Combinations comprising NF-KB inhibitors and MCIM modulators

Abstract

The invention provides combination therapies comprising NF-kB inhibitor compounds and mitochondrial complex I modulator (MCIM) compounds, which find utility in the medical field of inflammatory and progressive disorders, for example in the treatment of arthritis, inflammatory bowel disease and multiple sclerosis.

Description

[0001] NF-KB inhibitor combination therapies

[0002] This application claims priority from GB2411554.5 filed 6 August 2024, the contents and elements of which are herein incorporated by reference for all purposes.

[0003] Field of the Invention

[0004] The present invention relates to combination therapies that can have reparative effects on a range of progressive and / or degenerative diseases. In particular instances, the combination therapies can be used for the treatment of autoimmune diseases such as arthritis, and in particular rheumatoid arthritis. In particular instances, the combination therapies comprise an NF-KB inhibitor, for example an interleukin-1 receptor associated kinase inhibitor (IRAKi) compound or an S1 P receptor modulator compound and a therapeutic agent which can act by binding mitochondrial Complex I. The therapeutic agent which can act by binding mitochondrial Complex I are referred to herein as Mitochondrial Complex I Modulator compounds (or MCIM compounds).

[0005] Background

[0006] Mitochondrial Complex I (also known as NADH:ubiquinone oxidoreductase, Type I NADH dehydrogenase, respiratory Complex I, or simply ‘Complex I’) is the first enzyme complex of the respiratory chain (Yoga et al, 2021 , which is hereby incorporated by reference in its entirety). Complex I is a very large protein complex comprising 45 subunits (Gutierrez-Fernandez, 2020) which is highly conserved in eukaryotes and prokaryotes. In eukaryotes, it couples the transfer of electrons from NADH to the coenzyme ubiquinone (Q) with the translocation of protons across the inner mitochondrial membrane, although the mechanism linking the spatially distinct proton translocation and electron transfer remains unknown (Gutierrez-Fernandez, 2020).

[0007] In humans, the most common form of ubiquinone is known as ‘Q10’ because it has ten isoprenyl subunits in its ‘tail’ region. Q10 is hydrophobic and it enters the Complex I enzyme from the mitochondrial inner membrane through a long binding channel (Bridges et al, 2020), which is often called the ‘Q tunnel’. The Q-tunnel is long and heterogenous in nature. Various compounds are known to bind within the Q tunnel, but there is no single consensus site for compound binding. For example, piericidin A is reported to bind within the Q-tunnel as a ‘short-form’ ubiquinone, with interactions at multiple residues from the top of the Q-tunnel to its midway point (Gutierrez- Fernandez, 2020; Bridges et al, 2020; Chung et al, 2021 , each of which is hereby incorporated by reference in its entirety). Aureothin and pyridaben, which are also quinone-like compounds, are also observed to bind at a similar site in T. thermophilus (Gutierrez-Fernandez, 2020; Chung et al, 2021). IACS-2858 and BAY-87-2243 act like a “cork in a bottle”, binding a cluster of residues of subunits ND1 and NDUFS7 in the central charged region of the ubiquinone-binding pocket of mouse Complex I (Chung et al, 2021 ; Kurelac et al, 2022). Biguanides such as metformin are similarly thought to interact with Phe244 of ND1 and Arg77 of NDUFS7 in the Q-tunnel with a mode dependent on the active or inactive state of the enzyme. Furthermore, evidence indicates that the biguanides may be non-selective in their binding, with a putative additional binding site on Complex IV, another subunit of the electron transport chain (LaMoia et al, 2021). The binding sites of several Complex I inhibitors are reviewed by Schiller and Zickermann (2022).

[0008] Classical Complex I inhibitors, such as those mentioned above, often cause cytotoxicity and cell death. For instance, piercidin A is insecticidal and antibacterial, pyridaben is an acaricide (killing ticks and mites) and aureothin exhibits antitumor, antifungal and insecticidal activity. IACS-010579 and IM156 (also known as HL156A) have been reported to possess anti-tumour effects due to profound impacts on cancer cell viability (Tsogbadrakh et al, 2018 and Izreig et al, 2020). However, despite these properties, the known, classical, C1 inhibitors have not found use as approved therapeutics. Indeed, as well as showing mechanism-based toxicity (Yap, T et al, 2023), these agents have been used to elicit disease in mouse models of neurodegenerative conditions such as Parkinson disease (PD; Xiong et al, 2012, which is hereby incorporated by reference in its entirety) and Alzheimer's disease (AD; Joh et al, 2017, which is hereby incorporated by reference in its entirety). As such, for classical complex I inhibitors, identifying a suitable approach for therapeutic use that provides a benefit without toxicity has proved to be a challenge. An alternative approach which might elicit a benefit without adverse effects may have potential benefits for the treatment of a variety of progressive diseases.

[0009] ***

[0010] The goal of therapeutic tissue repair is to restore the tissue to its original state of structure and function (Krafts, 2010 and Paul and Sharma, 2021 ). Attaining this goal has proved elusive, with the only effective examples being organ transplantation or surgical implants using natural or biomimetic structures such as aortic valves or joint replacement). Further, whilst there has been a significant increase in research into strategies to achieve repair in different organ systems, these approaches aim to remove the primary driver to tissue injury (e.g. , the calcified heart valve) or to replace the dysfunctional matrix environment with an environment which favours homing of repair cells or local augmentation of soluble pro-repair factors (e.g., fibrin). Such examples include biomimetic scaffolds in orthopaedics, which simulate normal structural matrix for cell homing, and cellular products to simulate the soluble matrix microenvironment for cutaneous and ocular wound repair. As such, the identification of a therapeutic agent(s) which both attenuates the drive to tissue injury and concurrently promotes a pro-repair microenvironment, has proved elusive.

[0011] Tissue repair (healing) is a highly orchestrated and complex process involving a sequence of overlapping events that are precisely timed. The process has three broad phases which were first delineated in the 19th Century (Virchow, 1859) and have been since augmented by the addition of data on their cellular genotypes, phenotypes, and molecular mediators (Liehn, 2011 , Takeo, 2015, and Somer et al, 2021 ). However, there are limited, if any, data available regarding the mechanisms underpinning repair in most chronic disease settings (Peyrin-Biroulet, 2020) and current understanding of tissue repair processes has not led to substantial improvements in the clinical care of tissue damage (Eming et al, 2014).

[0012] As shown in Figure 1 , the three phases of tissue repair are:

[0013] 1. Inflammation

[0014] 2. Proliferation (fibrogenesis and angiogenesis)

[0015] 3. Tissue Remodelling (Lokmic et al, 2012.)

[0016] In the healthy, functional healing / repair process, these phases proceed in an overlapping sequence, with resolution of inflammation progressing alongside proliferation and matrix remodelling to restore tissue architecture. In conditions of chronic disease, this process is interrupted or dysregulated, resulting in persistent non-healing tissue damage.

[0017] Functional repair involves the resolution of the primary inflammatory response to injury and the simultaneous activation of the inflammatory response consequent upon repair. These phases show different qualitative and kinetic properties; the first phase induces a proliferative response in both infiltrating and resident cells whilst the second involves repolarisation of the infiltrating cells.

[0018] Furthermore, the cells involved in the repair process show different responses to stress dependent on the progressing phase of repair. For example, immune cells of the myeloid lineage (short-lived cells with high bioenergetic demand) respond to stress by reducing proliferation and activating apoptosis pathways such that the overall phenotype of the myeloid lineage is anti-inflammatory, and in the context of repair, a reduced population showing immunomodulatory effects. By contrast, mesenchymal and epithelial cells respond to similar microenvironmental stressors by activating effector pathways. For example, mesenchymal cells typically respond to low oxygen tension (hypoxia) by the expansion and activation of a repair phenotype.

[0019] There is an urgent need for therapeutics which exert a dual pharmacology of reducing disease progression whilst supporting tissue repair in chronic progressive disease, medical conditions that worsen over time without medical intervention. Prominent examples are autoimmune diseases such as rheumatoid arthritis (RA), psoriasis and inflammatory bowel disease (IBD) and progressive fibrosis such as idiopathic pulmonary fibrosis (IPF), non-alcoholic fatty liver disease (NAFLD) / non-alcoholic steatohepatitis (NASH) and chronic kidney disease. Without treatment these conditions typically progress in severity over time and may, as in the case of pulmonary fibrosis, be fatal.

[0020] The current treatments for these conditions inhibit the progression of the diseases. However, in general these agents typically fail to promote tissue repair by exerting a direct effector response on repair processes. Indeed, their suppression of the pro-inflammatory effector cell and molecular response proceeds cyclically, perhaps for months or years. For example, in rheumatoid arthritis, persistent inflammation within the bone erosion prevents erosions from healing (Berardi et al, 2021) whilst a similar unresolved inflammation preventing repair is seen in chronic skin wounds (Li et al, 2021), ulcerative colitis and Crohn’s disease. Examples of conditions where effective antiinflammatory effects by a therapeutic do not result in effective repair include:

[0021] • rheumatoid arthritis, in which suppression of synovitis and pannus formation does not result in complete suppression of erosions and bone loss;

[0022] • inflammatory bowel disease, in which suppression of mucosal inflammation does not result in complete suppression of ulceration;

[0023] • neurodegeneration, such as multiple sclerosis (MS), in which suppression of the inflammatory drive to de-myelination does not result in concomitant increase in oligodendrocyte or Schwann cell-induced re-myelination;

[0024] • pathology of the distal lungs, such as idiopathic pulmonary fibrosis, in which suppression of inflammation does not halt the drive to fibroblastic expansion and emphysematous destruction, or result in the conservation of alveolar stem cells.

[0025] Furthermore, in other chronic diseases, the kinetic interplay between the drive to injury and sequential activation of repair, often results in ‘futile’ repair, i.e., creation of maladapted restitution of tissue remodelling to a normal state. Such futile repair is seen in settings such as osteoarthritis and fibrosis.

[0026] The result of either failure to repair or futile repair is that most patients with chronic disease experience ongoing symptoms, and disease progression despite treatment. As such, there is a pressing need for therapeutics with a dual pharmacology that can act on both the inflammatory and repair arms of a lesion. Such a therapeutic would:

[0027] • display a pharmacology-dependent, differential transduction of microenvironmental stress signals.

[0028] • mitigate the drive to injury and simultaneously, augment and capitalise upon the stressor events that constitute the inflammatory to proliferative phase of tissue repair.

[0029] • orchestrate repair, in an anatomically appropriate manner to restore key aspects of tissue function (Eming et al, 2014).

[0030] In addition, the pharmacological intervention might elicit cellular changes consistent with those required to orchestrate a controlled repair response. For example, the approach might elicit production of the key basement membrane collagen IV in a controlled manner, alongside production of growth factors important for angiogenesis, epithelialisation and matrix remodelling, such as VEGF, FGF21 and GDF15. Were this approach to be successful it would elicit repair in a pathology agnostic manner, i.e. the repair response would be seen in multiple settings regardless of the nature of the original injury. In addition, it might alter the activation response of resident cells and de-sensitize' the microenvironment to the effects of a pro-inflammatory cell infiltrate, resulting in a ‘permission’ to repair.

[0031] One proposed approach to eliciting a tissue repair response has been to repair the cell first (Fu, 2021). The induction of an integrated stress response (ISR) may be an effective means of achieving this goal. The ISR is a cyto protective mechanism that maintains cellular proteostasis (i.e., protein homoeostasis) in response to stress conditions. The ISR is highly conserved across cell types, and is triggered in response to changes in mitochondrial function (Savu and Moisoi, 2022). Activation of a controlled ISR has been shown to have beneficial effects in multiple disease settings. For example, in mouse models of multiple sclerosis the ISR can be harnessed to protect oligodendrocytes and myelin during inflammation (Way and Popko, 2016). In addition, the ISR has been shown to regulate the health of cardiac progenitor cells by removing unhealthy cells to prevent their differentiation and selfrenewal (Searfoss et al, 2019), a property that may be shared across progenitor cells in other settings such as oligodendrocyte progenitors in the brain and spinal cord, alveolar type II epithelial cells (AT2) in the lung and mesenchymal stem cells and bone marrow progenitor cells. Roles for the ISR in obesity, neurodegeneration and heart failure have also been proposed. Importantly, to achieve these outcomes the ISR should be moderate and tightly regulated, like a rheostat, in order to avoid pushing cells towards apoptosis (Kaspar et al, 2021).

[0032] An agent which could both control symptoms and elicit tissue repair / healing may have greater benefits for patients than existing therapy and lead to improved treatment outcomes.

[0033] ***

[0034] NF-KB is chronically active in many inflammatory and progressive diseases, including arthritis, IBD, multiple sclerosis (Park and Hong, 2016), graft versus host disease (GvHD), atopic dermatitis, and lupus. The canonical NF-KB signalling pathway is induced by various signals including TL1A, Toll-like receptor (TLR) and interleukin-1 receptor (IL1 R) activation. Following activation of TLRs or the IL1R, MYD88 is recruited which in turn promotes assembly of a signalling complex comprising TRAF3, TRAF6, IRAK4 and IRAKI (Spiegel and Milstien, 2011). Following recruitment, TRAF6 undergoes autoubiquitylation which then recruits and activates TAK1. TAK1 activation culminates in the activation of NF-KB which in turn promotes transcription of pro-inflammatory genes. It is thought that sphingosine- 1-phosphate (S1P) promotes NF-KB signalling through these canonical pathways by binding to TRAF6 and enhancing autoubiquitylation. The interleukin-1 receptor associated kinase (IRAK) family of proteins are key regulators of the innate immune response and consist of four family members, IRAKI, IRAK2, IRAK-M, and IRAK4. Following activation of TLRs and the IL1R, or in response to changes in sphingosine-1-phosphate (S1 P), IRAK4 binds to MyD88 and induces signalling through IRAKI and IRAK2 resulting in activation of NF-KB, IRF-5, and MAPK. Thus, in healthy individuals, the IRAK family, alongside S1 P, IL-1 and TLR activity, play a crucial role in the adaptive immune response and innate immune response to pathogens. However, dysregulated IRAK activity, and especially dysregulated IRAKI and IRAK4 activity, and / or dysregulation of S1 P levels can lead to an increase in autoimmune pathologies. For example, dysregulated IRAK4 activity is associated with increased release of inflammatory cytokines which can lead to an increase in autoimmune signalling and pathology. In particular, autoimmune disorders such as rheumatoid arthritis (RA), inflammatory bowel disease, multiple sclerosis (MS), lupus and psoriasis are associated with dysregulated S1 P and IRAK4 activity. In addition to the role S1P plays in TLR / IL1 R-driven NF-KB activation, it is also able to stimulate NF-KB signalling via S1 P receptors in an autocrine, paracrine or endocrine fashion (that is, S1 P is exported from a cell and acts as an extracellular ligand). In such cases, S1 P binds to and activates the S1P receptor which in turn activates Gai which induces K84-linked ubiquitination and degradation of the inhibitory IKBQ, thereby activating NF-KB (Spiegel and Milstien, 2011).

[0035] TL1A, also known as TNFSF15, is also an activator / modulator of NF-KB signalling and TL1A dysregulation and / or abnormal expression is implicated in a number of diseases, including IBD, ulcerative colitis, rheumatoid arthritis, psoriasis ankylosing spondylitis and fibrosis, including colonic fibrosis associated with IBD, interstitial lung disease (including systemic sclerosis associated with interstitial lung disease (SSc-ILD)). TL1A is a ligand for death receptor 3 (DR3), and TL1A binding to DR3 results in activation of the TRADD signalling pathway which ultimately stimulates NF-KB activation (Wen et al., 2003). In this context, activation of NF-KB by TL1 A / DR3-mediated signalling has been shown to preferentially activate pro-inflammatory pathways and inhibit apoptosis, thus exacerbating IBD and RA symptoms and disease progression (Xu et al., 20022).

[0036] In view of the extensive involvement of NF-KB in inflammatory and progressive diseases, therapeutic interventions in this pathway are viewed as a promising tool for treatment. For example, IRAK inhibitors (IRAKi) were viewed as a promising avenue for development of new treatments of autoimmune disorders and a number of IRAK4 inhibitors have since entered clinical trials (Wiese et al, 2020). These include BAY1830839 for treatment of autoimmune disease; GS-5718, zimlovisertib and zabedosertib for the treatment of rheumatoid arthritis; The IRAK4-degrader KT-474 / SAR444656 and EVO101 for treatment of atopic dermatitis; zimlovisertib and KT-474 / SAR444656 for the treatment of hidradenitis suppurativa; emavusertib and KT-413 for the treatment of lymphoma; and the IRAK-4 / IRAK1 dual inhibitor R289 (R835 prodrug) for the treatment of and myelodysplastic syndromes. Several S1 P receptor (S1 PR) modulators are also approved for the treatment of IBD, such as etrasimod and ozanimod, and fingolimod, ponesimod and siponimod for the treatment of multiple sclerosis. Ponesimod is also approved from the treatment of GvHD and psoriasis. In addition, several other S1 P receptor modulators are currently in clinical trials, including ceralifimod for treatment of MS, zectivimod for treatment of MS and atopic dermatitis, and cenerimod for treatment of lupus. Finally, a number of TL1A inhibitors are also in development and under investigation in clinical trials. For example, tulisokibart (previously known as PRA023 and MK-7240) is under investigation for treatment of ulcerative colitis, and SSc-ILD ulcerative colitis. PF-06480605 / RVT-3101 is being investigated in a phase 2 trial for the treatment of Crohn’s disease. TEV-48574 is being investigated in a phase 2 trial for the treatment of Crohn’s disease and UC. FG-M701 and SPY002 are being developed for treatment of IBD. The inventors have previously discovered that compounds which can bind to and modulate the activity of mitochondrial complex I (see European patent application No. 23162131.9, which is incorporated herein by reference) are beneficial in the treatment of inflammatory and / or progressive diseases such as rheumatoid arthritis (RA), inflammatory bowel disease (IBD), interstitial lung disease or pulmonary fibrosis, and multiple sclerosis (MS). The inventors demonstrated that such compounds could slow down and even prevent disease progression in mice with the conditions. Even more surprisingly, however, was the observation that these compounds additionally promoted repair of affected tissues thereby reversing disease progression.

[0037] While this newly discovered class of compounds provides an exciting new avenue for treatment of inflammatory and / or progressive disease, there is still an ongoing need to improve the efficacy of these nascent drug treatment regimens to further improve patient quality of life.

[0038] The present invention has been devised in light of the above considerations.

[0039] Summary of the Invention

[0040] Current treatments for chronic, progressive conditions inhibit disease progression but fail to promote tissue repair. Consequently, patients with chronic disease experience ongoing symptoms and progression, and poor quality of life. Despite the attractiveness of restoring normal tissue architecture as a means to treat chronic disease, pharmacological interventions to achieve this have not been studied, and as a result practical applications of this approach do not yet exist. One potential approach to achieve pharmacological tissue repair is through changes in mitochondrial function. However, the literature currently teaches that eliciting changes in mitochondrial function suppresses repair and promotes inflammation (Cai et al, 2022), and indeed, alterations in mitochondrial function to alter disease progression through control of inflammation, or tissue remodelling, have not been extensively studied. The mitochondrial Complex I modulator (MCIM) compounds, which are disclosed in EP23162131.9, modulate the activity of mitochondrial Complex I in a manner that differs from that of conventional complex I inhibitors. This elicits an adaptive phase which directs cell fate choices and mimics a wound repair-like microenvironment. Phenotypically, this can control inflammation, alter the activation response of resident cells and desensitizes the microenvironment to the effects of a pro- inflammatory cell infiltrate, and concurrently initiate repair signals in affected tissues, such as joints and the lung. In addition, the MCIM compounds can stimulate the production of key growth factors such as VEGF, and collagen I, and the basement collagen IV. Together, these mechanisms support a reduction in inflammation and restoration of tissue architecture in multiple organ / tissue settings.

