamine, diethylamine, N-ethyl-glucamine, hydrabamine, trimethylamine, triethylamine, dicyclohexylamine, ethanolamine, diethanolamine, triethanolamine, dimethylethanolamine, (2,2′,2″-nitrilotris(ethanol)), 2- diethylaminoethanol, procaine or substituted procaine (e.g., chloroprocaine), meglumine, carnitine, ethylenediamine, choline, acetylcholine, aralkyl amine such as Ν,Ν- dibenzylethylenediamine, benzathine, benethamine; heterocyclic aromatic amine such as pyridine, pyrimidine, picoline, quinoline or isoquinoline, quaternary ammonium (e.g., NH4+) such as betaine, nontoxic quaternary ammonium (e.g., NMe4+, N+(C1–4alkyl)4,), tetramethylammonium, tetraethylammonium, benzyltrimethylammonium, benzyltriethylammonium, benzyltributylammonium, methyltrioctylammonium or tetrabutylammonium; 1H-imidazole, substituted-imidazole (e.g., N-alkyl imidazole, N- methyl imidazole), pyrrolidine, substituted pyrrolidine (e.g., 1-alkyl pyrrolidine, 1- methyl pyrrolidine, 1-(2-hydroxy-ethyl)-pyrrolidine), piperidine or substituted piperidine (e.g., 1-alkyl piperidine, 1-methyl piperidine), piperazine or substituted piperazine (e.g., 1-alkyl piperazine, 1-methyl piperazine, 1,4-dialkyl piperazine, 1,4-dimethyl piperazine), morpholine, substituted morpholine (e.g., N-substituted morpholine, N-methyl morpholine or 4-(2-hydroxyethyl)-morpholine), basic amino acid such as arginine, lysine, or histidine. aminoguanidine, guanidine derivatives and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate.

14. The compound of any one of claims 1 to 12, wherein is choline.

15. The compound of any one of claims 1 to 12, wherein has the structure of , wherein R8, R9, R10, and R11are each independently a substituted or unsubstituted group selected from a C1-6 alkyl group, a phenyl group, a cycloalkyl group, a 4-7 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, and a 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.WSGR Docket No.: 56017-735.601 16. The compound of any one of claims 1 to 12, wherein has the structure of , wherein: (i) R8, R9, R10, and R11are each independently substituted or unsubstituted C1-C6alkyl; (ii) R8, R9, and R10are each independently substituted or unsubstituted C1-C6 alkyl, and R11is C1-C6alkyl that is unsubstituted or substituted with one or more hydroxyl; (iii) R8, R9, R10, and R11are each independently substituted or unsubstituted C1-C4alkyl; (iv) R8, R9, and R10are substituted or unsubstituted C2alkyl, and R11is substituted or unsubstituted C1alkyl; (v) R8, R9, and R10are substituted or unsubstituted C4 alkyl, and R11is substituted or unsubstituted C1alkyl; (vi) one or more R8, R9, R10, and R11are substituted or unsubstituted C1alkyl; (vii) one or more R8, R9, R10, and R11are substituted or unsubstituted C2 alkyl; (viii) one or more R8, R9, R10, and R11are substituted or unsubstituted C3 alkyl; (ix) one or more R8, R9, R10, and R11are substituted or unsubstituted C4alkyl; (x) all of R8, R9, R10, and R11are substituted or unsubstituted C1 alkyl; (xi) all of R8, R9, R10, and R11are substituted or unsubstituted C2 alkyl; (xii) all of R8, R9, R10, and R11are substituted or unsubstituted C3alkyl; or (xiii) all of R8, R9, R10, and R11are substituted or unsubstituted C4alkyl.

17. The compound of any one of claims 1 to 12, wherein has the structure of:

18. The compound of any one of claims 1 to 12, wherein has the structure of.WSGR Docket No.: 56017-735.601 19. The compound of any one of claims 1 to 12, wherein the compound has the structure of Formula Ic:Formula Ic.

20. A composition comprising the compound of any one of claims 1 to 19, wherein the compound comprises additional such that the molar ratio of : of fromgreater than 1:12 (e.g., 12.01, 12.1 etc.) to about 1:1,000.

21. The composition of claim 20, wherein the compound comprises additional such thatthe molar ratio of : of greater than 1:12 (e.g., 1:12.01, 1:12.1 etc.) to about1:

500.

22. The composition of claim 20, wherein the compound comprises additional such that the molar ratio of : of greater than 1:12 (e.g., 1:12.01, 1:12.1 etc.) to about1:

100.

23. The composition of claim 20, wherein the compound comprises additional such that the molar ratio of : of greater than 1:12 (e.g., 1:12.01, 1:12.1 etc.) to about1:

50.

24. The composition of claim 20, wherein the compound comprises additional such that the molar ratio of : of greater than 1:12 (e.g., 1:12.01, 1:12.1 etc.) to about1:

20.

25. The compound of any one of claims 1 to 24, wherein the compound comprises a weight% (wt%) ratio of : of from about 0.1 wt%:99.9 wt% to about 99.9wt%:0.1 wt%.WSGR Docket No.: 56017-735.601 26. The compound of any one of claims 1 to 24, wherein the compound comprises a weight% (wt%) ratio of : of from about 0.1 wt%:99.9 wt% to about 80.0wt%:20.0 wt%.

27. The compound of any one of claims 1 to 24, wherein the compound comprises aweight% (wt%) ratio of : of from about 0.1 wt%:99.9 wt% to about 50.0wt%:50.0 wt%.

28. The compound of any one of claims 1 to 24, wherein the compound comprises aweight% (wt%) ratio of : of from about 0.1 wt%:99.9 wt% to about 20.0wt%:80.0 wt%.

29. The compound of any one of claims 1 to 24, wherein the compound comprises a weight% (wt%) ratio of : of from about 20.0 wt%:80.0 wt% to about 99.9wt%:0.1 wt%.

30. The compound of any one of claims 1 to 24, wherein the compound comprises aweight% (wt%) ratio of : of from about 50.0 wt%:50.0 wt% to about 99.9wt%:0.1 wt%.

31. The compound of any one of claims 1 to 24, wherein the compound comprises a weight% (wt%) ratio of : of from about 80.0 wt%:20.0 wt% to about 99.9wt%:0.1 wt%.

32. A compound comprising the structure of Formula IIa, Formula IIb, Formula IIc, or any combination thereof: Formula IIa,WSGR Docket No.: 56017-735.601 Formula IIb,Formula IIc, wherein: (a) is a cation of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19-WSGR Docket No.: 56017-735.601 carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein the N-terminal amino group of any one of (i), (ii), (iii), (iv), (v), (vi) or (vii) is in the form(b)is a cation of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyWSGR Docket No.: 56017-735.601 l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein one or more Arg residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) are in the form ofcation of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide;WSGR Docket No.: 56017-735.601 (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, wherein one or more His residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) are in the form of33. The compound of claim 32, wherein, , , or any combination thereof is a cation of H-Aib-WSGR Docket No.: 56017-735.601 EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H- Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy- 4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

34. The compound of claim 32, whereinany combination thereof is a cation of H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4- carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxWSGR Docket No.: 56017-735.601 y]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPR TETGSGSP-amide, and H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPR TETGSGSP-amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

35. The compound of claim 32, whereincombination thereof is a cation of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib-WSGR Docket No.: 56017-735.601 EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

36. The compound of claim 32, whereinany combination thereof is a cation of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4- [(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-WSGR Docket No.: 56017-735.601 [(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

37. The compound of claim 32, whereinany combination thereof is a cation of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2-WSGR Docket No.: 56017-735.601 [[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

38. The compound of claim 32, whereincombination thereof is a cation of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl]amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide, and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-WSGR Docket No.: 56017-735.601 [2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl]amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide has the structure of ,(1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

39. The compound of claim 32, whereincombination thereof is a cation of H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, andWSGR Docket No.: 56017-735.601 H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4- carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of, wherein: (1) the N-terminal amino group is in the form of ; (2) one or more Arg residues are in the form(3) one or more His residues are in the form of; or (4) any combination thereof.

40. The compound of any one of claims 32 to 39, wherein the compound has a ratio of ,of from about 1:1 to about 1:8.WSGR Docket No.: 56017-735.601 41. The compound of claim 40, wherein the compound has a ratio of ,,, or any combination thereof, to selected from the group consisting of about 1:1, about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, and about 1:

8.

42. The compound of claim 40, wherein the compound has a ratio of, ,, or any combination thereof, to selected from the group consisting of from about 1:1 to about 1:2, from about 1:2 to about 1:3, about 1:3 to about 1:4, about 1:4 to about 1:5, about 1:5 to about 1:6, about 1:6 to about 1:7, about 1:7 to about 1:

8.