[0041] In addition to the effects of MCIM compounds described in EP23162131.9, the inventors have further found that MCIM compounds can be used in combination with NF-KB pathway inhibitors (for example IRAK inhibitors, S1 P receptor modulators, and TL1 A inhibitors) to further improve treatment of inflammatory and / or progressive diseases and disorders, for example rheumatoid arthritis, inflammatory bowel disease and MS. Such combinations lead to a surprising and synergistic improvement in the levels of tissue repair observed compared to when either an MCIM compound or NF-KB pathway inhibitor compound is administered alone. For example, a synergistic improvement in the levels of tissue repair is observed in RA mouse models when mice are treated with an MCIM compound and the IRAKI compound zimlovisertib (previously known as PF-06650833). Similarly, a synergistic improvement in the levels of tissue repair is observed in IBD mouse models when mice are treated with an MCIM compound and the S1 PR modulator compound etrasimod. A synergistic improvement in the levels of tissue repair may be observed in IBD mouse models when mice are treated with an MCIM compound and the TL1 A inhibitor tulisokibart. It is envisaged that these combination treatments will also be useful in the treatment of other diseases associated with dysregulated NF-KB pathway activity, such as multiple sclerosis (MS), lupus and psoriasis, atopic dermatitis, psoriatic arthritis, inflammatory arthritis, ankylosing spondylitis, juvenile idiopathic arthritis, reactive arthritis, osteoarthritis, Crohn’s disease, fistulising Crohn’s disease, ulcerative colitis, graft versus host disease (GVHD), and lupus.

[0042] At its broadest, in a first aspect, the disclosure provides a pharmaceutical combination comprising an MCIM compound and an NF-KB pathway inhibitor. A pharmaceutical combination may comprise a single pharmaceutical composition comprising an MCIM compound and an NF-KB pathway inhibitor. Alternatively, the pharmaceutical combination may comprise a first pharmaceutical composition comprising an MCIM compound and a second pharmaceutical composition comprising an NF-KB pathway inhibitor. Thus, the disclosure further provides a pharmaceutical composition comprising an MCIM compound and an NF-KB pathway inhibitor. The disclosure further provides a pharmaceutical combination comprising an MCIM compound and an NF-KB pathway inhibitor for use in medicine. The MCIM compound and the NF-KB pathway inhibitor may be administered separately, sequentially, or simultaneously, and may be administered in any order. The combination therapy can achieve reparative effects when used to treat inflammatory and / or progressive diseases. Preferably, the MCIM compounds bind complex I and are able to modulate complex I function.

[0043] In a second aspect, the disclosure provides a pharmaceutical combination or composition according to the first aspect for use in a method of treatment.

[0044] In a third aspect, the disclosure provides a pharmaceutical composition comprising a mitochondrial complex I modulator (MCIM) compound for use in the treatment of an inflammatory and / or progressive disease in a subject. The treatment comprises the separate, sequential or simultaneous administration of the pharmaceutical composition and an NF-KB pathway inhibitor to the subject. The treatment may achieve disease control, regression, or tissue repair, or any combination of the foregoing.

[0045] In a related fourth aspect, the disclosure further provides a pharmaceutical composition comprising an NF-KB pathway inhibitor for use in the treatment of an inflammatory and / or progressive disease in a subject. The treatment comprises the separate, sequential or simultaneous administration of the pharmaceutical composition and a mitochondrial complex I modulator (MCIM) compound to the subject. The treatment may achieve disease control, regression, or tissue repair, or any combination of the foregoing.

[0046] In a related fifth aspect, the disclosure further provides a pharmaceutical composition comprising a mitochondrial complex I modulator (MCIM) compound and an NF-KB pathway inhibitor for use in the treatment of an inflammatory and / or progressive disease in a subject. The treatment comprises administration of the composition to the subject. The treatment may achieve disease control, regression, or tissue repair, or any combination of the foregoing.

[0047] In a sixth aspect, the disclosure provides a pharmaceutical combination comprising an MCIM compound and an NF-KB pathway inhibitor for use in a method of treatment. The combination may be comprised in a single pharmaceutical composition. Alternatively, the MCIM compound and the NF-KB pathway inhibitor may be comprised in separate pharmaceutical compositions. The method may comprise the separate, sequential or simultaneous administration of the pharmaceutical combination. That is, the MCIM and the NF-KB pathway inhibitor may be administered separately, sequentially, or simultaneously.

[0048] In a seventh aspect, the disclosure further provides a method of treating an inflammatory and / or progressive disease in a subject, wherein the method comprises administering a pharmaceutical composition comprising a mitochondrial complex I modulator (MCIM) compound to the subject. The method further comprises the separate, sequential or simultaneous administration of an NF-KB pathway inhibitor to the subject. The treatment may achieve disease control, disease regression or tissue repair, or a combination of any of the foregoing.

[0049] In an eighth aspect, the disclosure further provides a method of treating an inflammatory and / or progressive disease in a subject, wherein the method comprises administering a pharmaceutical composition comprising an NF-KB pathway inhibitor to the subject. The treatment further comprises the separate, sequential or simultaneous administration of a mitochondrial complex I modulator (MCIM) compound to the subject. The treatment may achieve disease control, disease regression or tissue repair, or a combination of any of the foregoing.

[0050] In a ninth aspect, the disclosure further provides a method of treating an inflammatory and / or progressive disease in a subject, wherein the method comprises administering a pharmaceutical composition comprising a mitochondrial complex I modulator (MCIM) compound and an NF-KB pathway inhibitor to a subject. The treatment may achieve disease control, disease regression or tissue repair, or a combination of any of the foregoing.

[0051] In some embodiments of the above aspects of the disclosure, the treatment elicits disease control, disease regression or tissue repair, or a combination of any of the foregoing. In some embodiments, the treatment achieves disease control, disease regression or tissue repair, or a combination of any of the foregoing. In some embodiments, the treatment initiates an adaptive response in certain cell types that leads to pharmacodynamic evidence of disease control, disease regression or tissue repair, or any combination of the foregoing. In some embodiments, the adaptive response leads to tissue repair and / or disease regression. In some embodiments, the tissue repair or disease regression induces a restoration of tissue architecture towards its healthy state, which is characterised by anatomically normal architecture. In some embodiments, disease control comprises inhibition of disease progression. In some embodiments, inhibition of disease progression includes a prevention of disease progression. In some embodiments, inhibition of disease progression includes a reduced rate of disease progression. In some embodiments, disease control comprises the prevention of a loss of anatomically normal tissue architecture, or a reduction in the speed of the loss of anatomically normal tissue architecture. In some embodiments, the tissue repair and / or disease regression is characterised by an increased clinical repair score and / or comprises increased wound healing.

[0052] In some embodiments, the inflammatory and / or progressive disease is an autoimmune disease. In some embodiments, the inflammatory and / or progressive disease is an arthritis, inflammatory bowel disease (IBD), atopic dermatitis, psoriasis, lupus or plaque psoriasis. In some embodiments, the disease or disorder may be an autoimmune disorder such as rheumatoid arthritis (RA), inflammatory bowel disease (IBD), ulcerative colitis, Crohn’s disease, atopic dermatitis,. In some embodiments, the disease or disorder may be RA, psoriatic arthritis, inflammatory arthritis, ankylosing spondylitis, juvenile idiopathic arthritis, reactive arthritis, gout, septic arthritis, enteropathic arthritis, osteoarthritis, atopic dermatitis. In some embodiments, the tissue repair and / or disease regression is characterised by an increased clinical repair score and / or comprises increased wound healing. In some embodiments, the inflammatory and / or progressive disease is RA, psoriatic arthritis, Crohn’s disease, or ulcerative colitis.

[0053] In some embodiments, the inflammatory and / or progressive disease is associated with, or caused by, pathological activation of NF-KB activity. NF-KB activity may be measured using any suitable method known in the art, for example, any of the NF-KB assays disclosed in the Assay Guidance Manual (Trask, J. 2012), which is hereby incorporated by reference. In some embodiments, pathological NF- KB activity is defined as an increase in NF-KB activation relative to NF-KB activation healthy subjects. In some embodiments, pathological activation of NF-KB is associated with overstimulation of one or more of; Toll-like receptors (TLRs), IL1 receptors (IL1Rs), S1 P receptors (S1PRs), and death receptor 3 (DR3). In some embodiments, overstimulation of TL1R, IL1 R, S1 PR and / or DR3 is defined as an increase in receptor stimulation compared to receptor activity in healthy subjects. In some embodiments, pathological activation of NF-KB is associated with elevated S1 P, or TL1A. In some embodiments, elevated S1 P or elevated TL1A is compared to S1P and / or TL1A in healthy subjects.

[0054] Clinical repair scores can be used to objectively assess clinical repair in inflammatory and / or progressive diseases. Increased clinical repair score can be indicated by a decreased disease score. In some embodiments, disease control is characterised by a decreased rate of change in the disease score. In some embodiments, disease control is characterised by no change in disease score following treatment - that is, disease control may be characterised by an inhibition of disease progression associated with an increase in disease score. In some embodiments wherein the disease is an arthritis, tissue repair and / or disease regression may be characterised by a decrease in the average arthritic index score, ACR / EULAR score, DAS28 score, HAQ-DI score, CDAI score, SDAI score, ACR20 / 50 / 70 score, EULAR score, mTSS score, RAMRIS erosion score, or RAPID3 score, or any combination thereof, as described herein. In some embodiments, tissue repair and / or disease regression may be characterised by; i) a decrease in the serum concentration of C-reactive protein (CRP); ii) a decrease in serum concentration of Tartrate-resistant acid phosphatase 5 (TRAP5); iii) an increase in the serum concentration of procollagen 1 intact N-terminal (P1NP); iv) an increase in the serum concentration of osteocalcin; or v) any combination of i)-iv).

[0055] In some embodiments, the disease control, regression or tissue repair, or any combination thereof, comprises an increased cell count of reparative cells and / or a decreased cell count of pathology driving cells. In some embodiments, the disease control, regression, or tissue repair, or any combination thereof, comprises an increased count of mesenchymal and / or epithelial cells. In some embodiments, the adaptive response is characterised by an increased count of mesenchymal and / or epithelial cells. In some embodiments, the adaptive response is characterised by an increase in the differentiation of mesenchymal and / or epithelial cells. For instance, in the bone, an increase in the number and / or activity of osteoblasts, non-transformed fibroblasts or myeloid cells, or any combination thereof, may be seen. For example, an increase in the number and / or activity of M2 macrophages may be seen. In addition to, or alternatively, in the bone, a decrease in the number or activity of pathology driving cells such as osteoclasts, transformed fibroblasts, fibroblast-like synoviocyte cells, proinflammatory macrophages, effector memory T-cells, plasmacytoid dendritic cells or transformed fibroblasts, or any combination thereof, may be seen. When the inflammatory and / or progressive disease is an IBD, the reparative cells may comprise epithelial cells and / or mucus cells. For instance, in the gastrointestinal tract the cells may comprise fibroblasts or epithelial cells, or alternatively repair may be indicated by an increase in the overall number of mucus cells which indicate that epithelial differentiation is proceeding normally. In addition to, or alternatively, when the inflammatory and / or progressive disease is an IBD, the adaptive response is characterised by a decreased count of lymphocytes, macrophages or granulocytes, or any combination thereof.

[0056] In some embodiments, the tissue repair and / or disease regression comprises a decreased cell count and / or decreased function of activated immune cell subtypes. For instance, when the inflammatory and / or progressive disease is RA, the disease control, regression or tissue repair, or any combination thereof, may comprise a decrease in the number of myeloid cells such as macrophages, osteoclasts, lymphocytes such as T-, B-, or Th17 cells, or fibroblasts such as FLS cells, or any combination thereof. Preferably, the decrease in immune cell activity and / or activated immune cell numbers is not accompanied by a decrease in the activity, function or numbers of adapting mesenchymal or epithelial cells. In some embodiments, the adaptive response comprises a change in the function of mesenchymal and / or epithelial cells. For instance, in IBD the cells may comprise PAS positive cells, or surfactant producing epithelial cells.

[0057] In some embodiments, the tissue repair and / or disease regression induces a restoration of tissue architecture towards its healthy state, which is characterised by anatomically normal architecture. For example, in some embodiments, the inflammatory and / or progressive disease is an arthritis, such as RA, and the tissue repair and / or disease regression comprises increased bone formation and / or decreased bone resorption, optionally alongside reduced oedema and / or erythema. In some embodiments, disease control comprises decreased bone resorption and / or preventing further loss of anatomically normal architecture. In some embodiments, the disease control, tissue repair and / or disease regression comprises a reduction in inflammatory cytokine production from pro-inflammatory myeloid cells. In some embodiments, the disease control, tissue repair or disease regression, or any combination thereof, comprises an increase in growth factors that are important for angiogenesis, epithelialisation or matrix remodelling, or any combination thereof. For example, the disease control, tissue repair or disease regression, or any combination thereof, may comprise an increase in VEGF, FGF21 or GDF15, or any combination thereof. Cytokine and growth factor levels can be measured by any suitable method, e.g. via ELISA as described herein, or via ELISpot. In some embodiments, the disease control, tissue repair or disease regression, or any combination thereof, comprises an increase in basement collagen IV. Collagen IV levels can be measured by any suitable method, e.g. via ELISA as described herein and / or by immunohistochemical analysis.

[0058] Relatedly, the disclosure also provides a pharmaceutical composition comprising an MCIM compound for use in combination with a NF-KB pathway inhibitor to increase reparative cells and / or decrease destructive cells in a subject with an inflammatory and / or progressive disease, to achieve disease control and / or tissue repair and, as a result, disease regression or resolution, or improved symptom control and quality of life. Relatedly, the disclosure also provides a pharmaceutical composition comprising an NF-KB pathway inhibitor compound for use in combination with an MCIM compound to increase reparative cells and / or decrease destructive cells in a subject with an inflammatory and / or progressive disease, to achieve disease control and / or tissue repair and, as a result, disease regression or resolution, or improved symptom control and quality of life. Relatedly, the disclosure also provides a pharmaceutical composition comprising an MCIM compound and an NF-KB pathway inhibitor to increase reparative cells and / or decrease destructive cells in a subject with an inflammatory and / or progressive disease, to achieve disease control and / or tissue repair and, as a result, disease regression or resolution, or improved symptom control and quality of life. In some embodiments, the pharmaceutical compositions trigger an adaptive response in a subject with an inflammatory and / or progressive disease. The disclosure also provides methods for increasing reparative cells and / or decreasing destructive cells in a subject with an inflammatory and / or progressive disease, comprising administering the pharmaceutical composition to achieve disease control, tissue repair, disease regression, disease resolution, or improved symptom control and quality of life, or any combination thereof. In some embodiments, the method increases the adaptive response of mesenchymal and / or epithelial cells. In some embodiments, the method decreases the activation and / or numbers of pro-inflammatory cells, fibrotic cells, or erosive cells, or any combination thereof, in a subject with an inflammatory and / or progressive disease. Relatedly, the disclosure also provides pharmaceutical compositions for use in reducing cytokine production from pro-inflammatory myeloid cells in a subject with an inflammatory and / or progressive disease, to achieve disease control, tissue repair or disease regression, or any combination thereof. The disclosure also provides methods for reducing cytokine production from pro-inflammatory myeloid cells in a subject with an inflammatory and / or progressive disease, comprising administering the pharmaceutical composition to achieve disease control, tissue repair or disease regression, or any combination thereof. The compounds and inflammatory and / or progressive diseases are defined herein.

[0059] Preferably, the MCIM compound binds to Complex I and modulates Complex I activity. The modulation of Complex I activity may be determined by detecting a reduction in cellular O2 consumption. In some embodiments, the reduction in cellular O2 consumption is not associated with a reduction of cell viability. O2 consumption may be measured by any standard technique known in the art, for example, using a real-time cell metabolic analyser (e.g. a Seahorse Analyzer). The modulation of Complex I activity may also lead to a reversible reduction of cell proliferation. The reversibility of the reduction of cell proliferation means that the reduction of proliferation is reversed when the compound is removed. This contrasts with the reduction of proliferation that is observed following treatment of the same cell type with a classical complex I binder, where reduced cell proliferation is not reversed by removal of the classical complex I binder. To assess the reversibility of the reduction of cell proliferation, an MCIM is applied to a cell culture, at a concentration to substantially reduce cell proliferation, for 24 hours at 37°C / 5% CO2. After 24 hours, the cell culture is washed and cultured under conditions conducive to cell growth and proliferation. Recovery of cell proliferation is measured after 24-hours incubation in these ‘growth’ conditions (37°C / 5% CO2, without MCIM present). Recovery of cell proliferation is observed. This contrasts to observations made on the same cells that have undergone the same culture / wash / grow cycle with a classical complex I binder in the culture step. The reversable reduction of cell proliferation may be assessed using human primary lung fibroblasts, e.g. as described in Example 4 (as illustrated in Figure 5). Preferably, the MCIM compound interacts with Complex I at a binding site at the top of or outside the Q tunnel. In some embodiments, the binding site comprises one or more amino acid residues from NDUSF2 (SEQ ID NO: 1 ) and / or NDUSF7 (SEQ ID NO2). In some embodiments, the compound interacts with at least one amino acid residues in NDUFS2 (SEQ ID NO: 1 ), for instance His92, Gly85, Tyr141 , His88, Leu95, Asp193, or Phe458. In some embodiments, the compound interacts with one or more amino acid residues in NDUFS2 (SEQ ID NO: 1 ) selected from Tyr141 , His92 and Asp193.

[0060] In some embodiments, the response may include promotion of a repair phenotype during the same time course as control of inflammation. The control of inflammation induced by MCIM compounds of the disclosure may be distinct from the control of inflammation induced by other anti-inflammatory drugs which rely on the suppression of inflammation before activation of tissue repair as a secondary effect.

[0061] In some embodiments, the compound comprises four or more of the pharmacophore features of the pharmacophore model represented in Figure 15. The three-dimensional arrangement of the pharmacophore features may be as described in Tables 6-A, 6-B and 6-C.

[0062] In some embodiments, the compound is a compound, or a pharmaceutically acceptable salt, hydrate, or solvate thereof, of the following formula: defined in claim 1 of WO2010 / 032009. Claim 1 of WO2010 / 032009 is hereby incorporated by reference. Furthermore, WO2010 / 032009 is hereby incorporated by reference in its entirety.

[0063] In some embodiments, the compound is a compound, or a pharmaceutically acceptable salt, hydrate, or solvate thereof, of the following formula: defined in claim 1 of WO2010 / 032010. Claim 1 of

[0064] WO2010 / 032010 is hereby incorporated by reference. Furthermore, WO2010 / 032010 is hereby incorporated by reference in its entirety.

[0065] In some embodiments, the compound is a compound, or a pharmaceutically acceptable salt, hydrate, or solvate thereof, of the following formula: defined in claim 1 of W02020 / 035560 A1. Claim 1 of W02020 / 035560 A1 is hereby incorporated by reference. Furthermore, W02020 / 035560 A1 is hereby incorporated by reference in its entirety.

[0066] In some embodiments, the compound is a compound, or a pharmaceutically acceptable salt, hydrate, or solvate thereof, of the following formula: as defined in claim 1 of W02020 / 212581 A1. Claim 1 of W02020 / 212581 A1 is hereby incorporated by reference. Furthermore, WO2020 / 212581 A1 is hereby incorporated by reference in its entirety.

[0067] In one embodiment, the compound is a compound, or a pharmaceutically acceptable salt, hydrate, or solvate thereof as defined in WO2014 / 207445 A1, which is incorporated herein by reference in its entirety. For example, in some embodiments, the compound is a compound selected from compounds of the following formulae, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:

[0068] HMC-C-05,

[0069] HMC-N-04.

[0070] In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:

[0071] HMC-C-01-A.

[0072] In one embodiment, the compound is a compound, or a pharmaceutically acceptable salt, hydrate, or solvate thereof as defined in WO2016 / 097001 A1, which is incorporated herein by reference in its entirety. For example, in some embodiments, the compound is a compound selected from compounds of the following formulae, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:

[0073] HMC-C-07.

[0074]

[0075] In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof: In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:

[0076] NAS M P-01 -A.

[0077] In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:

[0078] In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:

[0079] In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof: In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:

[0080] In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:

[0081] In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof: In some embodiments, the compound is a compound of the following formula, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:

[0082]

[0083] In some embodiments of the above aspects, the NF-KB pathway inhibitor comprises an IRAKi compound. In some embodiments, the IRAKi compound is selected from zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, and EVO101, or any combination thereof. In some embodiments of the above aspects, the IRAKi compound is selected from zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, and KT- 413, or any combination thereof. In some embodiments wherein the NF-KB pathway inhibitor comprises an IRAKi, the inflammatory and / or progressive disease may be selected from rheumatoid arthritis (RA), psoriatic arthritis, inflammatory arthritis, ankylosing spondylitis, juvenile idiopathic arthritis, reactive arthritis, and osteoarthritis.

[0084] In some embodiments of the above aspects, the NF-KB pathway inhibitor comprises an S1 PR modulator. In some embodiments, the S1PR modulator is selected from etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, and cenerimod, or any combination thereof. In some embodiments, the S1 PR modulator comprises etrasimod. In some embodiments wherein the NF-KB pathway inhibitor comprises an SP1 R modulator compound, the inflammatory and / or progressive disease may be selected from inflammatory bowel disease (IBD), ulcerative colitis, multiple sclerosis, graft versus host disease (GVHD), psoriasis, Crohn’s disease, fistulising Crohn’s disease, atopic dermatitis, and lupus.

[0085] In some embodiments of the above aspects, the NF-KB pathway inhibitor comprises a TL1A inhibitor. In some embodiments, the TL1A inhibitor is selected from tulisokibart, RVT-3101 , TEV-48574, FG- M701 , and SPY002, or any combination thereof. In some embodiments, the TL1 A inhibitor comprises tulisokibart. In some embodiments wherein the NF-KB pathway inhibitor comprises a TL1 A inhibitor, the inflammatory and / or progressive disease may be selected from IBD, ulcerative colitis, Crohn’s disease, fistulising Crohn’s disease, RA, psoriasis, ankylosing spondylitis, fibrosis, and intestinal fibrosis.

[0086] The pharmaceutical composition(s) may comprise pharmaceutically acceptable excipients, stabilisers, processing aids and / or excipients which enhance the solubility, dissolution rate, permeability, absorption performance, site specific delivery of one or more of the active compounds contained therein.

[0087] In some embodiments, the MCIM compound and the NF-KB pathway inhibitor are uniformly dispersed in a solution, suspension, semi-solid or solid mixture within a single dosage form. In some embodiments, the single dosage form comprises one or more pharmaceutically acceptable excipients. In some embodiments, the MCIM compound and the NF-KB pathway inhibitor are heterogeneously dispersed and separated from each other in different regions within a single dosage form.

[0088] The invention includes the combination of the aspects and preferred features described except where such a combination is clearly impermissible or expressly avoided.

[0089] Summary of the Figures

[0090] Embodiments and experiments illustrating the principles of the invention will now be discussed with reference to the accompanying figures in which:

[0091] Figure 1 . A graph of response over time of each of the three phases of repair (Inflammation, proliferation and tissue remodelling) which are proposed to be broadly similar across tissues. Cell types and soluble factors involved in each phase are shown below the graph along with changes in the extracellular matrix.

[0092] Figure 2. High throughput integrative biology platform (BioMAP®) profile of the effects of MCIM compounds on multiple disease-associated regulatory pathways identified that these compounds have the potential to regulate inflammatory responses and the tissue remodelling collagen, collagen type IV, for ABD599 (A) and HMC-C-01-A (B) and (C). (D) The effects of S1 PR modulator compound ozanimod on multiple disease-associated regulatory pathways identified that this compound has the potential to regulate inflammatory responses but reduces collagen type III.

[0093] Figure 3. Electron micrographs of human primary myeloid cells (osteoclasts) treated with MCIM compounds show an adaptive response by changing mitochondrial morphology, with an increase in mitochondrial area without an overt increase in mitochondrial mass.

[0094] Figure 4. A) Three graphs showing the change in intracellular ATP levels (left), nuclei count (middle) and ATP readout per cell (right) in response to increasing MCIM compound dose in standard, glucose supplemented media (squares), media supplemented with glucose and L-glutamine (open circles) or media supplemented with glucose, L-glutamine, and pyruvate (close circles). B) A graph showing the change in VEGF secretion in response to increasing MCIM compound concentration in standard, glucose and L-glutamine supplemented media containing pyruvate (closed circles), or medium containing glucose and L-glutamine but without pyruvate (open circles). MCIM compounds promote an adaptive response by increasing VEGF secretion in metabolically restricted human primary lung fibroblasts without a change in cell number.

[0095] Figure 5. Cell proliferation inhibition measured by BrdU incorporation (A) and nucleic count (B) as a function of increasing dosage of either Rotenone (squares), IACS-010759 (closed circles) or MCIM compound (open circles). Comparison of cells without washout vs washout of test compounds on cell proliferation measure by BrdU incorporation (C) and nuclei count (D). Non-washout and washout of rotenone are shown in grey and open grey, respectively. Non-washout and washout of IACS-010759 are shown in black and open black, respectively. Non-washout and washout of MCIM compound are shown in checkboard fill and open fill pattern, respectively. MCIM compounds reversibly inhibit cell proliferation whereas cells treated with typical Complex I inhibitors IACS-010759 and rotenone do not recover cell proliferative capacity after compound washing out.

[0096] Figure 6. Seven graphs each showing the average arthritic index as a function of time (dosing day) for test compound dosed at 10 mg / kg / day by oral gavage (open circles) and control (solid circles), for each of (A) HMC-C-02-A, (B) HMC-C-01-A, (C) HMC-N-02-A, (D) HMC-N-01-A, (E) NASMP-01-A, (F) CHMSA-01-A, (G) CHMSA-03-A.

[0097] Figure 7. Graphs showing the average bone resorption counts in mice with collagen-induced arthritis treated with (A) vehicle control or 10 mg / kg / day of either HMC-C-01-A, HMC-C-01-B, or HMC N 01 B, (B) vehicle control, or 10 mg / kg / day of either ABD900, NASMP-01, CHMSA-03-A, or NASMP-06, (C) average osteoid counts in mice with collagen-induced arthritis treated with vehicle control or 10 mg / kg / day of either HMC-C-01-A, HMC-C-01-B, or HMC N 01 B, and (D) average osteoid zones in mice with collagen-induced arthritis treated with vehicle control, or 10 mg / kg / day of either ABD900, NASMP-01, CHMSA-03-A, or NASMP-06. MCIM compounds of the invention protect against bone resorption and promote the formation of osteoid, an indicator of bone formation, in mice suffering from collagen-induced arthritis. Data are mean ± s.e.m. *p<0.05 ** p<0.01 *** p<0.005 vs vehicle.

[0098] Figure 8. Histological sections (160x magnification, stained with toluidine blue) of limbs from mice with collagen-induced arthritis treated with either vehicle control (top panels), 10 mg / kg / day MCIM compound (middle panels) or 3 mg / kg / day etanercept (bottom panels). MCIM compounds promote bone formation in established arthritis, indicating an adaptive repair response. Top panel shows bone from collagen-induced arthritic mice treated with vehicle showing no clear signs of bone formation. Middle panel shows bone from collagen-induced arthritis mice which have clear indications of osteoid (new bone) formation in a structured manner as indicated by the black arrows. In contrast, mice treated with etanercept, a drug approved for treatment of RA, show only low levels of reactive and sporadic new bone formation.

[0099] Figure 9. Graph showing the relative inflammatory (left two bars) and osteoid (right two bars) scores in mice with collagen-induced arthritis treated with either vehicle control or a very low dose MCIM compound at 0.03 mg / kg per day for 14 days. MCIM compounds promote adaptive responses leading to repair (osteoid formation) in mice with established collagen-induced arthritis at doses which don’t control inflammation, showing that the response is not a consequence of control of inflammation, but an independent, adaptive response. Data are mean ± s.e.m.. *** p<0.005 vs vehicle.

[0100] Figure 10. Graphs showing the mean change in (A) arthritic index, (B) synovitis score, (C) bone resorption and (D) osteoid score in mice with collagen-induced arthritis treated with either 0.1 mg / kg / day zimlovisertib (PF-06650833), 0.03 mg / kg / day the MCIM compound HMC-C-01-A or a combination of 0.1 mg / kg / day zimlovisertib (PF-06650833) and 0.03 mg / kg / day HMC-C-01-A. Mean changes were calculated relative to mice with collagen-induced arthritis treated with vehicle control. Data are mean ± s.e.m.. * p<0.05, ** p<0.01 *** p<0.005 vs vehicle. § p<0.05, §§ p<0.01 §§§ p<0.005 vs zimlovisertib. a p<0.05 aaa p<0.005 vs compound.

[0101] Figure 11 . A graph showing a comparison of disease activity index in mice with DSS-induced colitis treated with vehicle control, sulfasalazine, etanercept and MCIM compound. MCIM compounds of the invention reduce the severity of symptoms of mice with DSS-induced colitis compared to mice treated with vehicle control, sulfasalazine or etanercept. Data are mean ± s.e.m.. * p<0.05, *** p<0.005 vs vehicle, §§§ p <0.005 vs sulfasalazine,aaap<0.005 vs etanercept.

[0102] Figure 12. Two graphs showing a comparison of mucosal erosion in mice with DSS-induced colitis treated with (A) vehicle control, sulfasalazine or ABD900 and (B) vehicle control, sulfasalazine or HMC-C-01-A. MCIM compounds of the invention inhibit mucosal erosion to a greater extent in mice with established DSS-induced colitis compared to mice treated with vehicle control, Sulfasalazine (A), or Etanercept (B). Data are mean ± s.e.m.. * p<0.05 vs vehicle § p<0.05 vs sulfasalazine.

[0103] Figure 13. Two graphs showing a comparison of glandular loss in mice with DSS-induced colitis treated with (A) vehicle control, sulfasalazine or ABD900 and (B) vehicle control, sulfasalazine or HMC-C-01-A. MCIM compounds of the invention reduce glandular loss to a greater extent in mice with established DSS-induced colitis compared to mice treated with vehicle control, Sulfasalazine (A) or Etanercept (B). Data are mean ± s.e.m.. ** p<0.01 vs vehicle, § p<0.05 vs sulfasalazine.

[0104] Figure 14. Two graphs showing a comparison of epithelial hyperplasia in mice with DSS-induced colitis treated with (A) vehicle control, sulfasalazine or ABD900 and (B) vehicle control, sulfasalazine or HMC-C-01-A. MCIM compounds of the invention can promote epithelial hyperplasia in mice with established DSS-induced colitis at a comparable level compared to mice treated with Sulfasalazine

[0105] (A) but to a greater extent than mice treated with Etanercept (B). Data are mean ± s.e.m.. * p<0.05 vs vehicle.

[0106] Figure 15. Two graphs showing a comparison of fibroplasia, which is indicative of tissue or wound repair, in mice with DSS-induced colitis treated with (A) vehicle control, sulfasalazine or ABD900 and

[0107] (B) vehicle control, sulfasalazine or HMC-C-01-A. MCIM compounds of the invention promote increased ‘healthy’ fibroplasia in mice with established DSS-induced colitis compared to mice treated with vehicle control, Sulfasalazine (A) or Etanercept (B). Data are mean ± s.e.m.. *** p<0.005 vs vehicle, §§§ p <0.005 vs sulfasalazine,aaap<0.005 vs etanercept.

[0108] Figure 16. Histological sections from mice with DSS-induced colitis treated with either vehicle control (top panels), etanercept (middle panels) or an HMC-C-01-A (bottom panels). Ulceration, loss of architecture, oedema / inflammation and erosion is seen in the vehicle control (arrows). The positive control, etanercept, shows general conservation of tissue architecture but with underlying inflammation and oedema (arrows). The MCIM of the invention shows a general conservation of architecture, with no inflammation or oedema and with radial distribution of repair (arrows).

[0109] Figure 17. Graphs showing the (A) clinical score, (B) mean demyelination score, and (c) mean oligodendrocyte precursor cell score in mice with EAE multiple sclerosis treated with vehicle, fingolimod or an MCIM compound. MCIM compounds of the invention controls disease and supports repair in the EAE multiple sclerosis disease model. The first panel shows that 10 mg / kg / day of a MCIM compound of the invention reduces clinical score in the EAE multiple sclerosis disease model. The second panel shows that an MCIM compound of the invention reduces demyelination in the EAE multiple sclerosis disease model. The third panel shows that a MCIM compound of the invention supports oligodendrocyte precursor cells (OPCs) to a greater extent than fingolimod in the EAE multiple sclerosis disease model. Data are mean ± s.e.m.. ** p<0.01 *** p<0.005 vs vehicle

[0110] Figure 18. Histological sections of mice neural tissue from mice with EAE MS treated with either vehicle control (left panel) or 10 mg / kg / day MCIM compound (right panel). MCIM compounds of the invention reduces inflammation and increases ramified (‘resting’) microglia in the MS model. Upper panel shows rounded microglia with evident process extrusions following administration of vehicle alone (negative control). Lower panel shows ramified microglia with reduced process extrusions following administration of a MCIM compound of the invention.

[0111] Figure 19. Homology model of the complete Complex I constructed from publicly available structures for 5 different organisms. The putative targets were resolved in all 5 structures.

[0112] Figure 20. In silico homology model of NDUFS2. Druggability assessment was performed using SiteMap and identified two binding pockets in the Complex I subunit NDUFS2 (spheres).

[0113] Figure 21 . In silico SiteFinder model of NDUFS2 when in Complex I. A narrow channel was identified for Q10 and drug-like compound binding in the Q-tunnel. Spheres are used to illustrate the space / channels around NDUFS2 when in the Complex I structure.

[0114] Figure 22. In silico model of a MCIM compound docked in the Q-site of Complex I. This model reveals interactions between a MCIM compound and NDUFS2 and additional interactions with the neighbouring Complex I subunit NDUFS7.

[0115] Figure 23. 3D representation of a pharmacophore model built from in silico modelling of drug docking in Complex I. Figure 24. Overlay of a MCIM compound on the ligand-protein pharmacophore model illustrating successful docking of the MCIM compound in the Q-tunnel of Complex I.

[0116] Figure 25. Overlay of a MCIM compound, CHMSA-02-A, on the ligand-protein pharmacophore model (top panel) and the chemical structure of CHMSA-02-A (bottom panel). This illustrates successful docking of CHMSA-02-A in the Q-tunnel of Complex I.

[0117] Figure 26. Graph showing the quantitative structure-activity relationship (QSAR) model used to identify further MCIM compounds, which bind Complex I, and to predict their activity in vivo.

[0118] Predicted pAct of MCIM compounds correlates well with their experimentally validated pAct, with a coefficient of determination (R2) value of 0.8322 demonstrating that this QSAR model can be used to accurately identify novel MCIM compounds which bind Complex I.

[0119] Detailed Description of the Invention

[0120] Aspects and embodiments of the present invention will now be discussed with reference to the accompanying figures. Further aspects and embodiments will be apparent to those skilled in the art. All documents mentioned in this text are incorporated herein by reference.

[0121] The present disclosure provides a pharmaceutical composition comprising an MCIM compound for use in a method of treating or preventing an inflammatory and / or progressive disease, wherein the method further comprises administering an NF-KB pathway inhibitor, for example an IRAK inhibitor (IRAKi) compound, an S1 PR modulator compound, and / or a TL1A inhibitor. Also provided is a pharmaceutical composition comprising an NF-KB pathway inhibitor for use in a method of treating or preventing an inflammatory and / or progressive disease, wherein the method further comprises administering an MCIM compound. Also provided is a pharmaceutical composition comprising an MCIM compound and an NF-KB pathway inhibitor for use in a method of treating or preventing an inflammatory and / or progressive disease. Also provided is the use of an MCIM compound in the manufacture of a medicament for use in a method of treating or preventing an inflammatory and / or progressive disease, wherein the method further comprises administering an NF-KB pathway inhibitor. Also provided is the use of an NF-KB pathway inhibitor in the manufacture of a medicament for use in a method of treating or preventing an inflammatory and / or progressive disease, wherein the method further comprises administering an MCIM compound.

[0122] Also provided is an MCIM compound in combination with an NF-KB pathway inhibitor for use in a method of reducing arthritic index to a greater extent in a patient compared to administration of MCIM alone or an NF-KB pathway inhibitor alone. Also provided is an MCIM compound for use in combination with an NF-KB pathway inhibitor for use in a method of reducing arthritic index to a greater extent in a patient compared to administration of MCIM alone or an NF-KB pathway inhibitor alone. Also provided is an NF-KB pathway inhibitor for use in combination with an MCIM compound for use in a method of reducing arthritic index to a greater extent in a patient compared to administration of MCIM alone or an NF-KB pathway inhibitor alone. Administration of the MCIM compound and the NF-KB pathway inhibitor may be separate, sequential, or simultaneous.

[0123] Further provided is a method of treating or preventing an inflammatory and / or progressive disease, the method comprising administering a therapeutically- or prophylactically-effective amount of (i) MCIM compound and (ii) an NF-KB pathway inhibitor to a subject in need of treatment.

[0124] The present disclosure also provides an MCIM compound and an NF-KB pathway inhibitor (e.g. in the form of a pharmaceutical combination or pharmaceutical composition comprising an MCIM compound and an NF-KB pathway inhibitor) for use in a method of treating or preventing an inflammatory and / or progressive disease. Also provided is the use of an MCIM compound and an NF-KB pathway inhibitor (e.g. in the form of a pharmaceutical combination or pharmaceutical composition comprising an MCIM compound and an NF-KB pathway inhibitor) in the manufacture of a medicament for use in a method of treating or preventing an inflammatory and / or progressive disease. Also provided is a method of treating or preventing an inflammatory and / or progressive disease, the method comprising administering a therapeutically- or prophylactically-effective amount of an MCIM compound and an NF-KB pathway inhibitor (e.g. in the form of a pharmaceutical combination or pharmaceutical composition comprising an MCIM compound and an IRAKI compound, a S1PR modulator compound, and / or a TL1A inhibitor) to a subject in need of treatment.

[0125] In some aspects and embodiments, the MCIM compound and the NF-KB pathway inhibitor may be provided as a combination therapy. In some embodiments, the MCIM compound and the NF-KB pathway inhibitor may be administered simultaneously or sequentially. Simultaneous administration refers to administration of the two or more agents together, for example as a pharmaceutical composition containing both agents (i.e. as a combined preparation), or immediately after one another (e.g. within 1 , 4, 6, 8 or 12 hours), and optionally via the same route of administration, e.g. to the same artery, vein or other blood vessel. Sequential administration refers to administration of one of the agents followed by, after a given time interval, separate administration of another agent. It is not required that the agents are administered by the same route, although this is the case in some embodiments. The time interval may be any time interval.

[0126] Also provided is the use of an MCIM compound in the manufacture of a medicament for use in treating or preventing inflammatory and / or progressive disease, wherein treating or preventing the inflammatory and / or progressive disease further comprises administering an NF-KB pathway inhibitor.