43. The compound of any one of claims 32 to 39, wherein the compound has a ratio of ,selected from the group consisting of about 1:0.1 to about 1:

1.

44. The compound of any one of claims 32 to 43, wherein is any one selected from the group consisting of besylate, mesylate, tosylate, sulfonate, sulfate, methylsulfate, camsylate, isethionate, edisylate, 1-hydroxy-2-naphthoate, 2,2-dichloroacetate, 2- hydroxyethanesulfonate, 2-oxoglutarate, 4-acetamidobenzoate, 4-aminosalicylate, acetate, trifluoroacetate, adipate, ascorbate, aspartate, benzenesulfonate, benzoate, bromide, chloride, camphorate, camphor-10-sulfonate, caprate (decanoate), caproateWSGR Docket No.: 56017-735.601 (hexanoate), caprylate (octanoate), carbonate, cinnamate, citrate, cyclamate, dodecylsulfate, dodecylsulfurate, ethanesulfonate, ethane-1,2-disulfonate, ethanesulfonate, formate, fumarate, galactarate, gentisate, glucoheptonate, gluconate, glutantate, glucuronate, glutamate, glutarate, glycerophosphorate, glycine, glycolate, hippurate, hydrobromate, hydroiodide, hydrochlorate, isobutyrate, lactate, lactobionate, laurate, lysine, maleate, malate, malonate, mandelate, methanesulfonate , naphthalene- 1,5-disulfonate, naphthalene-2-sulfonate, nicotinate, nitrate, oleate, orotate, oxalate, palmitate, pamoate, phosphorate, proprionate, pyroglutamate, salicylate, sebacate, stearate, succinate, sulfurate, tannate, tartarate, thiocyanate, toluenesulfonate, undecylenate, α-lipoate, 12-hydroxystearate, 2-(4-isobutylphenyl)propionate, 2-(4,4- dimethyl-2-pentanyl)-5,7,7-trimethyloctanoate, 2-aminoethanesulfonate, 2- hexyldecanoate, 2-hydroxyhippurate, 3-(4-hydroxyphenyl)propionate, 3- methylcrotonate, 3,3-diphenylpropionate, 3,4-dihydroxbenzoate, ,5-dihydroxybenzoate, 4-acetamido-benzoate, 3,7-dimethyloctanoate, 4-hydroxybenzenesulfonate, 4- hydroxybenzoate, 4-methylhexanoate, 4-methyloctanoate, valerate salts including 4- methylvalerate, 5-norbornene-2-carboxylate, 8-[(2-hydroxybenzoyl)amino]octanoate, abietate, acetylcysteine, aconitate, arachidonate, behenate, caffeate, chenodeoxycholate, citronellate, crotonate, galactonate, deoxycholate, dihydrocaffeate, 2-phenylpropionate (hydratropate), tropate, eicosanedioate, eicosapentanoate (EPA), elaidate, ellagate, erucate, ethylenediaminetetraacetate (EDTA), geranate, heptanoate, hydrocinnamate (3- phenylpropionate), isovalerate, glutathione reduced, lactate, laurate, levulinate, linoleate, linolenate, lithocholate, mesaconate, nonanoate, oxalate, coumarate, palmitate, perillate, pimelate, 3–phenylpropionate, pivalate, propionate, pyruvate, ricinoleate, salicylate, 2- hydroxybenzoate, sinapinate (3,5-dimethoxy-4-hydroxycinnamate), sorbate, syringate, tiglate, 2-decenoate, 2-hexenoate, 2-octenoate, 3-octenoate, 7-octenoate, ferulate, undecanoate, valerate, vanillate, perchlorate, alginate, bisulfate, borate, butyrate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecylsulfate, glycerophosphate, hemisulfate, hydroiodide, lauryl sulfate, 2–naphthalenesulfonate, pectinate, persulfate, phosphate, tartrate, o-(4-hydroxybenzoyl)benzoate, 1,2,- ethanedisulfonate, chlorobenzenesulfonate, 4-methylbicyclo[2.2.2]oct-2-ene-carboxylate, 4.4’-methylenebis(3-hydroxy-2- ene-1-carboxylate), trimethylacetate, tertiary butylacetate, lauryl sulfurate, hydroxynaphthoate, muconate, αketoglutarate, p- toluenesulfonate, p-coumarate, and p-chlorobenzenesulfonate.WSGR Docket No.: 56017-735.601 45. The compound of any one of claims 32 to 43, wherein is 8-[(2- hydroxybenzoyl)amino]octanoate.

46. The compound of any one of claims 32 to 45, wherein the compound comprises one or more of: (a) a molar ratioabout 1:1;(b) a molar ratiofrom about 1:1 to about 1:5;(c) a molar ratiofrom about 1:1 to about 1:2; or(d) any combination thereof.

47. The compound of any one of claims 32 to 45, wherein the compound comprises one or more of: (a) a molar ratioabout 1:1;(b) a molar ratioabout 1:5;(c) a molar ratioabout 1:2; or(d) any combination thereof.

48. The compound of any one of claims 32 to 45, wherein the compound comprises one or more of: (a) a molar ratioabout 1:1;WSGR Docket No.: 56017-735.601 (b) a molar ratioabout 1:1;(c) a molar ratioabout 1:1; or(d) any combination thereof.

49. The compound of any one of claims 32 to 45, wherein the compound comprises: (a) a weight% (wt%) ratio of : of from about 0.1 wt%:99.9 wt% to about 99.9wt%:0.1 wt%; (b) a weight% (wt%) ratiofrom about 0.1 wt%:99.9 wt% to about99.9 wt%:0.1 wt%; (c) a weight% (wt%) ratiofrom about 0.1 wt%:99.9 wt% to about99.9 wt%:0.1 wt%; or (d) any combination thereof.

50. A compound comprising the structure of Formula III:Formula III, wherein: (a)is a covalent derivative of one or more carboxyl groups of any one compound selected from the group consisting of: (i) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(17-WSGR Docket No.: 56017-735.601 carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; (ii) H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amin o]ethoxy]ethoxy]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELS TAALGRLSAELHELATLPRTETGSGSP-amide; (iii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTE TGSGSP-amide, (iv) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2- [2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (v) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoy l]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexano yl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, (vi) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6- [[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, and (vii) H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino ]ethoxy]ethoxy]acetyl])- GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide, or a pharmaceutically acceptable salt thereof,WSGR Docket No.: 56017-735.601 wherein the covalent derivative of one or more carboxyl groups are of the C18 diacid, C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues of (i), (ii), (iii), (iv), (v), (vi) or (vii) and are in the form of; and (b) each R100is independently selected from an optionally substituted group consisting of C1-6aliphatic, (C1-22)alkyl, (C1-22)alkenyl, -C(O)R, -C(O)OR, -C(O)N(R)2, phenyl, 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur; and each occurrence of R is independently hydrogen or an optionally substituted group selected from C1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur.

51. The compound of claim 50, whereinis a covalent derivative of one or more carboxyl groups of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2- [[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:WSGR Docket No.: 56017-735.601, wherein the covalent derivative of one or more carboxyl groups are of the C18 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of.

52. The compound of claim 50, wherein is a covalent derivative of one or more carboxyl groups of H-Aib-EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPR TETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib- EGTFTSDVSK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethox y]acetyl])YLEEQAAREFIAWLVRGRGGGGGEASELSTAALGRLSAELHELATLPR TETGSGSP-amide has the structure of:WSGR Docket No.: 56017-735.601, wherein the covalent derivative of one or more carboxyl groups are of the C18 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of.

53. The compound of claim 50, wherein is a covalent derivative of one or more carboxyl groups of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2- [[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4- (19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:WSGR Docket No.: 56017-735.601, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of.

54. The compound of claim 50, whereinis a covalent derivative of one or more carboxyl groups of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2- [[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2- [2-[[2-[2-[2[[(4S)-4-carboxy-4-[[4-[(19 carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:,WSGR Docket No.: 56017-735.601 wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of.

55. The compound of claim 50, wherein is a covalent derivative of one or more carboxyl groups of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2- amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)- 2-amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-[[4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl]amino]butanoyl]amino]ethoxy ]ethoxy]acetyl]amino]ethoxy]ethoxy]acetyl]amino]hexanoyl])- GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of:, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .WSGR Docket No.: 56017-735.601 56. The compound of claim 50, whereinis a covalent derivative of one or more carboxyl groups of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2- amino-6-[[2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl]amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide or a pharmaceutically acceptable salt thereof, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([(2S)-2-amino-6-[[2-[2-[2-[[2-[2-[2- [[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl]amino]hexanoyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP- amide has the structure of, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^-Glu linker, Glu residues, and / or Asp residues are in the form of .