[0127] The present disclosure further provides a pharmaceutical composition comprising an MCIM as disclosed herein compound for use in a method of treatment, wherein the method further comprises administering an NF-KB pathway inhibitor. The present disclosure further provides a pharmaceutical composition comprising an MCIM compound as disclosed herein for use in a method of treatment, wherein the method further comprises administering an NF-KB pathway inhibitor. The present disclosure further provides a pharmaceutical composition comprising an MCIM compound for use in a method of treatment, wherein the method further comprises administering an NF-KB pathway inhibitor. The present disclosure further provides a pharmaceutical composition comprising an NF-KB pathway inhibitor for use in medicine, wherein the method further comprises administering an MCIM compound as disclosed herein. The present disclosure further provides a pharmaceutical composition comprising an NF-KB pathway inhibitor for use in medicine, wherein the use further comprises administering an MCIM compound as disclosed herein. The present disclosure further provides a pharmaceutical composition comprising an NF-KB pathway inhibitor for use in medicine, wherein the method further comprises administering an MCIM compound as disclosed herein. The present disclosure further provides a pharmaceutical composition comprising an MCIM compound as disclosed herein and an NF-KB pathway inhibitor for use in medicine. The present disclosure further provides a pharmaceutical composition comprising an MCIM compound and an NF-KB pathway inhibitor for use in medicine. The present disclosure further provides a pharmaceutical composition comprising an MCIM compound as disclosed herein and an NF-KB pathway inhibitor for use in medicine. In any of the foregoing aspects and embodiments, the NF-KB pathway inhibitor may comprise an IRAKi compound. In any of the foregoing aspects and embodiments, the IRAKi compound may be selected from zimlovisertib, zabedosertib, emavusertib, EVO101 , KT- 474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, and R835 prodrug, or any combination thereof. In any of the foregoing aspects and embodiments, the NF-KB pathway inhibitor may comprise an S1 PR modulator compound. In any of the foregoing aspects and embodiments, the S1 PR modulator compound may be selected from etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, cenerimod, or any combination thereof. In any of the foregoing aspects and embodiments, the NF-KB pathway inhibitor may comprise a TL1A inhibitor. In any of the foregoing aspects and embodiments, the TL1A inhibitor may be selected from tulisokibart, RVT-3101 , TEV-48574, FG-M701 , and SPY002, or any combination thereof. Additionally, in any of the foregoing aspects and embodiments, the MCIM compound may be HMC-C-01-A.

[0128] Pharmacophores

[0129] The term “pharmacophore” is used herein as defined in Wermuth, C.G., Ganellin, C.R., Lindberg, P., Mitscher, LA.; Glossary of Terms Used in Medicinal Chemistry (IUPAC Recommendations 1998); Pure & Appl. Chem. 70:5 (1998) 1129-1143: A pharmacophore is an ensemble of aromatic steric and electronic features that is necessary to ensure the optimal supramolecular interactions with a specific biological target and to trigger (or block) its biological response. The ensemble of aromatic steric and electronic features represent so-called “pharmacophoric features”. Typical pharmacophoric features include, for example, hydrogen bond donor, hydrogen bond acceptor, hydrophobic, aromatic, and positively and negatively ionized areas.

[0130] As used herein, the term “pharmacophore model” relates to a pharmacophore hypothesis for the binding interactions in a particular active site. A pharmacophore model is made up of a set of annotation points which are interrelated in 3D space. The annotation points show the location and type of biologically important atoms and groups, i.e. , each annotation point relates to a pharmacophore feature of the model. Each annotation point is associated with a radius that describes the permissible variation in 3D space for the location of the given pharmacophoric feature.

[0131] As used herein, the phrase “conform to a pharmacophore model” means that a compound described herein binds to the target binding site (i.e., the NDUSF2 and / or NDUSF7 binding site) in a 3D conformation (i.e., “pose”) whereby, 4 or more of the annotation points of the pharmacophore model described herein are occupied by corresponding features of the MCIM compound described herein, as determined the unified annotation scheme in Molecular Operating Environment (MOE), 2022.02 Chemical Computing Group ULC, 1010 Sherbooke St. West, Suite #910, Montreal, QC, Canada, H3A 2R7, 2022. In some embodiments, four or more of the annotation points of the pharmacophore model described herein are occupied by corresponding features of the MCIM compound described herein. In some embodiments, five or more, six or more, seven or more, eight or more, or all nine of the annotation points of the pharmacophore model described herein are occupied by corresponding features of the MCIM compound described herein. The conformance of a compound described herein with the pharmacophore features is as determined using the unified annotation scheme in Molecular Operating Environment (MOE), 2022.02 Chemical Computing Group ULC, 1010 Sherbooke St. West, Suite #910, Montreal, QC, Canada, H3A 2R7, 2022.

[0132] Annotation points can be broadly divided into three categories: atom, projected, and centroid. Annotation points are determined for a given compound by the unified annotation scheme in Molecular Operating Environment (MOE), 2022.02 Chemical Computing Group ULC, 1010 Sherbooke St. West, Suite #910, Montreal, QC, Canada, H3A 2R7, 2022.

[0133] The annotation points used herein are described below.

[0134] Atom

[0135] Don: H-bond Donor

[0136] Acc: H-bond Acceptor

[0137] Atom annotations are located directly on an atom of a molecule and typically indicate a function related to protein-ligand binding.

[0138] Don annotates an H-bond donor heavy atom. A Don annotation is added to all oxygen and nitrogen atoms with at least one (possibly implicit) hydrogen attached.

[0139] Acc annotates an H-bond acceptor heavy atom. O, S, and N elements can be hydrogen bond acceptors provided that they conform to the following rules:

[0140] 1 . Sulfur atoms are not acceptors except that sulfur in S=C groups and anionic sulfurs are acceptors and are given Acc annotations. 2. Nitrogen atoms are acceptors and given Acc annotations provided that they are not buried. A buried nitrogen is one of {=N=, -N#, >N=, >N<} or a non-3-ring conjugated nitrogen of the form {>N-TT, >N-[C+], >N-B, >N-S=O, >N-P=O}.

[0141] 3. Oxygen atoms are acceptors and are given Acc annotations provided that they are not buried and provided that they are not in certain exception groups. A buried oxygen is one of {=0= -O#;

[0142] >0= >O<} or a non-3-ring conjugated oxygen of the form {>O-rr, >O-B, >0- [C+]}. Non-buried oxygen atoms are acceptors unless they are part of the following exception groups: Projected

[0143] Don2: Projected Donor

[0144] Acc2: Projected Acceptor

[0145] Projected annotations are (typically) located along implicit lone pair or implicit hydrogen directions and are used to annotate the location of possible hydrogen bond or metal ligation partners, or possible R-group atom locations.

[0146] Projected Don2 annotations are added according to the hybridization and the heavy atom coordination of the donor. In the following table the d denotes a Don2 feature. Hydrogen bond Acc2 projected annotations are added to those heavy atoms that qualify as H-bond acceptors (see above) and are given Acc annotations. The Acc2 projected annotations are added in the same locations as those for the Don2 projected annotations and according to the same rules. (That is, the donors and the acceptors are projected using the same angles and the same distances.) An atom that is both a Don and an Acc will be annotated with “Don2&Acc2” projected annotations.

[0147] Projected annotations such as Don2, and Acc2 are located at potential heavy atom positions. For example, Don2 indicates a potential hydrogen bond partner heavy atom. Realistically, this partner atom cannot have too much overlap with any of the atoms of the molecule generating the projected annotation. This condition depends on the particular conformation of a molecule and cannot be reliably predicted by topological means. Consequently, a solvent exposure test must be applied to validate any hits resulting from a Pharmacophore Search, i.e., a test to verify that applicable projected features are not covered by other parts of the conformation (that would prevent the putative projection atom from occupying the intended position).

[0148] Centroid

[0149] Aro Aromatic

[0150] Hyd Hydrophobic

[0151] Centroid annotations (Aro, Hyd) are located at the geometric center of a subset of the atoms of a molecule.

[0152] Aro annotation centroids are used for aromatic and pseudo aromatic rings. The Aro annotation centroid is placed at the centroid of each aromatic ring (e.g. two centroids in naphthalene).

[0153] The definition of aromaticity is generous (a Daylight-style definition) in which each ring is treated in isolation and a Huckel 4n+2 rule is applied. C=O carbons count 0 electrons, otherwise C=R count as 1 ; N=X nitrogens count 1 and >N- nitrogens and -O- oxygens count 2 electrons. Thus, the following are treated as (pseudo) aromatic and are given an Aro annotation centroid in the center of the ring:

[0154] Hydrophobic atoms are annotated with HydA and hydrophobic centroids are annotated with Hyd. Hydrophobic groups are determined by graph theoretic algorithms.

[0155] The fundamental rules for deciding whether an atom is hydrophobic are summarized below:

[0156] 1. Nitro nitrogen atoms (not in nitrate anions) are hydrophobic.

[0157] 2. Divalent sulfur atoms with two heavy neighbors bonded only to carbon or sulfur are hydrophobic. 3. Halogens are hydrophobic.

[0158] 4. Carbon atoms are hydrophobic except a) aliphatic carbons rr bonded to non-carbon atoms; or b) TT carbon atoms adjacent to univalent oxygen; or c) aromatic carbon adjacent to aromatic oxygen in 5-rings; or d) carbon atoms adjacent to two or more {N, 0} atoms; or e) anionic carbons in c1cccc1 ;

[0159] The assignment of hydrophobic annotations proceeds by first applying the preceding hydrophobic atom typing rules but leaving out fluorine atoms on the grounds that they are small and should not affect annotation placement.

[0160] The Unified scheme provides an atom-centered hydrophobic annotation, HydA and a centroid hydrophobic feature Hyd. The HydA annotation is used for hydrophobic atoms that are deemed to have sufficiently high (potential) exposure to a potential receptor. This means that, for example, sp3 carbons with 4 heavy neighbors are not marked (since they are buried) and aromatic carbons with two heavy neighbors and two ortho substituents are not annotated.

[0161] The Hyd annotations are assigned by a procedure that groups connected hydrophobic atoms and assigns centroids weighted by an estimate of the likely exposed surface area of each hydrophobic atom; that is, the Hyd centroid will be placed closer to more exposed hydrophobic atoms in a hydrophobic group.

[0162] The following grouping algorithm is used:

[0163] 1 . Strip Fluorines. Remove all fluorines that are not bonded to {H,F} from further consideration. Note that estimates of exposed surface area use a fluorine suppressed molecule.

[0164] 2. Rings. Find all 5-, 6-, 7-, and 8-member rings that are not composed of smaller rings. For each such ring, extract each contiguous stretch of hydrophobic atoms with at least three atoms that have a sufficiently high total exposed surface area, and generate a surface area weighted centroid annotation. Remove all annotated ring atoms from further consideration.

[0165] 3. Components. Find all connected components (single-linkage clusters) among the remaining hydrophobes and remove from consideration those clusters with an exposed surface area sum deemed too small (less than a -CH2- group).

[0166] 4. Small Components. For the remaining hydrophobic components with three or fewer atoms, generate an exposed surface area weighted centroid annotation.

[0167] 5. Large Components. Identify the center of the component graph and generate a weighted centroid at the center including its neighbors. Remove the annotated atoms, splitting the component and apply the Small Components step and / or the Large Components step (recursively) to group the hydrophobes.

[0168] The MCIM compounds described herein conform to a pharmacophore model as described herein.

[0169] The MCIM compounds for use in combination with an NF-KB pathway inhibitor compound, such as an IRAKi compound (e.g. zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, and / or EVO101), an S1 PR modulator compound (e.g. etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, and cenerimod), or a TL1A inhibitor (e.g. tulisokibart (previously PRA023 / MK-7240), RVT-3101 (previously PF- 06480605), TEV-48574 (aka TEV’574), FG-M701, and SPY002), described herein conform to a pharmacophore model as described herein.

[0170] NF-KB pathway inhibitors

[0171] The NF-KB family of transcription factors control transcription of a wide range of genes involved in inflammation, including cytokines, and cell-survival. Aberrant / pathological NF-KB activation is associated with many inflammatory and progressive diseases, including IBD, arthritis, and multiple sclerosis. Aberrant NF-KB activity can be inhibited using various compounds which target the upstream components of the signalling cascade(s) that lead to NF-KB activation, for example IRAK inhibitors, S1 P receptor modulators and / or TL1A inhibitors. To determine if a compound is an NF-KB inhibitor, NF-KB inhibition can be measured using any standard method known in the art, for example, any of those assays disclosed in the Assay Guidance Manual (Trask, J. 2012), which is hereby incorporated by reference. Any suitable compound which inhibits transduction of signalling through the NF-KB pathway may find use in the invention.

[0172] The IRAK family of kinases are upstream components of the NF-KB signalling cascade. Following TLR or IL1R stimulation, IRAK family members are recruited to a signalling complex which leads to the activation of NF-KB through a kinase signalling cascade. Inhibition of IRAKi compounds therefore lead to the inhibition of NF-KB activation. Therefore, IRAKi compounds can be considered NF-KB pathway inhibitors.

[0173] IRAKi compounds which find use in the pharmaceutical compositions for use in treatment, pharmaceutical combinations, and methods of treatment disclosed herein include zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, and / or EVO101. Any IRAKi may be used in the combination with an MCIM compound to treat an inflammatory and / or progressive disease, for example an arthritic disease.

[0174] The S1 P receptor family may be activated by S1 P. Activation of S1 P receptor induces a signalling cascade which may result in the ubiquitination and degradation of NF-KB inhibitor proteins, thereby stimulating NF-KB activity. S1 P receptor modulators may stimulate internalisation and degradation of S1 P receptor, resulting in reduced S1 P receptor on the cell surface and consequently a reduced sensitivity of the cell to extracellular S1 P. S1 P receptor modulators therefore result in reduced S1 P receptor signalling and reduced NF-KB inhibitor complex degradation. This results in reduced NF-KB activation. S1 P receptor modulators may therefore be considered NF-KB pathway inhibitors. S1 PR modulators which find use in the pharmaceutical combinations / compositions, and the combinations / compositions for use in treatment, and methods of treatment disclosed herein, include etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, and cenerimod. S1 P receptor antagonists may also find use in the invention.

[0175] Activation of DR3 by TL1 A induces a signalling cascade which results in NF-KB activation. TL1 A inhibitors may therefore be considered NF-KB pathway inhibitors. DR3 overstimulation can result in aberrant NF-KB activity which may contribute to pathogenesis of various pathological conditions, including RA and IBD. While overstimulation of the TL1 A / DR3 signalling axis may contribute to disease progression, completely blocking DR3 signalling can inhibit tissue repair in the intestine (Jia et al., 20216). Moreover, aberrant TL1 A / DR3 signalling in the gastrointestinal tract is associated with intestinal fibrosis (Jacob et al., 2020). MCIM compounds disclosed herein can induce tissue repair, including repair of fibrotic lesions. MCIM compounds disclosed herein may therefore improve patient outcomes when combined with TL1 A inhibitors because the MCIM compounds stimulating tissue repair. TL1 A inhibitors which find use in the pharmaceutical combinations / compositions, and the combinations / compositions for use in treatment, and methods of treatment disclosed herein, include tulisokibart, RVT-3101, TEV-48574, FG-M701 , and SPY002.

[0176] Inflammatory and / or progressive diseases

[0177] As described herein, a combination of the mitochondrial Complex I modulator (MCIM) compound with an NF-KB pathway inhibitor is suitable for use in treating inflammatory and / or progressive diseases.

[0178] The disease may be a chronic progressive disease associated with fibrosis of the affected tissue(s), such as: intestinal fibrosis, colonic fibrosis, interstitial lung disease (ILD), idiopathic pulmonary fibrosis (IPF); pulmonary fibrosis; liver fibrosis; non-alcoholic steatohepatitis (NASH), non-alcoholic fatty liver disease (NAFLD); kidney fibrosis; chronic kidney disease (CKD); cardiac fibrosis; ischaemia reperfusion injury; heart failure with reduced ejection fraction, heart failure with preserved ejection fraction; myelofibrosis; retroperitoneal fibrosis; atherosclerosis; myocardial infarction; stroke; neurodegenerative disease; multiple sclerosis; fronto-temporal dementia (FTD); amyotrophic lateral sclerosis (ALS), Alzheimer’s disease (AD); osteoporosis, osteopenia; osteoarthritis; endometriosis; bone loss associated with endometriosis; neoplasia of bones (including, e.g., as a primary tumour or as metastases and including, e.g., bone cancer; osteosarcoma; or osteoma); cancer associated bone disease (including, e.g., metastatic bone disease associated with, e.g., breast cancer, lung cancer, prostate cancer, or multiple myeloma; changes in bone mineralisation and density associated with cancer, including, e.g., hypercalcaemia associated with cancer); and bone metastases (including, e.g., osteolytic bone metastases). The disease may be an autoimmune or autoinflammatory disease, such as: rheumatoid arthritis (RA); psoriatic arthritis; ankylosing spondylitis; spondyloarthritis; reactive arthritis; infectious arthritis; lupus; systemic lupus erythematosus; scleroderma; juvenile idiopathic arthritis; psoriasis; systemic lupus erythematosus; lupus nephritis; uveitis; systemic sclerosis; scleroderma; hepatitis; Sjogren’s syndrome; inflammatory bowel disease; ulcerative colitis; Crohn’s disease; multiple sclerosis; atherosclerosis; chronic obstructive pulmonary disease (COPD); uveitis; allergic disease (including, e.g., atopy, allergic rhinitis, atopic dermatitis, anaphylaxis, allergic bronchopulmonary aspergillosis, allergic gastroenteritis, hypersensitivity pneumonitis); type I diabetes; celiac disease; oophoritis; primary biliary cirrhosis; insulin-resistant diabetes; Behpet’s disease; myasthenia gravis; autoimmune polyneuritis; pemphigus; rheumatic carditis; Goodpasture’s syndrome; postcardiotomy syndrome; polymyositis; dermatomyositis; irritable bowel syndrome; pancreatitis; gastritis, chronic pulmonary inflammation; pulmonary alveolitis; polycystic kidney disease; cryopyrin-associated periodic syndrome (CAPS); Muckle-Wells Syndrome; Guillain-Barre syndrome; chronic inflammatory demyelinating polyneuropathy; dermatitis; atopic dermatomyositis; Graves’ disease; autoimmune (Hashimoto’s) thyroiditis; bronchitis; cystic fibrosis; pulmonary embolism; sarcoidosis; emphysema; respiratory failure; acute respiratory distress syndrome; BENTA disease; or polymyositis; SSC-ILD, hidradenitis suppurative, alopecia areata, atopic dermatitis, graft versus host disease (GVHD). Inflammatory bowel disease, ulcerative colitis and Crohn’s disease may be associated with intestinal and / or colonic fibrosis.

[0179] In some embodiments, tissue repair, disease regression, disease control (which includes, for example, preventing or slowing disease progression), increase in reparative cells, decrease in destructive cells and / or reduction in cytokine production from peripheral mononuclear cells or lymphoid cells (such as T-, B- or NK-cells) can be determined as defined herein. For instance, in some embodiments, the MCIM compound reduces the levels of inflammatory mediators such as TNFa, eSEL, CD38, CD40, CD69, slgG, SIL-17A, slL-17F, slL-2 and / or slL-6 that are produced by a target cell. In some embodiments, the MCIM compound reduces the levels of collagen type I and / or MMP1 , and / or increases collagen type IV production. In some embodiments, the MCIM compound increases ETC efficiency, without an increase in biomass. In some embodiments, the MCIM compound decreases ETC efficiency. In some embodiments, the MCIM compound reduces cellular proliferation without reducing ATP concentration / cell and viability, dependent on the environmental composition such as in the absence of pyruvate. In some embodiments, the MCIM compound induces an adaptive / repair response under conditions of metabolic stress conditions. For instance, the MCIM compound modulates Complex I activity and attenuates high energy processes such as proliferation and / or differentiation and concurrently induces an adaptive / repair response by increasing the production of pro-angiogenic / repair factors such as VEGF to restore tissue metabolic homeostasis, particularly under metabolic stress conditions. In some embodiments, the MCIM compound reduced cell viability, particularly in cell types which are heavily dependent on Complex I metabolism and lack the metabolic flexibility to adapt. Each of these effects on tissue repair, disease control, disease regression, increase in reparative cells, decrease in destructive cells and / or reduction in cytokine production from pro-inflammatory myeloid cells can be determined by comparing the effect in the presence and absence of the MCIM compound.

[0180] In some embodiments, lung fibroblasts are used as a target cell to determine the effect of the MCIM compound. For example, cellular adaptation may be determined in human primary lung fibroblasts, e.g. by measuring vascular endothelial growth factor (VEGF) secretion. (VEGF can be induced in a cell that is not receiving enough oxygen or nutrients to support ATP production. This can indicate how metabolic signalling pathways interact and integrate with angiogenic signalling events and repair). In some embodiments, VEGF secretion can be measured by plating primary human lung fibroblasts at 2 x 103cells / well in 96-well plates in 100 L DMEM complete medium with: 1 g / L glucose and 110 mg / L pyruvate; or 1 g / L glucose without pyruvate (each supplemented with 1% penicillinstreptomycin and 10% heat inactivated foetal bovine serum), and incubating in a humidified 37°C incubator with 5% CO2 for 24 hours. The test compound is prepared as a 10x final concentration solution in culture medium and added to final concentrations before further incubating the cells at 37°C / 5% CO2 for 24 hours. VEGF secretion is measured in the cell supernatants using Quantikine® ELISA Human VEGF kits according to the manufacturer’s instructions. Absorbance at 450 nm is measured on a BMG Plate reader (CLARIOstar plus) using pathlength correction. Background absorbance is measured at 540 nm. Preferably, treatment with the test compound results in an increase in VEGF secretion in the absence of pyruvate, but not in the presence of pyruvate as a metabolic substrate for the cell. This indicates the induction of an adaptive / repair response under conditions of metabolic stress conditions via the attenuation of highly energy-consuming processes such as proliferation and concurrent production of pro-angiogenic / repair factors such as VEGF to restore tissue metabolic homeostasis.

[0181] Disease control may be achieved by treatment with the compositions of the invention. Disease control can comprise inhibition of disease progression and / or control of disease symptoms. Inhibition of disease progression includes prevention of disease progression and slowing down disease progression. Standard methods in the art may be employed to determine disease progression.

[0182] Evaluating disease repair in human and animal subjects

[0183] Chronic autoimmune diseases are amenable to treatment with a combination of the Complex I modulator (MCIM) compound as described herein with an NF-KB pathway inhibitor, for example and IRAKi compound, an S1 PR modulator compound, and / or a TL1A inhibitor. Such diseases include RA, IBD, Ulcerative colitis (UC), Psoriatic arthritis (PsA), and psoriasis. As described herein, the MCIM compound can elicit tissue repair and disease regression, and this may be increased when combined with an NF-KB pathway inhibitor. In RA and PsA, for example, repair / healing can be clinically assessed using standard methods in the art including imaging methods such as MRI, computer tomography or ultrasonography, and / or by measuring functional responses. For example, the response to treatment in RA may be assessed via the American College of Rheumatology (ACR) Criteria, the Disease Activity Score (DAS) or by patient reported outcomes such as pain or physical function.

[0184] Histopathological assessment may be used to determine the effect of an MCIM compound and an MCIM compound in combination with an NF-KB pathway inhibitor on arthritis using animal models (as described in Example 5): For example, for the assessment of arthritis, the following signs are monitored in digits or limbs of each subject three times per week and summed to generate the Arthritic Index (Al). (The maximum Al for one animal is 16):

[0185] 0: no visible effects of arthritis. 1 : oedema and / or erythema of 1 digit. 2: oedema and / or erythema of 2 digits. 3: oedema and / or erythema of more than 2 digits. 4: severe arthritis of entire paw and digits. In some embodiments, the MCIM compound in combination with an NF-KB pathway inhibitor reduces the average score compared with subjects treated with a negative control, MCIM compound alone and / or an NF-KB pathway inhibitor alone. In a subject suffering from arthritis, inhibition of disease progression may be indicated by a stable Arthritic Index (Al) score, or any other suitable method known in the art. Other suitable clinical scoring methods known in the art include the ACR / EULAR 2010 scoring criteria (ACR / EULAR score), “disease activity score at 28 joints” criteria (DAS28 score), “health assessment questionnaire disability index” (HAQ-DI score), “clinical disease activity index” (CDAI score), “simplified disease activity index” (SDAI score), “American College of Rheumatology response criteria" (also known as “ACR20 / 50 / 70 response”; ACR20 / 50 / 70 score), European league against rheumatism response criteria (EULAR score), “Modified total Sharp / van der Heijde score” (mTSS score), and / or the “routine assessment of patient index data 3 score” (RAPID3 score). For example, inhibition of disease progression may be determined by comparing the Al score, ACR / EULAR score, DAS38 score, HAQ-DI score, CDAI score, SDAI score, ACR20 / 50 / 70 score, EULAR score, mTSS score, and / or RAPID3 score of a subject before, during and / or after receiving treatment with an MCIM compound and an NF-KB pathway inhibitor. Inhibition of disease progression may be indicated by the Al score, ACR / EULAR score, DAS38 score, HAQ-DI score, CDAI score, SDAI score, ACR20 / 50 / 70 score, EULAR score, mTSS score, and / or RAPID3 score being stable (i.e. not changing) over time following treatment. Inhibition of disease progression may be indicated by the Al score, ACR / EULAR score, DAS38 score, HAQ-DI score, CDAI score, SDAI score, ACR20 / 50 / 70 score, EULAR score, mTSS score, and / or RAPID3 score progressing or increasing at a slower rate following treatment. Disease control in Arthritis may be determined by any suitable method known in the art. In some embodiments, the MCIM compound in combination with the NF-KB pathway inhibitor is for use in the treatment of arthritis to reduce the average arthritic score (e.g. , Al score, ACR / EULAR score, DAS38 score, HAQ-DI score, CDAI score, SDAI score, ACR20 / 50 / 70 score, EULAR score, mTSS score, and / or RAPID3 score) compared to administration of MCIM compound or a NF-KB pathway inhibitor alone. In some embodiments, the MCIM compound in combination with an NF-KB pathway inhibitor reduces the Al score, ACR / EULAR score, DAS38 score, HAQ-DI score, CDAI score, SDAI score, ACR20 / 50 / 70 score, EULAR score, mTSS score, and / or RAPID3 score in a subject by at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%.

[0186] In a subject suffering from arthritis, inhibition of disease progression may be indicated by a stable Arthritic Index (Al) score, or any other suitable method known in the art. For example, inhibition of disease progression may be determined by comparing the Al score from a subject before and after treatment with the composition of the invention. Inhibition of disease progression may be indicated by the Al score being stable (i.e. not changing) over time following treatment. Inhibition of disease progression may be indicated by the Al score progressing or increasing at a slower rate following treatment. Disease control in Arthritis may be determined by any suitable method known in the art.

[0187] In IBD, repair / healing can be clinically assessed using gut transit time, occult blood, endoscopy, histopathology, electrolytes and / or by measuring biomarkers such as pANCA, ASCA, GP2, CUZD1, CHI3L1, GM-CSF, AGA, PS / PT, ALGA, ACCA, AMCA, OmpC, I2, Cbirl , Laminarin, Chitin, IFI16, IL- 1 p, IL-6, IL-8, IL-9, IFN-y, TNF, CCL2, IL-22, IL-2, and / or IL-6, as disclosed in Chen et al (2020) which is incorporated herein in its entirety by reference.

[0188] In some embodiments, a histopathological assessment can be used to determine the effect of the MCIM compound and the MCIM compound in combination with an NF-KB pathway inhibitor on IBD: lleo-caecal issue sections can be stained with Haematoxylin and Eosin (H&E) and parameters of inflammation, mucosal erosion, epithelial hyperplasia, epithelial metaplasia, mucus cell metaplasia, and fibroplasia are assessed on a scale of 0-5 as follows:

[0189] 0: normal. 1 : minimal, focal. 2: moderate, focal. 3: moderate, multi-focal or diffuse. 4: marked, focal.

[0190] 5: marked, multi-focal or diffuse. In some embodiments, the MCIM compound in combination with the NF-KB pathway inhibitor reduces the average score compared with a subject treated with a negative control, MCIM compound alone and / or an NF-KB pathway inhibitor alone. In some embodiments, the MCIM compound in combination with the NF-KB pathway inhibitor is for use in the treatment of IBD to reduce the average IBD score compared to administration of MCIM or NF-KB pathway inhibitor alone. In some embodiments, the average score is reduced by at least 1, at least 2, at least 3, at least 4, or 5. In some embodiments, the MCIM compound in combination with a NF-KB pathway inhibitor prevents disease progression and can be indicated by no further increase in the average score compared following treatment.

[0191] In multiple sclerosis, repair / healing can be clinically assessed using McDonald criteria, Doppler ultrasound, analysis of conduction defects and / or magnetic resonance imaging (MRI). In some embodiments, the MCIM compound in combination with an NF-KB pathway inhibitor increases ramified (‘resting’) microglia and / or increases mean oligodendrocyte progenitor cell (OPC) score in MS subjects, compared with MS subjects treated with a negative control, or either an MCIM compound or an NF-KB pathway inhibitor. In some embodiments, a histopathological assessment can be used to determine the effect of the MCIM compound in combination with the NF-KB pathway inhibitor on multiple sclerosis (MS). For this assessment of MS, spinal cord sections can be stained with Masson’s Trichome (MT) to assess fibrosis using the Ashcroft score, and Haematoxylin and Eosin (H&E) to assess parameters of inflammation, demyelination and pyknosis. The following scoring system is used to assess these parameters:

[0192] Grade 0: Normal, no pathology. Grade 1 : minimal, Single focal lesion in one section. Grade 2: moderate, Single focal lesion in 2+ sections. Grade 3: moderate, multi-focal lesions in one section. Grade 4: multi-focal lesions in 2+ sections. Grade 5: marked, diffuse pathology.

[0193] In some embodiments, sections can be stained using A2B5 immunohistochemistry to assess oligodendrocyte progenitor cells. Cells are counted to assess this parameter.

[0194] In psoriasis, repair / healing can be clinically assessed using Doppler ultrasound or by histological analysis of biopsy samples.

[0195] In pulmonary conditions, repair / healing can be clinically assessed using high-resolution computed tomography (HRCT), MRI, exacerbation frequency and / or by measuring biomarkers and / or pulmonary surfactant proteins. For example, in pulmonary fibrosis biomarkers which may be measured include ATF3, PPP1 R15A, ZFP36, SOCS3, NAMPT, GADD45B, COL15A1, GIMPAP6, JAM2, LMO7, TSPAN13, LAMA3, GDF15, FGF-21 , MUC1 and ANXA3, as disclosed in Maghsoudloo et al (2020).

[0196] In steatohepatitis such as NASH and NAFLD, repair / healing can be clinically assessed using imaging to measure liver distension, biopsy (Ishak score, Metavir score and / or Knodell score) and histopathology, liver function tests such as measures of albumin, total protein, alkaline phosphatase (ALP), aspartate aminotransferase (AST), gamma-glutamyl transferase (GGT), bilirubin, lactate dehydrogenase (LD) or prothrombin time (PT) and / or by measuring biomarkers. For example, in liver fibrosis biomarkers which may be measured include Type IV collagen, laminin, MMPs, TIMPs, YKL- 40, P3NP, TGF-b1 , MFAP-4, or combinatorial biomarkers such as APRI, AST / ALT ratio, ELF index and / or fibro index, among others (Nallagangula KS et al, 2018).

[0197] In chronic kidney disease, repair / healing can be clinically assessed using histological assessment of biopsy samples, kidney functional tests such as glomerular filtration rate (GFR), estimated GFR (eGFR) and / or by measuring biomarkers. For example, in kidney fibrosis biomarkers which may be measured include creatinine, neutrophil gelatinase-associated lipocalin (NGAL), kidney injury molecule-1 (KIM-1 ), N-acetyl-p-D-glucosaminidase (NAG), liver-type fatty acid binding protein (L- FABP), and uromodulin (UMOD) (Lousa, I et al, 2021 ).

[0198] In some embodiments, tissue repair, disease regression, disease control (which includes, for example, preventing or slowing disease progression), increase in reparative cells, decrease in destructive cells and / or reduction in cytokine production from peripheral mononuclear cells or lymphoid cells (such as T-, B- or NK-cells) can be determined as defined herein. For instance, in some embodiments, the combination therapy reduces the levels of inflammatory mediators such as TNFa, eSEL, CD38, CD40, CD69, slgG, SIL-17A, sll_-17F, slL-2 and / or slL-6 that are produced by a target cell. In some embodiments, the combination therapy increases Coll IV expression. In some embodiments, the combination therapy increases ETC efficiency, without an increase in biomass. In some embodiments, the combination therapy reduces cellular proliferation without reducing ATP concentration / cell and viability, in the absence of pyruvate. In some embodiments, the combination therapy induces an adaptive / repair response under conditions of metabolic stress conditions, reducing cell death. For instance, the MBS compound modulates Complex I activity and attenuates high energy processes such as proliferation and concurrently induces an adaptive / repair response by increasing the production of pro-angiogenic / repair factors such as VEGF to restore tissue metabolic homeostasis, particularly under metabolic stress conditions. Each of these effects on tissue repair, disease regression, increase in reparative cells, decrease in destructive cells and / or reduction in cytokine production from pro-inflammatory myeloid cells can be determined by comparing the effect in the presence and absence of the combination therapy.

[0199] Disease control may be achieved by treatment with an MCIM compound and an NF-KB pathway inhibitor. Disease control can comprise inhibition of disease progression, control of disease symptoms and / or supporting tissue repair. Inhibition of disease progression includes prevention of disease progression and slowing down disease progression. Standard methods in the art, such as those disclosed above, may be employed to determine disease progression. Inhibition of disease progression, for example in subjects suffering from arthritis, IBD, multiple sclerosis, pulmonary diseases, such as IPF, steatohepatitis, such as NASH and NAFLD, and chronic kidney disease may be determined by the histopathological methods described above, or any other suitable method known in the art. For example, inhibition of disease progression may be determined by comparing histopathological results from a subject before and after treatment with the compositions disclosed herein. Inhibition of disease progression may be indicated by the histopathological score being stable (i.e. not changing) over time following treatment. Inhibition of disease progression may be indicated by the histopathological score progressing at a slower rate following treatment compared to disease progression before treatment.

[0200] Pharmaceutical combinations

[0201] A pharmaceutical combination as disclosed herein refers to a combination comprising two or more active compounds. A pharmaceutical combination may comprise two or more compositions each comprising at least one active compound. In such embodiments, the two or more compositions may be administered separately, sequentially or simultaneously. For example, the pharmaceutical combination may comprise a first composition comprising an MCIM compound, such as HMC-C-01-A, and a second composition comprising an NF-KB pathway inhibitor, such as zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, EVO101, etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, cenerimod, tulisokibart, RVT-3101, TEV-48574, FG-M701 , and SPY002, or any combination of the foregoing. The first and second composition may be administered separately, sequentially or simultaneously.

[0202] Alternatively, a pharmaceutical combination may comprise a single composition comprising two or more active compounds. For example, the combination may comprise a single composition comprising an MCIM compound and an NF-KB pathway inhibitor, for example an IRAKI compound, an S1 PR modulator compound, and / or a TL1 A inhibitor. In some embodiments, the MCIM compound comprises HMC-C-01-A. In some embodiments, the IRAKi compound comprise one or more compounds selected from zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, EVO101 , or any combination of the foregoing. In some embodiments, the composition comprises the MCIM compound HMC-C-01-A and an IRAKi compound selected from zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, EVO101 , or a combination thereof. In some embodiments, the composition comprises the MCIM compound HMC-C-01-A and the IRAKi compound zimlovisertib.

[0203] In some embodiments, the NF-KB pathway inhibitor comprises an IRAKi compound and the inflammatory and / or progressive disease is RA. In some embodiments, the IRAKi compound comprises zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS- 5718, R289, R835 prodrug, EVO101 , or a combination of any of the foregoing, and the inflammatory and / or progressive disease is RA. In some embodiments, the NF-KB pathway inhibitor comprises an IRAKi compound and the inflammatory and / or progressive disease is an inflammatory bowel disease, such as Crohn’s disease or ulcerative colitis. In some embodiments, the IRAKi compound comprises zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, EVO101 , or any combination of the foregoing, and the inflammatory and / or progressive disease is an inflammatory bowel disease, such as Crohn’s disease or ulcerative colitis. In some embodiments, the NF-KB pathway inhibitor comprises an IRAKi compound and the inflammatory and / or progressive disease is lupus erythematosus. In some embodiments, the IRAKi compound comprises zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, EVO101 , or a combination of any of the foregoing, and the inflammatory and / or progressive disease is lupus erythematosus. In some embodiments, the NF- KB pathway inhibitor comprises an IRAKi compound and the inflammatory and / or progressive disease is psoriatic arthritis. In some embodiments, the IRAKi compound comprises zimlovisertib, zabedosertib, emavusertib, KT-474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, EVO101, or a combination of any of the foregoing, and the inflammatory and / or progressive disease is psoriatic arthritis. In some embodiments, the NF-KB pathway inhibitor comprises an IRAKi compound and the inflammatory and / or progressive disease is reactive arthritis. In some embodiments, the IRAKi compound comprises zimlovisertib, zabedosertib, emavusertib, KT- 474 / SAR444656, KT-413, BAY1830839, GS-5718, R289, R835 prodrug, EVO101, or a combination thereof, and the inflammatory and / or progressive disease is reactive arthritis. In any of the foregoing embodiments, the MCIM compound may be HMC-C-01-A.

[0204] In some embodiments, the NF-KB pathway inhibitor comprises an S1 PR modulator compound and the inflammatory and / or progressive disease is MS. In some embodiments, the S1 PR modulator is selected from etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, cenerimod, or any combination thereof, and the inflammatory and / or progressive disease is MS. In some embodiments, the NF-KB pathway inhibitor comprises an S1 PR modulator compound and the inflammatory and / or progressive disease is IBD. In some embodiments, the S1 PR modulator is selected from etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, cenerimod, or any combination thereof, and the inflammatory and / or progressive disease is IBD. In some embodiments, the NF-KB pathway inhibitor comprises an S1 PR modulator compound and the inflammatory and / or progressive disease is ulcerative colitis. In some embodiments, the S1 PR modulator is selected from etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, cenerimod, or any combination thereof, and the inflammatory and / or progressive disease is ulcerative colitis. In some embodiments, the NF-KB pathway inhibitor comprises an S1 PR modulator compound and the inflammatory and / or progressive disease is psoriasis. In some embodiments, the S1 PR modulator is selected from etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, cenerimod, or any combination thereof, and the inflammatory and / or progressive disease is psoriasis. In some embodiments, the NF-KB pathway inhibitor comprises an S1PR modulator compound and the inflammatory and / or progressive disease is GvHD. In some embodiments, the S1 PR modulator is selected from etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, cenerimod, or any combination thereof, and the inflammatory and / or progressive disease is GvHD. In any of the foregoing embodiments, the MCIM compound may be HMC-C-01-A.