57. The compound of claim 50, wherein is a covalent derivative of one or more carboxyl groups of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2- [[2-[2-[2-[[(4S)-4-carboxy-4-(19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide or a pharmaceutically acceptable salt thereof, and H-Aib- EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2-[2-[2-[[(4S)-4-carboxy-4-WSGR Docket No.: 56017-735.601 (19- carboxynonadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]ethoxy ]acetyl])-GGGGSGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide has the structure of, wherein the covalent derivative of one or more carboxyl groups are of the C20 diacid, ^- Glu linker, Glu residues, and / or Asp residues are in the form of .

58. The compound of any one of claims 50 to 57, wherein the compound is of Formula IIIaor a pharmaceutically acceptable salt or salts thereof.

59. The compound of claim 58, wherein the compound of Formula IIIa is selected from the group consisting of:, , Formula IIIa-2 Formula IIIa-3,, Formula IIIa-4 Formula IIIa-5 Formula IIIa-6, , Formula IIIa-7 Formula IIIa-8 Formula IIIa-9WSGR Docket No.: 56017-735.601Formula IIIa-10 Formula IIIa-11 Formula IIIa,- or a pharmaceutically acceptable salt or salts thereof.

60. The compound of claim 58, wherein the compound of Formula IIIa has the structureFormula IIIa-1, or a pharmaceutically acceptable salt or salts thereof.

61. The compound of claim 58, wherein the compound has the structure of Formula IIIb:Formula IIIb, or a pharmaceutically acceptable salt or salts thereof.

62. The compound of claim 58, wherein the compound has the structure of Formula IIIb-1:Formula IIIb-1, or a pharmaceutically acceptable salt or salts thereof.

63. A pharmaceutical composition comprising the compound of any one of claims 1 to 62, and a pharmaceutically acceptable excipient.

64. The pharmaceutical composition of claim 63, further comprising one or more ionic liquids, wherein each of the one or more ionic liquids independently comprises an anion and a cation.

65. The pharmaceutical composition of claim 64, wherein each of the one or more ionic liquids independently comprise a cation selected from the group consisting of aminoguanidine, choline or choline derivative, carnitine, acetylcholine, ammonium, tetramethyl ammonium, tetraethyl ammonium, tetrabutyl ammonium, and guanidine derivatives.WSGR Docket No.: 56017-735.601 66. The pharmaceutical composition of claim 64, wherein each of the one or more ionic liquids independently comprise a cation selected from the group consisting of choline or a choline derivative, carnitine, or acetylcholine.

67. The pharmaceutical composition of claim 64, wherein each of the one or more ionic liquids independently comprise an anion of any one selected from the group consisting of (R)-α-lipoic acid, 12-hydroxystearic acid, 2-(4-isobutylphenyl)propionic acid, 2-(4,4- dimethyl-2-pentanyl)-5,7,7-trimethyloctanoic acid, 2-aminoethanesulfonic acid (taurine acid), 2-hexyldecanoic acid, 2-hydroxyhippuric acid, 3-(4-hydroxyphenyl)propionic acid, 3-methylcrotonic acid, 3,3-diphenylpropionic acid, 3,4-dihydroxbenzoic acid (protocatechuic acid), 3,7-dimethyloctanoic acid, 4-hydroxybenzenesulfonic acid, 4- hydroxybenzoic acid, 4-methylhexanoic acid, 4-methyloctanoic acid, 4-methylvaleric acid, 5-norbornene-2-carboxylic acid, 8-[(2-hydroxybenzoyl)amino]octanoic acid, abietic acid, acetic acid, acetylcysteine, aconitic acid, arachidonic acid, behenic acid, benzoic acid, caffeic acid, chenodeoxycholic acid, cinnamic acid, citric acid, citronellic acid, crotonic acid, D-(+)-galactonic acid, decanoic acid, deoxy-cholic acid, dihydrocaffeic acid, DL-2-phenylpropionic (hydratropic) acid, DL-tartaric acid, DL- tropic acid, eicosanedioic acid, eicosapentanoic acid (EPA), elaidic acid, ellagic acid, erucic acid, ethylenediaminetetraacetic acid (EDTA), formic acid, fumaric acid, geranic ac-id, glutaric acid, glycolic acid, heptanoic acid, hexanoic acid, hydrocinnamic acid (3- phenylpropionic acid), isobutyric acid, isovaleric acid, L-(+)-tartaric acid, L-ascorbic acid, L-aspartic acid, L-glutamic acid, L-glutathione reduced, lactic acid, lauric acid, levulinic acid, linoleic acid, linolenic acid, lithocholic acid, maleic acid, malic acid, malonic acid, mandelic acid, mesaconic acid, nicotinic acid, nonanoic acid, octanoic acid, oleic acid, oxalic acid, p-coumaric acid, p-toluenesulfonic acid, palmitic acid, perillic acid, phosphoric acid, pimelic acid, pivalic acid, propionic acid, pyroglutamic acid, pyruvic acid, ricinoleic acid, salicylic acid (2-hydroxybenzoic acid), sinapinic acid (3,5-dimethoxy-4-hydroxycinnamic acid), sorbic acid, stearic acid, succinic acid, syringic acid, tiglic acid, trans-2-decenoic acid, trans-2-hexenoic acid, trans-2-octenoic acid, trans-3-octenoic acid, trans-7-octenoic acid, trans-ferulic acid, undecanoic acid, valeric acid, vanillic acid, and αKetoglutaric acid.