[0205] In some embodiments, the NF-KB pathway inhibitor comprises a TL1 A inhibitor and the inflammatory and / or progressive disease is an IBD, for example ulcerative colitis, Crohn’s disease or fistulising Crohn’s disease. In some embodiments, the TL1A inhibitor is selected from tulisokibart, RVT-3101 , TEV-48574, FG-M701 , and SPY002, or any combination thereof, and the inflammatory and / or progressive disease is an IBD. In some embodiments, the NF-KB pathway inhibitor comprises a TL1A compound and the inflammatory and / or progressive disease is RA. In some embodiments, the TL1A inhibitor is selected from tulisokibart, RVT-3101 , TEV-48574, FG-M701, and SPY002, or any combination thereof, and the inflammatory and / or progressive disease is RA. In some embodiments, the NF-KB pathway inhibitor comprises a TL1 A inhibitor and the inflammatory and / or progressive disease is psoriasis. In some embodiments, the TL1 A inhibitor is selected from tulisokibart, RVT- 3101 , TEV-48574, FG-M701 , and SPY002, or any combination thereof, and the inflammatory and / or progressive disease is psoriasis. In some embodiments, the NF-KB pathway inhibitor comprises a TL1 A inhibitor and the inflammatory and / or progressive disease is ankylosing spondylitis. In some embodiments, the TL1A inhibitor is selected from tulisokibart, RVT-3101, TEV-48574, FG-M701, and SPY002, or any combination thereof, or any combination thereof, and the inflammatory and / or progressive disease is ankylosing spondylitis. In some embodiments, the NF-KB pathway inhibitor comprises a TL1 A inhibitor and the inflammatory and / or progressive disease is fibrosis, for example intestinal fibrosis. In some embodiments, the TL1A inhibitor is selected from tulisokibart, RVT-3101 , TEV-48574, FG-M701 , and SPY002, or any combination thereof, and the inflammatory and / or progressive disease is fibrosis, for example intestinal fibrosis. In any of the foregoing embodiments, the MCIM compound may be HMC-C-01-A.

[0206] Pharmaceutical compositions

[0207] Medicaments and pharmaceutical compositions according to the aspects disclosed herein may be formulated for administration by a number of routes, including but not limited to, parenteral i.e. nonoral route (for example, by injection: sub-cutaneous, intravenous, intra-arterial, intramuscular, or intratumoral; by topical or intradermal; by inhalation or intranasal; or by rectal), and peroral i.e. oral route. The medicaments and compositions may be formulated in a solid, semi-solid, or liquid dosage form. The pharmaceutical compositions according to this invention may be delivered by a route which facilitates exposure in the systemic circulation or by a route or method which gives rise to localised, targeted, delivery of the active compounds to a selected region in the body. The pharmaceutical compositions according to this invention may also be administered to humans or animals.

[0208] Administration is preferably in a “therapeutically effective amount”, this being sufficient to show benefit to the individual. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of the disease being treated. For example, the rate of release of the active compounds from the pharmaceutical composition may be immediate, sustained, extended, controlled, pulsatile or follow a pattern that is optimal for the intended therapeutic application. The frequency of dosing can be fixed or variable depending on the rate of drug release, the required level in the systemic circulation or at the target site to provide the desired therapeutic effect. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of physicians and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington’s Pharmaceutical Sciences, 23rdEdition, 2020, pub. Lippincott, Williams & Wilkins. The disclosure provides pharmaceutical combinations comprising a MCIM compound and an NF-KB pathway inhibitor. In some embodiments, the combination may comprise a single composition comprising the MCIM compound and the NF-KB pathway inhibitor. In other embodiments, the pharmaceutical combination may comprise a first composition comprising a MCIM compound and a second composition comprising an NF-KB pathway inhibitor. In other embodiments, the combination comprises a first composition comprising a MCIM compound and a second compositions comprising two or more NF-KB pathway inhibitors. In embodiments wherein the combination comprises two or more NF-KB pathway inhibitors, the two or more NF-KB pathway inhibitors may be formulated as individual compositions comprising a single NF-KB pathway inhibitor.

[0209] Pharmaceutical compositions may be prepared using a pharmaceutically acceptable “carrier” composed of materials, also known as excipients, that are generally considered safe and pharmacologically inert. “Pharmaceutically acceptable” refers to molecular entities and compositions that are “generally regarded as safe - GRAS”, e.g., that are physiologically tolerable and do not typically produce adverse or untoward effects when administered to a human. In some embodiments, this term refers to molecular entities and compositions approved by a regulatory agency of the US federal or a state government, as the GRAS list under section 204(s) and 409 of the Federal Food, Drug and Cosmetic Act, that is subject to premarket review and approval by the FDA or similar lists, the U.S. Pharmacopeia or another generally recognised pharmacopeia for use in animals, and more particularly in humans.

[0210] The term “carrier” refers to excipients that serve one or more functions in the pharmaceutical compositions, for example, as diluents, binders, lubricants, glidants, disintegrants, solubilisers or solubility enhancers, stabilisers, preservatives, taste-masking or taste-modifying agents, flavourant, and / or colourant. The pharmaceutical compositions, when formulated as a solid dosage form, may further be uncoated or coated with an outer layer to impart aesthetic features, physical protection, enhance the physical and / or chemical stability of the active compounds or other constituents of the pharmaceutical compositions, and / or alter the rate of dissolution and release of the active compounds from the pharmaceutical compositions. The pharmaceutical compositions, when formulated as a parenteral injectable dosage form, may additionally contain aqueous or non-aqueous solvents, cosolvent mixtures, buffering agents, surfactants, tonicity modifying agents, chelating agents, pH modifiers, viscosity modifiers, and / or suspending agents. The pharmaceutical compositions, when formulated as a parenteral dosage form for inhalation, may additionally contain particle carriers for the pulmonary delivery of the active compounds, absorption penetration enhancers, and / or propellants, dependent on the inhalation delivery device to be used. Those with skill in the art are familiar with such pharmaceutical carriers, excipients therein, and methods of compounding these excipients into pharmaceutical compositions. Suitable excipients for use in the pharmaceutical compositions can be found in standard pharmaceutical texts, for example, Handbook of Pharmaceutical Excipients, 9thedition, Pharmaceutical Press, American Pharmaceutical Association, 2020. The pharmaceutical compositions provided herein may include one or more excipients, e.g., solvents, solubility enhancers, suspending agents, buffering agents, isotonicity agents, antioxidants or antimicrobial preservatives. When used, the excipients of the compositions will not adversely affect the stability, bioavailability, safety, and / or efficacy of the active ingredients, i.e. the MCIM compound and / or the TNF inhibitor compound used in the composition. Thus, the skilled person will appreciate that compositions are provided wherein there is no incompatibility between any of the components of the dosage form. Excipients may be selected from the group consisting of buffering agents, solubilizing agents, tonicity agents, chelating agents, antioxidants, antimicrobial agents, and preservatives. Suitable carriers, diluents, excipients, etc. can be found in standard pharmaceutical texts, for example, Handbook of Pharmaceutical Excipients, 9thedition, Pharmaceutical Press, American Pharmacists Association, 2020.

[0211] The choice of the pharmaceutical carrier is dependent on the dosage form type, the dose, intended route of delivery, the physicochemical properties of the active compounds, and the required bioavailability and / or exposure profile. When used, the excipients of the pharmaceutical compositions should not adversely affect the stability, bioavailability, safety, and / or therapeutic efficacy of the active compounds, i.e. the MCIM compound and / or the NF-KB pathway inhibitor used in the pharmaceutical compositions. Thus, the skilled person will appreciate that pharmaceutical compositions are provided wherein there is no significant incompatibility between any of the components of the dosage form.

[0212] It may be convenient or desirable to prepare, purify, and / or handle a corresponding solvate or pharmaceutically-acceptable salt of the active compound(s), for example, a corresponding solvate or a pharmaceutically-acceptable salt of an MCIM compound, for example HMC-C-01-A, or an NF-KB pathway inhibitor. The term “solvate” is used herein in the conventional sense to refer to a complex of solute (e.g., active compound, salt of active compound) and solvent. If the solvent is water, the solvate may be conveniently referred to as a hydrate, for example, a mono-hydrate, a di-hydrate, a trihydrate, etc. Unless otherwise specified, a reference to a particular compound also includes the solvate forms thereof. Examples of pharmaceutically acceptable salts are discussed in Berge et al., 1977, “Pharmaceutically Acceptable Salts,” J. Pharm. Set, Vol. 66, pp. 1-19. For example, if the compound is anionic, or has a functional group which may be anionic (e.g., COOH may be COO), then a salt may be formed with a suitable cation. If the compound is cationic, or has a functional group which may be cationic (e.g., NH2 may be NH3+), then a salt may be formed with a suitable anion. Unless otherwise specified, a reference to a particular compound also include salt forms thereof.

[0213] Coformulations

[0214] The pharmaceutical compositions according to this invention include, but are not limited to, dosage forms wherein the active compounds are co-formulated uniformly in a common excipient base, such as a conventional single-layer tablet or conventional powder-in-capsule for oral administration; a solution, suspension or dispersed system for parenteral administration; a lotion, cream, ointment for topical administration; a transdermal patch, microneedle or autoinjector system for transdermal administration; a dry powder, solution or suspension for inhalation administration; and a solution or suspension for intranasal administration. Alternative pharmaceutical compositions, particularly useful for solid dosage forms for oral administration, are provided according to this invention wherein the active compounds are physically separated within a single pharmaceutical composition to avoid the potential for physical and chemical interactions and incompatibilities. Such pharmaceutical compositions include, but are not limited to, a bi- / multi-layer tablet, wherein the formulation of each layer is optimised for each active compound, which can be combined in a single pharmaceutical composition by conventional tablet compression. Such pharmaceutical compositions may also include a single-layer or bi- / multi-layer tablet wherein one of the active compounds is contained within a layer that is coated on the outside of the singlelayer or bi- / multi-layer compressed tablet core, thus, providing a physical separation of the active compounds and their associated excipient systems. A further alternative pharmaceutical composition according to this invention is a multi-particulate capsule, wherein the formulation of each active compound in a particulate / granular form can be optimised, then combined and encapsulated into a conventional capsule as a single pharmaceutical composition.

[0215] The methods for the preparation of the pharmaceutical compositions accordingly to this invention are well known to the skilled person in the art and are well described in standard pharmaceutical formulation textbooks, such as Remington, The Science and Practice of Pharmacy, Editor: Adeboye Adejare, 23rdedition, 2020, publisher: Elsevier, Aulton’s Pharmaceutics, The Design and Manufacture of Medicines, editors: Kevin Taylor and Michael Aulton, 6thedition, 2021 publisher: Elsevier, and Lachman / Liebermans: The Theory and Practice of Industrial Pharmacy, Editors: Roop Khar, SP Vyas, Farnham Ahmad, Gaurav Jain, 4thedition, 2014, publisher: CBS.

[0216] Sequence Listing

[0217] Human NDUFS2 amino acid sequence SEQ ID NO: 1 :

[0218] MAALRALCGFRGVAAQVLRPGAGVRLPIQPSRGVRQWQPDVEWAQQFGGAVMYPSKETAHWKPP PWNDVDPPKDTIVKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQA LPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFF WLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIW RNRTIDIGWTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRV EEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEA PKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADWAIIGTQDIVFGEVDR

[0219] Human NDUFS7 amino acid sequence SEQ ID NO:2:

[0220] MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAK LDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMA PALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSWRGCDRIVPVDIYIPGCPPTAEALLYGILQLQ RKIKRERRLQIWYRR The features disclosed in the foregoing description, or in the following claims, or in the accompanying drawings, expressed in their specific forms or in terms of a means for performing the disclosed function, or a method or process for obtaining the disclosed results, as appropriate, may, separately, or in any combination of such features, be utilised for realising the invention in diverse forms thereof.

[0221] While the invention has been described in conjunction with the exemplary embodiments described above, many equivalent modifications and variations will be apparent to those skilled in the art when given this disclosure. Accordingly, the exemplary embodiments of the invention set forth above are considered to be illustrative and not limiting. Various changes to the described embodiments may be made without departing from the spirit and scope of the invention.

[0222] For the avoidance of any doubt, any theoretical explanations provided herein are provided for the purposes of improving the understanding of a reader. The inventors do not wish to be bound by any of these theoretical explanations.

[0223] Any section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.

[0224] Throughout this specification, including the claims which follow, unless the context requires otherwise, the word “comprise” and “include”, and variations such as “comprises”, “comprising”, and “including” will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps.

[0225] It must be noted that, as used in the specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Ranges may be expressed herein as from “about” one particular value, and / or to “about” another particular value. When such a range is expressed, another embodiment includes from the one particular value and / or to the other particular value. Similarly, when values are expressed as approximations, by the use of the antecedent “about,” it will be understood that the particular value forms another embodiment. The term “about” in relation to a numerical value is optional and means for example + / - 10%.

[0226] Examples

[0227] EXAMPLE 1 - BioMAP profiling

[0228] A high-throughput integrative biology platform (BioMAP ®) was used to profile the effect of MCIM compounds on multiple disease-associated regulatory pathways. BioMAP® has been developed as a method to assess efficacy, safety and the mechanism of action of drugs in multiple human cell types stimulated with inflammatory challenges as described in US6656695, which is incorporated herein in its entirety. The BioMAP system reflects human disease pathology and has the ability to detect and distinguish the effects of approved drugs and investigational human therapeutic compounds. BioMAP technology enables rapid determination of efficacy, side effects and mechanism of action of drug candidates.

[0229] BioMAP® provides an unbiased, target-agnostic and data-driven approach to understanding compound or combination therapy impact on human disease models and translational biomarkers. The system is validated with clinically approved drugs and known test agents. The principle of the assay is to test compounds in human primary cell-based disease systems, and compare the data with a Reference Database of over 4,500 compounds. The profile of a compound can be compared against a reference compound to see if the biological activity of the test item is differentiated from the reference.

[0230] The activity of MCIM compounds was determined in three BioMAP systems; Fibrosis panel, Autoimmune panel HDFSAg and Diversity Plus.

[0231] Thirteen primary human cell and co-culture assays were used to assess the effects of MCIM compounds on clinically relevant protein biomarkers of inflammation, cell growth, and fibrosis as part of the quality controlled BioMAP® Diversity PLUS, commercially available service (Eurofins Discover Corporation, Freemont, CA, USA; for full details https: / / www.discoverx.com). Briefly, the BioMAP® panels consist of human primary cell-based systems designed to model different aspects of the human body in an in vitro format. The 12 cell assays utilised in the Diversity PLUS panel allow characterisation of test agent responses in an unbiased way across a broad set of systems modelling various human disease states compared to historical controls. BioMAP® panels are constructed with primary cell types from healthy human donors, with stimuli (such as cytokines or growth factors) added to capture relevant signalling networks that naturally occur in human tissue or pathological conditions.

[0232] MCIM Compounds were tested in these assays at four concentrations: 4000 nM, 1300 nM, 400 nM & 150 nM. Human primary cells employed in the BioMAP® systems were used at passage 4 or earlier, derived from multiple donors (n = 2-6), commercially purchased and handled according to the recommendations of the manufacturers. Human blood derived CD14 + monocytes were differentiated into macrophages in vitro before being added to the LPS system (Eurofins DiscoverX Corporation).

[0233] The human cell types and stimuli used in each assay system were as follows: 3 C system [human umbilical vein endothelial cells (HUVEC) + (IL-1 p, TNFa and IFNy)], 4H system [HUVEC + (IL-4 and histamine)], lipopolysaccharide (LPS) system [peripheral blood monocyte cells (PBMC) and HUVEC + LPS (TLR4 ligand)], Sag system [peripheral blood mononuclear cells, PBMC and HUVEC + TCR ligands], HDFSAg system [peripheral blood mononuclear cells, PBMC and human neonatal dermal fibroblasts + TCR ligands], BT system [CD19 + B cells and PBMC + (a-IgM and TCR ligands)], BF4T system [bronchial epithelial cells and human neonatal dermal fibroblasts, HDFn, + (TNFa and IL-4)], BE3C system [bronchial epithelial cells + (IL-1 p, TNFa and IFNy)], CASM3C system [coronary artery smooth muscle cells + (IL-1 p, TNFa and IFNy)], HDF3CGF system [HDFn + (IL-1 p, TNFa, I FN Y, EGF, bFGF and PDGF-BB)], KF3CT system [keratinocytes and HDFn + (IL-10, TNFa, IFNy and TGF0)], MyoF system [differentiated lung myofibroblasts + (TNFa and TGF0)], SAEMyoF system [small airway epithelial cells and differentiated lung myofibroblasts + (TNFa and TGF0)], ReMyoF system [renal epithelial cells and differentiated lung myofibroblasts + (TNFa and TGFp)] and IMphg system [HUVEC and M1 macrophages + Zymosan (TLR2 ligand)].

[0234] Assays were derived from either single cell types or co-culture systems. Adherent cell types were cultured in 96 or 384-well plates until confluence, followed by the addition of PBMC (Sag and LPS systems). The BT system consisted of CD19 + B cells co-cultured with PBMC and stimulated with a BCR activator and low levels of TCR stimulation. Test agents prepared in either DMSO (small molecules; final concentration < 0.1%) or PBS (biologies) were added at the indicated concentrations 1 h before stimulation, and cells remained in culture for 24 h or as otherwise indicated [48 h, MyoF system; 72 h, BT system (soluble readouts); 168 h, BT system (secreted IgG)]. Each assay plate contained negative controls (e.g., non-stimulated conditions) and vehicle controls (e.g., 0.1% DMSO) appropriate for each system. Direct ELISA was used to measure biomarker levels of cell-associated and cell membrane targets. Soluble factors from supernatants were quantified using either HTRF® detection, bead-based multiplex immunoassay, or capture ELISA. Overt adverse effects of (compounds) on cell proliferation and viability (cytotoxicity) were detected by sulforhodamine B (SRB) staining for adherent cells, and alamarBlue® reduction for cells in suspension. For proliferation assays, individual cell types were cultured at subconfluence and measured at time points optimised for each system (48 h: 3 C and CASM3C systems; 72 h: BT and HDF3CGF systems; 96 h: HDFSAg and Sag system). Cytotoxicity for adherent cells was measured by SRB (24 h: 3 C, 4H, LPS, Sag, HDFSag, BF4T, BE3C, CASM3C, HDF3CGF, KF3CT, and IMphg systems; 48 h: MyoF system), and by alamarBlue® staining for cells in suspension (24 h: HDFSAg and Sag system; 42 h: BT system) at the time points indicated.

[0235] Biomarker measurements in treated samples were divided by the average of the control samples (at least 6 vehicle controls from the same plate) to generate a ratio that was then log 10 transformed. Significance prediction envelopes were calculated using proprietary historical vehicle control data at a 95% confidence interval. Biomarker activities were annotated when two or more consecutive concentrations change in the same direction relative to vehicle controls were outside of the significance envelope and had at least one concentration with an effect size > 20% (Iog10 ratio 0.1 ). Biomarker key activities were described as modulated if these activities increase in some systems but decrease in others. Cytotoxic conditions were noted when total protein levels decreased by more than 50% (log 10 ratio of SRB or alamarBlue® levels < -0.3) and were indicated by a thin black arrow above the X-axis. A compound was considered to have broad cytotoxicity when cytotoxicity was detected in 3 or more systems. Concentrations of test agents with detectable broad cytotoxicity were excluded from biomarker activity annotation and downstream benchmarking, similarity search and cluster analysis. Antiproliferative effects were defined by an SRB or alamar Blue® log 10 ratio value < -0.1 from cells plated at a lower density and were indicated by grey arrows above the X-axis. Cytotoxicity and antiproliferative arrows only require one concentration to meet the indicated threshold for profile annotation.

[0236] Figure 2 shows the BioMAP profile of several MCIM compounds. (A) ABD599 tested in the full bioMAP profile shows decreased inflammation and immune modulation, and tissue remodelling with increased collagen IV levels. (B) HMC-C-01-A shows anti-inflammatory and immune modulation activity in the BT and Sag systems and (C) HMC-C-01-A in the fibrosis panels increases Collagen type IV.