68. The pharmaceutical composition of claim 64, wherein each of the one or more ionic liquids independently comprise an anion of any one selected from the group consisting of cinnamic acid, mandelic acid, citric acid, ricinoleic acid, linoleic acid, 8-[(2- hydroxybenzoyl)amino]octanoic acid, and tiglic acid.WSGR Docket No.: 56017-735.601 69. The pharmaceutical composition of claim 64, wherein the one or more ionic liquids comprise: (i) choline or a choline derivative-an anion of cinnamic acid, choline or a choline derivative-an anion of mandelic acid, choline or a choline derivative-an anion of citric acid, choline or a choline derivative-an anion of ricinoleic acid, choline or a choline derivative-an anion of linoleic acid, choline or a choline derivative-an anion of 8-[(2- hydroxybenzoyl)amino]octanoic acid, or choline or a choline derivative-an anion of tiglic acid; (ii) carnitine-an anion of cinnamic acid, carnitine-an anion of mandelic acid, carnitine-an anion of citric acid, carnitine-an anion of ricinoleic acid, carnitine-an anion of linoleic acid, carnitine-an anion of 8-[(2-hydroxybenzoyl)amino]octanoic acid, or carnitine-an anion of tiglic acid; (iii) acetylcholine-an anion of cinnamic acid, acetylcholine-an anion of mandelic acid, acetylcholine-an anion of citric acid, acetylcholine-an anion of ricinoleic acid, acetylcholine-an anion of linoleic acid, acetylcholine-an anion of 8-[(2- hydroxybenzoyl)amino]octanoic acid, or acetylcholine-an anion of tiglic acid; or (iv) any combination thereof.

70. The pharmaceutical composition of claim 64, wherein the one or more ionic liquids comprise a choline-an anion of cinnamic acid ionic liquid.

71. The pharmaceutical composition of claim 64, wherein the one or more ionic liquids comprise a choline-an anion of 8-[(2-hydroxybenzoyl)amino]octanoic acid ionic liquid.

72. The pharmaceutical composition of any one of claims 63 to 71, further comprising at least one permeation enhancer.

73. The pharmaceutical composition of claim 72, wherein the at least one permeation enhancer is selected from the group consisting of salcaprozate sodium (SNAC), sodium caprylate, sodium caprate, a bile salt, ethylenediaminetetraacetic acid (EDTA), ethylene glycol-bis-(2-aminoethylether)-N,N,N',N'-tetraacetic acid (EGTA), and 3-[N,N- Dimethyl(3-palmitoylaminopropyl)-ammonio]-propanesulfonate (PPS), and any combination thereof.

74. The pharmaceutical composition of claim 73, wherein the bile salt is selected from the group consisting of sodium deoxycholate, sodium chenodeoxycholate, sodium taurodeoxycholate, and a combination thereof.

75. The pharmaceutical composition of claim 72, wherein the at least one permeation enhancer comprises salcaprozate sodium (SNAC).WSGR Docket No.: 56017-735.601 76. The pharmaceutical composition of claim 63, wherein the pharmaceutical composition further comprises one or more ionic liquids and at least one permeation enhancer, and wherein the one or more ionic liquids comprise a choline-an anion of cinnamic acid ionic liquid, and the at least one permeation enhancer comprises salcaprozate sodium (SNAC).