[0237] Table 2 shows the key differences between the activities regulated by the MCIM compound HMC-C- 01-A, the IRAK inhibitor zimlovisertib (Pf-06650833), and the S1 P receptor modulator ozanimod. Together, Table 2 and Figure 2 demonstrate that MCIM compounds have a distinct phenotypic profile compared to zimlovisertib and ozanimod. MCIM compounds demonstrate multi-modal actions, having specific effects in different cell types following stimulation with different inflammatory mediators. In particular, the MCIM compounds modulate immune activities by reducing the levels of inflammatory mediators such as TNFa, e-Selectin, CD38, CD40, CD69, slgG, SIL-17A, slL-17F, slL-2 and slL-6. In addition, the MCIM compounds show potential for tissue remodelling as indicated by the decrease in Col I and MMP1. Particularly of note, the MCIM compounds increase production of Coll IV, a critical basement membrane collagen which is involved in tissue repair and remodelling activities. These activities are differentiated compared with the IRAKi, zimlovisertib and the S1 PR modulator, ozanimod. EXAMPLE 2 - Mitochondrial phenotype assessment

[0238] The ability of mitochondria to undergo fusion and fission processes is essential to mitochondrial function and cellular health. Qualitative and / or quantitative changes in the mitochondrial reticulum are also observed under pathological conditions that are caused by inherited mutations in mitochondrial DNA or in nuclear OXPHOS genes and suggest a tight relationship between mitochondrial structure and function. In addition, several lines of evidence suggest that the damage response of injured cells can be ameliorated by the presence of healthy mitochondria (Jin., et al, 2019, which is hereby incorporated by reference in its entirety). Studying mitochondrial form and function may therefore yield important insights into the potential of cells and tissues to recover from damage. Osteoclasts are a highly energetic cell type sensitive to changes in mitochondrial metabolism that are suitable for evaluating such relationships.

[0239] Peripheral blood mononuclear cells were isolated from human whole blood by differential centrifugation over Ficoll-Paque PLUS (GE Healthcare Biosciences). CD14+ monocytes were purified from the freshly isolated PBMCs using the CD14+ selection kit (StemCells. UK) by positive magnetic selection according to manufacturer’s instructions. Cells were differentiated to osteoclasts by adding 1x106ml-1 cells in complete minimum essential medium-alpha supplemented with 10% heat inactivated fetal bovine serum (FBS, lnvitrogen,UK),2mM glutamine (Invitrogen.UK) 20U ml-1 penicillin, 100ug / ml streptomycin (Sigma Aldrich, UK) along with 25ng ml-1 recombinant human M- CSF (Peprotech, UK) and 25 ng ml-1 RANKL for 6 days. On the 6thday, the cells were treated with test compound (final concentration 0.03-1 M, 0,05 % DMSO) or a control, rotenone (100 nM).

[0240] Adherent cells were fixed in 2.5% glutaraldehyde in 0.1 M cacodylate buffer, pH 7.4, for 1 h, post fixed with 1% osmium tetroxide (Electron Microscopy Science), dehydrated in a graded series of ethanol, and embedded in Epon (Electron Microscopy Science). The embedded samples were sectioned by an ultramicrotome (Ultracut E, Richert-Jung, Leica Microsystem). Thin sections (90 nm thick) were collected on 300 mesh nickel grids and stained with uranyl acetate (Electron Microscopy Science) and lead citrate. Samples were observed by using a Zeiss EM 109 apparatus (Zeiss). Images were captured using a Nikon digital camera Dmx 170 1200F and ACT-1 software.

[0241] Representative images are shown in Figure 3. Top left panel; control cells show a heterogenous and dynamic population of mitochondria with a good balance of fusion and fission (mitochondria (M) and endoplasmic reticulum (ER)). Top right panel; cells treated with the archetypal Complex I inhibitor, rotenone shows increased numbers of abnormal mitochondria which were more rounded and had condensed cristae with evidence of fragmentation, and evidence of lysosomes (L) close by. Middle left panel; 0.03 pM ABD900 showed increased tubular mitochondrial with evidence of extrusion budding, consistent with an adaptive change in mitochondrial structure to increase mitochondrial area without an overt increase in organelle biomass. Dumbbell morphology, consistent with the formation of electron transport chain (ETC) super-complexes, were also observed. Middle right panel; 0.1 |iM ABD900 showed a similar profile with evidence of cristae refraction. Bottom left panel; 0.3 pM ABD900 shows filamentous extensions in many mitochondria consistent with an attempt to enlarge cristae volume. Bottom left panel; 1 pM ABD900 shows a heterogenous mitochondrial population with rounded morphology and condensed cristae.

[0242] The results demonstrate that, in contrast to the classical Complex 1 blocker, rotenone, the MCIM compounds elicit a mitochondrial phenotype consistent with differentiation based on maturity. For example, older mitochondria, which are usually cleared by mitophagy, are retained as part of an integrated stress response. To increase ETC efficiency, without an overt increase in biomass, structural adaptation occurs to maintain cellular free energy.

[0243] EXAMPLE 3 - Cellular metabolism and viability

[0244] The in vitro effects of test compounds on cellular metabolism and viability were determined by incubation with human primary lung fibroblasts followed by measurement of cellular ATP concentrations and cell counts.

[0245] ATP is an organic compound which can be produced by several cellular processes such as glycolysis and oxidative phosphorylation. However, if levels of oxygen, or substrates to fuel oxidative phosphorylation are insufficient, cells can reprogramme their metabolism towards glycolysis or other pathways to maintain their availability of ATP. Depending on the environment of the cell, such changes in metabolism may be accompanied by adaptive changes in gene expression. For example, under certain culture conditions, cells may upregulate an ‘adaptive response’ gene known as vascular endothelial growth factor (VEGF); VEGF encodes a proangiogenic protein (VEGF), whose function to induce new blood vessel formation to seek out new sources of oxygen and nutrients. This is critical to eliciting a functional repair response. By modulating the activity of Complex I, the MCIM compounds disclosed herein modulate ATP production, and thereby induce a cellular adaptation response.

[0246] The effects of the MCIM compounds on cellular adaptation was assessed in vitro in human primary lung fibroblasts (HLF). Cells were cultured with different metabolic substrates- glucose, L-glutamine, and pyruvate- to explore potential changes according to the microenvironment of the cell. Cells cultured in these conditions were treated with compound at various concentrations, and intracellular ATP concentrations, nucleus counts, and VEGF secretion were measured to quantify cell viability, metabolism, and indications of adaptive response.

[0247] Human primary lung fibroblasts were plated at a concentration of 2 x 103cells / well in 96-well plates in 100 L DMEM complete media (5.5 mM glucose, 2 mM L-glutamine, and 1 mM pyruvate) containing 1% penicillin-streptomycin and 10% heat inactivated foetal bovine serum. Cells were incubated at 37°C / 5% CO2overnight to allow cell attachment. On the day of the treatment, cell culture medium was removed, and the cells were washed three times with Gibco™ DMEM, no glucose, no L- glutamine, no pyruvate, no phenol red + 1% penicillin-streptomycin and 10% heat inactivated foetal bovine serum (termed ‘basal’ culture medium). Fresh cell culture supplemented with 5.5 mM glucose alone, 5.5 mM glucose and 2 mM L-glutamine, or 5.5 mM glucose, 2 mM L-glutamine, and 1 mM pyruvate was added to the wells. Test compounds were prepared as 10x final concentration solutions in each appropriate culture medium. Compounds were added to the cultures at 1x final concentration and incubated at 37°C / 5% CO2 for 1 or 3 days. On day 1, VEGF secretion was measured from cell culture supernatants; 72 hours post treatment, cells were assayed for nucleus counts and ATP generation.

[0248] T 0 assess nucleus counts, formaldehyde was added to a final concentration of 4%. Following a further 20-minute incubation at room temperature, the medium was aspirated, the cells were washed twice with 200 L TBS-T (1x TBS + 0.1% Tween 20) and the nuclei were stained with 50 L of PBS containing 10% heat inactivated foetal bovine serum, 0.1% Triton-X-100 and 2 pM Hoechst dye. Following a 30-minute incubation at room temperature, protected from light, the cells were washed twice with TBS-T, and cells were counted in 100 pL PBS solution using an ImageXpress Pico system with stitched plate acquisition (4x magnification), DAPI channel (50ms exposure, -3 digital confocal setting).

[0249] To assess ATP concentration, 50 pL of reconstituted ATPIite substrate solution (ATPIite 1step Luminescence Assay System, Perkin Elmer) was added to the cells. After a 5-minute incubation at room temperature on a plate shaker, luminescence was measured on a BMG Plate reader (PHERAstar) using LUM plus module, gain 3000, OR 96 / 384 aperture spoon (type A3).

[0250] The average values across the concentrations tested were then plotted and the half-maximal inhibitory concentration ( IC50) for the effect on ATP or nuclei counts was calculated by fitting the data to a four-parameter IC50 equation using GraphPad Prism software (v9). ATP readout per nuclei count was calculated by dividing ATPIite luminescence readout values by the Hoechst-stained nuclei count number per test concentration.

[0251] To assess VEGF secretion, cell supernatants of three replicate wells were combined and VEGF secretion was measured following the Quantikine® ELISA Human VEGF kit manufacturer instructions. Absorbance at 450 nm was measured on a BMG Plate reader (CLARIOstar plus) using pathlength correction. Background absorbance was measured at 540 nm.

[0252] Data were normalised to a VEGF standard curve and expressed as the average of the control wells in pg / mL. Data were plotted and the IC50 for the effect on VEGF secretion was calculated by fitting the data to a four-parameter IC50 equation using GraphPad Prism software (v9).

[0253] The results are shown in Figure 4. Figure 4A consists of 3 panels showing intracellular ATP (left panel), nucleus counts (middle panel) and ATP readout per cell (right panel) after 72 hrs incubation with MCIM compound. In cells cultured in glucose-supplemented media (squares), there was no effect of the MCIM compound on intracellular ATP levels, nuclei count or ATP readout per cell. In cells cultured in media supplemented with glucose and glutamine (open circles), there was an increase in intracellular ATP levels and nucleus counts given vehicle compared to cells cultured with glucose alone. T reatment of cells cultured in medium supplemented with glucose and glutamine with the MCIM compound reduced intracellular ATP levels and nucleus counts, in a concentration-dependent manner, with no effect on ATP levels per cell. When the basal culture media supplemented with glucose, L-glutamine was enriched with pyruvate (filled circles), the effect of the MCIM compound on intracellular ATP and nucleus counts seen in the medium supplemented with glucose and L-glutamine alone was eliminated.

[0254] The results show that in cells cultured in basal medium containing glucose, the MCIM compound had showed no cytotoxicity and had no effect on cell viability. When the cells were cultured in medium supplemented with glucose and L-glutamine, there was an increase in intracellular ATP levels and nucleus counts reflecting that L-glutamine is a precursor amino acid essential for cellular proliferation. The reduction in intracellular ATP and nucleus counts seen in the cells cultured with glucose and L- glutamine, and lack of effect on ATP levels per cells shows that the cells were adapting to the metabolic effects of Complex I modulation by the MCIM compound by limiting highly energydemanding processes, such as cellular proliferation, in order to maintain their intracellular levels of ATP. In addition, the reversal of this effect with the medium was supplemented further with pyruvate (glucose + L-glutamine + pyruvate condition) shows that the adaptive response observed (reduction of cell proliferation) is dependent on nutrient availability to the cell.

[0255] Figure 4B shows that in complete medium, there is no effect of the MCIM compound on VEGF secretion (filled circles (•),), but in the absence of pyruvate in the media (open circles (O)), the MCIM compound elicited a concentration-dependent increase in VEGF secretion (half-maximal inhibitory concentration (IC50) = 112 nM).

[0256] The results show that by modulating Complex I, in the absence of an excess of substrate, cells trigger an adaptive response to cause growth and repair by upregulating VEGF. The absence of an effect when pyruvate was present in the medium, shows that the adaptive repair response is also dependent on nutrient availability.

[0257] In summary, the results show that treatment with MCIM compounds disclosed herein induces an adaptive response to enable cells to maintain their supply of ATP. When cells are treated with MCIM compound, they attempt to restore tissue homeostasis by reducing energy-intensive activities such as proliferation and increasing production of growth factors such as VEGF. This occurs without any effect on cell viability.

[0258] EXAMPLE 4

[0259] Classical Complex I inhibitors often cause cytotoxicity and cell death and despite reports of antitumour effects for compounds such as IACS-010579 the known inhibitors have not found use as approved therapeutics, largely due to mechanism-based toxicity (Yap, T et al, 2023). As such, identifying a suitable approach for complex I inhibition that provides a benefit without toxicity has proved to be a challenge. An alternative approach which does not elicit adverse effects may have potential benefits for the treatment of a variety of progressive diseases. In this study, the inventors evaluated whether the MCIM compounds disclosed herein showed differences in their cellular behaviour compared with known Complex I inhibitors, IACS-010579 and rotenone.

[0260] Human primary lung fibroblasts were plated at a concentration of 5 x 103cells / well in 96 well plates in 100 pL DMEM complete media (5.5 mM glucose, 2 mM L-glutamine, and 1 mM pyruvate) containing 1% penicillin-streptomycin and 10% heat-inactivated foetal bovine serum. Cells were incubated overnight at 37°C / 5% CO2to allow cell attachment. On the day of the treatment, cell culture medium was removed, and the cells were washed three times with Gibco™ DMEM, no glucose, no L- glutamine, no pyruvate, no phenol red + 1% penicillin-streptomycin and 10% heat inactivated foetal bovine serum (termed ‘basal’ culture medium). Fresh cell culture media (without pyruvate) was added to the wells. Test compounds were prepared as 10x final concentration solutions in pyruvate-free medium. Following 24-hours compound treatment (in 5% CO2,37°C cell incubator), spent medium was removed from all wells and were thoroughly washed thrice with basal cell culture medium. For washout assay condition, 100 pL of pyruvate-free media was added per well. For No Washout, 90 pL of pyruvate-free media and 10 pL of 10x final assay concentration prepared test agents (or assay media) were added per well. Recovery of cell proliferation was measured after 24-hours incubation at 37°C / 5% CO2with either pyruvate-free media (without re-addition of the compound) or re-addition of compounds in pyruvate-free media.

[0261] T o assess nucleus counts, formaldehyde was added to a final concentration of 4%. Following a further 20-minute incubation at room temperature, the medium was aspirated, the cells were washed twice with 200 pL TBS-T (1x TBS + 0.1% Tween 20) and the nuclei were stained with 50 pL of PBS containing 10% heat inactivated foetal bovine serum, 0.1% Triton-X-100 and 2 pM Hoechst dye. Following a 30-minute incubation at room temperature, protected from light, the cells were washed twice with TBS-T, and cells were counted in 100 pL PBS solution using an ImageXpress Pico system with stitched plate acquisition (4x magnification), DAPI channel (50 ms exposure, -3 digital confocal setting).

[0262] When cells grow and divide (termed proliferation), cells progress through the cell cycle, a tightly regulated process that consists of two main activities: DNA replication and mitosis / cell division. As a method of accurately quantifying cellular proliferation rate, the pyrimidine analogue, BrdU can be utilised to measure DNA replication. BrdU can be incorporated into the newly synthesized DNA in place of thymidine. Following incubation of proliferating cells with BrdU for 20 hours, labelling solution was removed thoroughly, and cells were fixed with 70 pL of fix solution for 30 min at room temperature. Fix solution was aspirated, and anti-BrdU-Eu antibodies were added for 2 hours at room temperature in the dark. Wells were washed thrice with wash solution and 70 pL of DELFIA inducer per well was added and incubated for 30 min, in the dark. Eu-fluorescence was measured in a time- resolved manner using the PHERAstar FSX (Ex337 / Em620 nm). Data were plotted and a curve was fitted using a 4-parameter equation with GraphPad Prism software.

[0263] The results are shown in Figure 5. The figure shows 4 panels: cell proliferation inhibition measured by BrdU incorporation (A) and nucleus counts (B), and effects of compound washout on cell proliferation by BrdU incorporation (C) and nucleus counts (D) at the highest tested concentration. In panels A and B, ABD900 is shown in filled circles (•), rotenone is shown in grey squares (■) and IACS-010759 in open circles (O). In panel C-D, cells without washout are shown in solid black (IACS-010759) and grey (Rotenone) fill, and washout in open black (IACS-010759) and grey (rotenone) bars. For ABD900, washout cells are shown with an open fill pattern and cells not washed out are shown in a checkerboard fill. Data are mean ± s.e.m..

[0264] The results show that typical Complex I inhibitors such as IACS-010759 and rotenone reduce cell proliferation (BrdU incorporation and nucleus counts) when cells are cultured in pyruvate-restricted conditions. For known Complex 1 inhibitors such as IACS-010759 and rotenone, there is no recovery from these effects when the compounds are washed out. However, for the MCIM compound, there is a recovery in the proliferative capacity (BrdU incorporation and nucleus counts) of the cells after the compound is washed out. Overall, the data together show that the MCIM compounds disclosed herein display different cellular effects to the known, archetypal, inhibitors of Complex I.

[0265] EXAMPLE 5 - Single agent and combination treatment of mice with collagen-induced arthritis (CIA)

[0266] Seven- to eight-week-old male DBA / 1j mice were used for all procedures. Animals were housed in groups of 10 and were maintained at 21 °C ± 2°C on a 12-hour light / dark cycle with food and water ad libitum. Complete Freund’s adjuvant (CFA) was prepared by emulsifying bovine type II collagen at 4 mg / mL with a 4 mg / mL suspension of Mycobacterium tuberculosis H37Ra in Incomplete Freund’s adjuvant (IFA) (0.85 ml_ paraffin oil and 0.15 mL mannide monooleate) in a 1 :1 (v / v) ratio. All mice were immunised subcutaneously with 200 pg of bovine type II collagen in CFA. 21 days later, all mice were immunised subcutaneously with 100 pg of bovine type II collagen in IFA. The mice started to develop signs and symptoms of arthritis following the ‘booster’ immunisation.

[0267] For macroscopic assessment of arthritis, the following signs were monitored in each paw of each mouse three times per week and summed to generate the Arthritic Index (Al) (the maximum Al for one animal is 16):

[0268] 0 = no visible effects of arthritis.

[0269] 1 = oedema and / or erythema of 1 digit.

[0270] 2 = oedema and / or erythema of 2 digits.

[0271] 3 = oedema and / or erythema of more than 2 digits.

[0272] 4 = severe arthritis of entire paw and digits. Figure 6 shows 7 graphs, each of average arthritic index as a function of time (dosing day) for test compound dosed at 10 mg / kg / day by oral gavage (open circles (O)) and control (solid circles (•)), for each of: (A) HMC-C-02-A, (B) HMC-C-01-A, (C) HMC-N-02-A, (D) HMC-N-01-A, (E) NASMP-01-A, (F) CH MSA-01 -A, (G) CHMSA-03-A. These data indicate that the MCIM compounds described herein show excellent oral in vivo activity in preventing the progression of established, severe arthritis.

[0273] Animals were sorted into treatment groups with a mean arthritic index of 2.5 and then dosed once daily for 14 days with compound by oral gavage. On Day 14, animals were sacrificed, and limbs were fixed in 10% neutral buffered formalin.

[0274] The fixed limbs were processed into paraffin blocks and sectioned, and then stained using Toluidine Blue.

[0275] For histopathological assessment of the biological effects of MCIM compounds in arthritis, bone resorption was assessed by a direct count per bone of areas showing evident Howship’s lacunae or active osteolytic foci. To assess the frequency of new bone formation, a total count of cancellous bone osteoid zones was performed. The data were analysed by generating an aggregate score for each parameter in each treatment group. Test groups were compared to vehicle group by ANOVA using the Kruskal Wallis test statistic with exact P value comparisons. The data are summarised in the Table 3 and Figure 7. Data shown as sum from all limbs per animal per group. * p<0.05, ** p<0.01 , *** p<0.005 vs vehicle. §§§ p<0.005 vs etanercept. The data for several of the compounds are also illustrated in Figure 7.