77. The pharmaceutical composition of claim 63, wherein the pharmaceutical composition further comprises one or more ionic liquids and at least one permeation enhancer, and wherein the one or more ionic liquids comprise a choline-an anion of 8-[(2- hydroxybenzoyl)amino]octanoic acid ionic liquid, and the at least one permeation enhancer comprises salcaprozate sodium (SNAC).

78. The pharmaceutical composition of any one of claims 63 to 77, wherein the pharmaceutical composition is formulated for parenteral administration, oral administration, or implantable administration.

79. The pharmaceutical composition of claim 78, wherein the pharmaceutical composition is formulated for subcutaneous administration or intravenous administration.

80. A drug delivery device comprising the compound of any one of claims 1 to 62, or the pharmaceutical composition of any one of claims 63 to 79.

81. The drug delivery device of claim 80, wherein the drug delivery device is a syringe, a single-dose pen with an injection needle, or an autoinjector with an injection needle.

82. The drug delivery device of claim 80, wherein the drug delivery device is an implantable osmotic drug delivery device.

83. A kit comprising the compound of any one of claims 1 to 62, the pharmaceutical composition of any one of claims 63 to 79, or the drug delivery device of any one of claims 80 to 82.

84. The kit of claim 83, further comprising an instruction for use.

85. A method of treating a disease or disorder in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the compound of any one of claims 1 to 62, or the pharmaceutical composition of any one of claims 63 to 79, wherein the administering is effective to treat the disease or disorder in the subject.

86. The method of claim 85, wherein the compound or the pharmaceutical composition is administered to the subject using the drug delivery device of any one of claims 80 to 82.

87. The method of claim 85 or 86, wherein the disease or disorder is a metabolic disease or disorder, a cardiovascular disease or disorder, chronic kidney disease, or a neurological disease or disorder.

88. The method of any one of claims 85 to 87, wherein the disease or disorder is selected from the group consisting of type 1 diabetes, type 2 diabetes, pre-diabetes, metabolicWSGR Docket No.: 56017-735.601 syndrome, obesity, overweight, metabolic dysfunction–associated fatty liver disease (MAFLD), metabolic dysfunction-associated steatohepatitis (MASH), and nonalcoholic steatohepatitis (NASH).

89. The method of any one of claims 85 to 87, wherein the disease or disorder is selected from the group consisting of arrhythmia, coronary artery disease, heart failure, valve disease, aortic disease, congenital heart disease, heart attack, angina, cardiomyopathy, peripheral arterial disease, atherosclerosis, cardiac dysrhythmias, pericarditis, pulmonary hypertension, stroke, cerebrovascular disease, rheumatic heart disease, atrial fibrillation, Brugada syndrome, aortic stenosis, bradycardia, endocarditis, high cholesterol, and long QT syndrome.

90. The method of any one of claims 85 to 87, wherein the disease or disorder is Parkinson’s disease or Alzheimer disease.

91. The method of any one of claims 85 to 90, wherein the subject is human.

92. The method of any one of claims 85 to 90, wherein the compound or the pharmaceutical composition is administered to the subject via parenteral administration, oral administration, or implantable administration.

93. The method of any one of claims 85 to 90, wherein the compound or the pharmaceutical composition is administered to the subject via subcutaneous administration or intravenous administration.

94. A method of reducing weight in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the compound of any one of claims 1 to 62, or the pharmaceutical composition of any one of claims 63 to 79, wherein the administering is effective to reduce weight in the subject.

95. The method of claim 94, wherein the compound or the pharmaceutical composition is administered to the subject using the drug delivery device of any one of claims 80 to 82.

96. The method of claim 94 or 95, wherein the subject is human.

97. The method of any one of claims 94 to 96, wherein the subject has obesity or is overweight.

98. The method of any one of claims 94 to 96, wherein the compound or the pharmaceutical composition is administered to the subject via parenteral administration, oral administration, or implantable administration.

99. The method of any one of claims 94 to 96, wherein the compound or the pharmaceutical composition is administered to the subject via subcutaneous administration or intravenous administration.

100. A compound comprising the structure of Formula X:WSGR Docket No.: 56017-735.601 Formula X, wherein:anion; and (d) is a cation of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2-[2-[[2- [2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]et hoxy]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; wherein the compound has a : molar ratio of from about 1:1 to about 8:1.

101. The compound of claim 100, wherein is a cation of:.

102. The compound of claim 100 or 101, whereinis an anion selected from the group consisting of formate, acetate, and trifluoroacetate.

103. The compound of claim 102, whereinis formate.

104. The compound of claim 102, whereinis acetate.

105. The compound of claim 102, wherein is trifluoroacetate.

106. The compound of any one of claims 100 to 105, wherein the : molar ratio isfrom about 2:1 to about 8:1.WSGR Docket No.: 56017-735.601107. The compound of claim 100, wherein the : molar ratio is from about 3:1 toabout 8:1.

108. The compound of claim 100, wherein the : molar ratio is from about 4:1 toabout 8:1.

109. The compound of claim 100, wherein the : molar ratio is from about 5:1 toabout 8:1.

110. The compound of claim 100, wherein the : molar ratio is from about 6:1 toabout 8:1.

111. The compound of claim 100, wherein the : molar ratio is from about 7:1 toabout 8:1.

112. The compound of claim 100, wherein the : molar ratio is about 1:1.

113. The compound of claim 100, wherein the : molar ratio is about 2:1.

114. The compound of claim 100, wherein the : molar ratio is about 3:1.

115. The compound of claim 100, wherein the : molar ratio is about 4:1.

116. The compound of claim 100, wherein the : molar ratio is about 5:1.

117. The compound of claim 100, wherein the : molar ratio is about 6:1.

118. The compound of claim 100, wherein the : molar ratio is about 7:1.

119. The compound of claim 100, wherein the : molar ratio is about 8:1.

120. A compound comprising the structure of Formula XX:WSGR Docket No.: 56017-735.601 Formula XX, wherein: (c)is an anion of H-Aib-EGTFTSDVSSYLEEQAAREFIAWLVRGRK([2-[2- [2-[[2-[2-[2-[[(4S)-4-carboxy-4-(17- carboxyheptadecanoylamino)butanoyl]amino]ethoxy]ethoxy]acetyl]amino]ethoxy]et hoxy]acetyl])-GGGGEASELSTAALGRLSAELHELATLPRTETGSGSP-amide; and (d) is an anion; wherein the compound has a : molar ratio of from about 1:1 to about 1:12.

121. The compound of claim 100, wherein is an anion of:.

122. The compound of claim 120 or 121, wherein is a cation selected from the groupconsisting of choline and betaine.

123. The compound of claim 122, wherein is choline.

124. The compound of claim 122, wherein is betaine.

125. The compound of any one of claims 120 to 124, wherein the : molar ratio isfrom about 1:2 to about 1:

12.

126. The compound of claim 125, wherein the : molar ratio is from about 1:3 toabout 1:12.WSGR Docket No.: 56017-735.601127. The compound of claim 125, wherein the : molar ratio is from about 1:4 toabout 1:12.

128. The compound of claim 125, wherein the : molar ratio is from about 1:5 toabout 1:12.

129. The compound of claim 125, wherein the : molar ratio is from about 1:6 toabout 1:12.

130. The compound of claim 125, wherein the : molar ratio is from about 1:7 toabout 1:12.

131. The compound of claim 125, wherein the : molar ratio is from about 1:8 toabout 1:12.

132. The compound of claim 125, wherein the : molar ratio is from about 1:9 toabout 1:12.

133. The compound of claim 125, wherein the : molar ratio is from about 1:10 toabout 1:12.

134. The compound of claim 125, wherein the : molar ratio is from about 1:11 toabout 1:12.

135. The compound of claim 125, wherein the : molar ratio is about 1:1.

136. The compound of claim 125, wherein the : molar ratio is about 1:2.

137. The compound of claim 125, wherein the : molar ratio is about 1:3.

138. The compound of claim 125, wherein the : molar ratio is about 1:4.WSGR Docket No.: 56017-735.601139. The compound of claim 125, wherein themolar ratio is about 1:5.

140. The compound of claim 125, wherein the : molar ratio is about 1:6.The compound of claim 125, wherein themolar ratio is about 1:7.

142. The compound of claim 125, wherein the: molar ratio is about 1:8.The compound of claim 125, wherein the : molar ratio is about 1:9.

144. The compound of claim 125, wherein the: molar ratio is about 1:10.. The compound of claim 125, wherein the: molar ratio is about 1:11.

146. The compound of claim 125, wherein the: molar ratio is about 1:12.

Images