[0276] Mice treated with the MCIM compounds HMC-C-01-A, HMC-C-01-B, HMC-N-01-B (Figure 7A) and ABD900, NASMP-01-A, CHMSA-03-A, or NASMP-06 (Figure 7B) have significantly reduced bone resorption compared to vehicle control. In addition, mice treated with the MCIM compounds HMC-C- 01-A, HMC-C-01-B, HMC-N-01-B have significantly increased average osteoid counts (Figure 7C) and those treated with ABD900, NASMP-01-A, CHMSA-03-A, or NASMP-06 have significantly increased osteoid zones compared to vehicle control (Figures 7D). Figure 8 shows the appearance of the osteoid / new bone formed in response to treatment with vehicle (top panel), an approved disease modifying anti-rheumatic drug (etanercept; bottom panel) and compound HMC-C-01-A (middle panel). Figure 10, middle panel, demonstrates the new bone formed in response to treatment with HMC-C- 01-A has a regular appearance with conservation of the tidemark (arrows). This indicates that the bone formed is responsive to pressure and has structural integrity in contrast to the reactive and sporadic deposits generated with etanercept (bottom panel).

[0277] Figure 9 shows that improvements in osteoid are achieved in mice treated with HMC-C-01 without control of inflammation. This indicates a direct remodelling effect that is not dependant on control of inflammation.

[0278] Figures 6-9 show the effects of the MCIM compounds in a model of joint inflammation and bone loss. The results show that the MCIM compounds reduce total bone resorption, and local focal areas of bone resorption. In addition, these data show that MCIM compounds trigger an adaptive repair response resulting in an increase in new bone deposition (osteoid), both in terms of osteoid counts and the areas of osteoid formation.

[0279] Together, the above data indicate that the MCIM compounds show excellent oral in vivo activity in preventing the progression of bone loss in established, severe arthritis, but importantly that they increase bone formation, indicating repair, in established arthritis.

[0280] Given the improved response of mice to treatment with the MCIM compounds, it was next investigated whether combining MCIM compounds with additional anti-rheumatic compounds could be used to treat arthritis further improve arthritic pathology in the mouse model. The data are summarised in Table 4 and illustrated in Figure 10.

[0281] Data are mean ± s.e.m.. * p<0.05, ** p<0.01 *** p<0.005 vs vehicle. § p<0.05, §§ p<0.01 §§§ p<0.005 vs zimlovisertib. A p<0.05, aa p<0.01 aaa p<0.005 vs compound.

[0282] Figure 10 shows 4 graphs, showing the anti-arthritic effects of the IRAKi compound zimlovisertib, the MCIM compound HMC-C-01-A, and the combination of zimlovisertib and HMC-C-01-A on (A) arthritic index, (B) synovitis, (C) bone resorption, (D), and osteoid score.

[0283] Figure 10 and Table 4 show that zimlovisertib and HMC-C-01-A have a more than additive effect on reducing arthritic index, synovitis score, bone resorption, and osteoid score. Importantly, the combination of HMC-C-01-A and zimlovisertib reduces overall bone pathology to a greater extent than either agent alone, with a synergistic effect observed when used in combination compared to either compound alone (Figure 10A). Furthermore, HMC-C-01-A shows a strong effect on osteoid formation when given alone, an indicator of its pro-repair phenotype while the IRAKi zimlovisertib shows no positive effects on osteoid formation (Figure 10D). Importantly, however, the combination of HMC-C- 01-A and zimlovisertib improves overall bone osteoid formation to a greater extent than either agent alone. The effect of the MCIM and NF-KB pathway inhibitor combination in reducing bone pathology is thought to be due to the remodelling and repair activities of the MCIM compound, augmenting control of pathology over what can be achieved simply through control of synovitis.

[0284] These data indicate that the combination of MCIM compounds with IRAK inhibitors results in greater effects on all disease parameters than compared to when either agent is administered alone. Specifically, administering MCIM and NF-KB pathway inhibitor together leads to a synergistic improvement of arthritic index, synovitis, bone resorption and osteoid score (bone repair).

[0285] Example 5B - MCIM and TL1A combination treatment of mice with CIA

[0286] Using the methods described in Example 5A to model arthritis, mice are treated with an MCIM compound (HMC-C-01-A), tulisokibart, or a combination of the MCIM compound and tulisokibart. Mice treated with single compound show an improvement in overall disease scores and improved histopathology compared to mice treated with a vehicle control. Administering MCIM and tulisokibart together leads to a synergistic improvement in one or more of arthritic index, synovitis, bone resorption and osteoid score (bone repair). Example 6 - Single agent treatment of mice with DSS-induced colitis

[0287] DSS-induced colitis is a widely used model of IBD (Chassaing et al, 2015, which is hereby incorporated by reference in its entirety). Eight- to nine-week-old female C57BI / 6 mice were used for all procedures. Animals were housed in groups of 10 and were maintained at 21 °C ± 2°C on a 12-hour light / dark cycle with food and water ad libitum. Dextran sulphate (DSS) was prepared by dissolving DSS in water to a final concentration of 1.5%. All mice were given ad libitum access to the DSS-containing water for 6 hours prior to dosing with vehicle control, 300 mg / kg sulfasalazine, 3 mg / kg etanercept or 10 mg / kg MCIM test compound by oral gavage, once daily for 8 days. The mice started to develop signs and symptoms of colitis within 1 day. Sulfasalazine and etanercept are approved anti-IBD drugs used in these experiments are positive control compounds.

[0288] For assessment of colitis, mouse body weight, stool consistency and presence / absence of blood in stool were monitored. Depending on the severity of the change in each of these observed parameters, the mice were assigned a score based on the criteria in Table 5. The disease scores were summed to generate the Disease Activity Index (DAI) (the maximum DAI for one animal is 9). The data are presented as mean s.e.m. across the group, and statistical analysis was performed using a two-way ANOVA with multiple comparisons (GraphPad Prism v 9.2.0). *p<0.05, ***p <0.005 vs vehicle, §§§p <0.005 vs sulfasalazine,aaap<0.005 vs etanercept.

[0289] Figure 11 shows the mean disease activity index for mice with DSS-induced colitis following treatment with vehicle, 300 mg / kg / d sulfasalazine, 3 mg / kg / d etanercept or 10 mg / kg / d MCIM compound, HMC- C-01-A. These data indicate that the MCI compounds described herein show excellent in vivo activity in preventing the progression of established DSS-induced colitis. Furthermore, the data shows that the MCIM compound has greater efficacy than both prior art treatments, sulfasalazine and etanercept.

[0290] For histopathological assessment of the biological effects of MCIM compounds in colitis, on Day 9, the colon from the rectum to the ileo-caecal junction was removed and the length recorded. The faeces were then removed, and the weight of the colon recorded. The colon was preserved in 10% neutral buffered formalin and processed to paraffin blocks.

[0291] Tissue sections were then stained with Haematoxylin and Eosin (H&E) and parameters of inflammation, mucosal erosion, epithelial hyperplasia, epithelial metaplasia, mucus cell metaplasia, and fibroplasia were assessed on a scale of 0-5 as follows:

[0292] 0: normal

[0293] 1 : minimal, focal

[0294] 2: moderate, focal

[0295] 3: moderate, multi-focal or diffuse

[0296] 4: marked, focal

[0297] 5: marked, multi-focal or diffuse

[0298] The data were analysed by generating an average histopathology score across each treatment group. Test groups were compared to the vehicle and positive control groups using two-way ANOVA with correction for multiple comparisons (Prism 9.2.0). Data shown as mean ± s.e.m.. * p<0.05, ** p<0.01 , *** p<0.005 vs vehicle.aaap<0.005 vs sulfasalazine. § p<0.05, §§ p<0.01 , §§§ p<0.005 vs etanercept. The data are summarised in Figures 11-16.

[0299] Figure 11 shows one graph, showing the average disease activity index for vehicle control, 300 mg / kg / day sulfasalazine, 3 mg / kg / day etanercept and 10 mg / kg / day HMC-C-01-A. Figure 12 shows two graphs, each of average mucosal erosion score for (A) vehicle control, 300 mg / kg / day sulfasalazine and 10 mg / kg / day ABD900and (B) vehicle control, 3 mg / kg / day etanercept and 10 mg / kg / day HMC-C-01-A. Figure 13 shows two graphs, each of average glandular loss score for each of: (A) vehicle control, 300 mg / kg / day sulfasalazine and 10 mg / kg / day ABD900 and (B) vehicle control, 3 mg / kg / day etanercept and 10 mg / kg / day HMC-C-01-A. Figure 14 shows 2 graphs, each of average epithelial hyperplasia score for each of: (A) vehicle control, 300 mg / kg / day sulfasalazine and 10 mg / kg / day ABD900 and (B) vehicle control, 3 mg / kg / day etanercept and 10 mg / kg / day HMC-C-01-A. Figure 15 shows 2 graphs, each of average fibroplasia score for each of: (A) vehicle control, 300 mg / kg / day sulfasalazine and 10 mg / kg / day ABD900, (B) vehicle control, 3 mg / kg / day etanercept and 10 mg / kg / day HMC-C-01-A.

[0300] Figure 16 shows representative histological cross sections of colon taken from mice with DSS- induced colitis treated with vehicle, 3 mg / kg / day etanercept or 10 mg / kg / day HMC-C-01-A, respectively. In vehicle treated mice, there is clear ulceration (top right panel, arrow) and a general loss of tissue architecture of the colon as demonstrated by visible oedema / inflammation and erosion (top left panel, arrow). Mice treated with etanercept display a general conservation of tissue architecture but still display a moderate degree of inflammation and oedema (middle panels, arrows). In contrast, the colon of mice treated with HMC-C-01-A have conserved tissue architecture and no visible signs of inflammation or oedema. Surprisingly, treatment with HMC-C-01-A stimulates an adaptive repair of the colon which is not seen with Etanercept treatment (bottom panel, arrows). The histological section from mice treated with HMC-C-01 -A demonstrates that this reaction is organised and localised within the lamina propria and aligned along the basal layer, with expansion / maintenance of basement membrane and maintenance of crypt architecture.

[0301] Together, these data indicate that HMC-C-01-A and ABD900 compounds have excellent activity in preventing the progression of established colitis and can stimulate repair of damaged tissues. Administration of MCIM compounds inhibited the key histological outcome of mucosal erosion / ulceration, as shown in Figure 12. Importantly, administration also increased hyperplasia of epithelium, suggesting induction of a repair response (Figure 14). This is supported by the unique finding of fibroplasia in the MCIM compound treated groups (Figure 15A and 15B).

[0302] Overall, Figures 11 to 16 show the effects of the MCIM compounds in a model of gastrointestinal disease. The results show that the MCIM compounds reduce disease signs and symptoms and protect the underlying tissue damage to a greater extent than approved drugs, sulfasalazine or anti- TNF biologic, etanercept, and that the MCIM compounds promote repair responses of epithelial hyperplasia, mucus cell metaplasia and fibroplasia to a greater extent than sulfasalazine and etanercept.

[0303] Example 7 - Combination treatment of mice with DSS-induced colitis

[0304] A number of NF-KB pathway inhibitors have been approved for use in the treatment / management of IBD, including etrasimod and ozanimod. Example 5 demonstrates that combining NF-KB pathway inhibitors with MCIM compounds of the invention can lead to a synergistic improvement of arthritic symptoms. This is believed to be due to the unique properties of MCIM compounds promoting tissue repair. Given these results, it is also predicted that, because of these unique reparative properties, combining MCIM compounds (which alone improve clinical symptoms of IBD) with NF-KB pathway inhibitors will also lead to an improved response in subjects suffering from IBD. For example, while it has been demonstrated in clinical trials that TL1 A inhibitors may be useful in the treatment of IBDs, such as ulcerative colitis, TL1 A inhibitors may also actively supress tissue healing (Jia et al., 2016 and Shimodaira et al., 2023). Therefore, it is thought that co-treatment with an MCIM compound, which promote tissue healing in various disease contexts including IBD as shown in Example 6, will lead to improved therapeutic outcomes. Using the methods described in Example 6 to model colitis, mice are treated with MCIM compound, for example HMC-C-01-A, etrasimod, tulisokibart, a combination of MCIM compound and etrasimod, or a combination of MCIM compound and tulisokibart. Mice treated with single compound will show an improvement in overall disease score and improved histopathology compared to mice treated with a vehicle control. Mice co-treated with MCIM compound and either etrasimod or tulisokibart will demonstrate a further improvement in disease score and histopathology compared to either MCIM compound, etrasimod or tulisokibart administered alone. Following treatment with a combination of HMC-C-01-A and etrasimod, or HMC-C-01-A and tulisokibart, mice will have improved clinical signs, clear anti-inflammatory effects in Gl tissues, and repair by fibroplasia and / or recruitment of PAS+ cells.

[0305] Mice treated with HMC-C-01-A and tulisokibart will also show repair of fibrosis in the intestine compared to when tulisokibart is administered alone.

[0306] Treatment with MCIM and tulisokibart may also result in a reduction in, and repair of, intestinal fibrosis associated with IBD.

[0307] EXAMPLE 8 - EAE model of Multiple sclerosis (MS)

[0308] Seven- to eight-week-old female C57BI / 6 mice were used for all procedures. Animals were housed in groups of 10 and were maintained at 22°C ± 3°C on a 12-hour light / dark cycle with food and water ad libitum. MOGss-sswas prepared by dissolving in saline at 1 mg / mL and mixed in an equal ratio with complete Freund’s adjuvant (CFA). Pertussis toxin was prepared by dissolving pertussis toxin to 1 ug / ml in saline. All mice were administered subcutaneously with 0.1 g MOG35-55 / CFA emulsion, and again two hours later with 0.2 ug pertussis toxin. A further 0.2 ug pertussis toxin was administered the following day. Clinical signs emerged after 7 days. Dosing was initiated after 13 days. All compounds were administered once daily by oral gavage for 27 days.

[0309] Clinical signs of disease were monitored daily according to the following scoring system.

[0310] 0: No obvious signs of motor dysfunction in mice compared to non-immunized control

[0311] 0.5: Distal tail limpness

[0312] 1 : Limp or floppy tail

[0313] 2: Limp tail and weakness in hind legs

[0314] 3: Limp tail and complete paralysis of hind legs (most common)

[0315] OR Limp tail with paralysis of one front and one hind leg

[0316] OR All of the following: severe head tilting walking only along the edges of the cage pushing against the cage wall spinning when picked up by the tail.

[0317] 4: Limp tail, complete hind leg and partial front leg paralysis

[0318] Mouse is minimally moving around cage but appears alert and feeding. Euthanasia is recommended after mouse scores 4 for 2 consecutive days. A score of 5 is entered when mouse is euthanized.

[0319] 5: Complete hind and complete front leg paralysis, no movement around cage OR mouse is spontaneously rolling in cage OR mouse found dead due to paralysis

[0320] On the 27thday, the brain was removed to 5 ml of 10% neutral buffered formalin and the spinal column was preserved in 50 ml 10% neutral buffered formalin and samples were sectioned for histopathology.

[0321] For histopathological assessment of the biological effects of MCIM compounds on disease, spinal cord sections were stained with Masson’s Trichome (MT) to assess fibrosis using the Ashcroft score, and Haematoxylin and Eosin (H&E) to assess parameters of inflammation, demyelination and pyknosis. Sections were stained using A2B5 to assess oligodendrocyte progenitor cells. The following scoring system was used to assess these parameters:

[0322] Grade 0: Normal, no pathology

[0323] Grade 1 : minimal, Single focal lesion in one section

[0324] Grade 2: moderate, Single focal lesion in 2+ sections

[0325] Grade 3: moderate, multi-focal lesions in one section

[0326] Grade 4: marked, multi-focal lesions in 2+ sections

[0327] Grade 5: marked, diffuse pathology

[0328] The data were analysed by generating an average histopathology score across each treatment group. Test groups were compared to the vehicle and positive control groups using two-way ANOVA with multiple comparisons (Prism 9.2.0). *p<0.05, **p <0.01, ***p <0.005 vs vehicle. The data are summarised in Figure 25.

[0329] Figure 17A also demonstrates that MCIM compounds of the invention reduce the clinical score in the EAE multiple sclerosis disease model. In addition, Figure 17B shows that a MCIM compound of the invention reduces demyelination in the EAE multiple sclerosis disease model. Figure 17C also demonstrates that a MCIM compound of the invention increases oligodendrocyte precursor cells (OPCs) to a greater extent than fingolimod in the EAE multiple sclerosis disease model. These data demonstrate that MCIM compounds of the invention reduce inflammation and tissue damage in EAE model mice and promote repair of damaged tissue. Microglia are the first line of defence following brain injury and respond rapidly to any type of brain injury. Microglia are typically highly ramified cells, with the ramifications capable of detecting stress signals in the local environment. Upon detection of such signals, the microglia are capable of responding to the stress (e.g. injury) in order to protect and / or promote repair of the damaged tissue. Microglia with a ramified phenotype are therefore neuroprotective. In chronic disease, microglia become less ramified and thus the normal neuroprotective function is impaired.

[0330] To determine if the MCIM compounds of the invention could promote neuroprotection, brain sections were taken from mice with EAE treated with vehicle control or an MCIM compound of the invention and the state of the microglia investigated.

[0331] An MCIM compound of the invention reduces inflammation and increases ramified (‘resting’) microglia in sections from mice with EAE. Figure 18, top panel, shows rounded microglia with evident process extrusions following administration of vehicle alone (negative control). In contrast, mice treated with HMC-C-01-A (bottom panel) shows ramified microglia with reduced process extrusions. These data suggest that by eliciting a more ramified microglia phenotype, MCIM compounds cause an adaptation to the neuronal environment and increase the potential for the normal neuroprotective response of microglia to function.

[0332] The results described above show that the MCIM compounds reduce inflammation and demyelination as well as fingolimod, and promote OPC cells, and a change in microglial phenotype as an indicator of a selective, adaptive repair responses.

[0333] EXAMPLE 9 - EAE model of Multiple sclerosis (MS)

[0334] Dysregulation of the NF-KB pathway is known to contribute to numerous neuroinflammatory diseases, including multiple sclerosis. In addition, Example 8 shows that the S1 PR modulator compound, fingolimod, ameliorates EAE in mice. Example 5 demonstrates that combining N F-KB pathway inhibitors with MCIM compounds of the invention can lead to a synergistic improvement of arthritic symptoms. This is believed to be due to the unique properties of MCIM compounds promoting tissue repair. Given these results, it is also predicted that, because of these unique reparative properties of MCIM compounds, combining MCIM compounds (which alone improve clinical symptoms of MS in an EAE model; Example 8 and Figures 17 and 18) with NF-KB inhibitors will also lead to an improved response in subjects suffering from MS.

[0335] Using the EAE mouse model above for MS, mice are treated with MCIM compound, for example HMC-C-01-A, etrasimod, or a combination of MCIM compound and etrasimod. Mice treated with single compound will show an improvement (decrease) in overall clinical score and improved histopathology (i.e. improved demyelination score and improved OPC score) compared to mice treated with a vehicle control. Mice co-treated with MCIM compound and etrasimod will demonstrate a further improvement in clinical score and histopathology measures compared to either compound administered alone. In particular, following treatment with a combination of HMC-C-01-A and etrasimod, mice will have improved clinical scores, clear anti-inflammatory effects in neuronal tissue, and an evident increase in ramified microglia with reduced process extrusions.

[0336] EXAMPLE 10 - Cellular thermal shift assay (CETSA) and multiplexes quantitative mass spectrometry

[0337] Following the observation that MCIM compounds can affect mitochondrial morphology and modulate cellular metabolism it was next investigated whether the reparative properties of the MCIM compounds could be attributed to binding to / modulation of mitochondrial proteins and / or complexes. To this end, MCIM compounds were assessed using a cellular thermal shift assay (CETSA) coupled with quantitative mass spectroscopy (MS) to determine what pathways are modulated by the MCIM compounds.

[0338] Thp-1 cells were incubated in the presence of 2 M MCIM compound (ABD900) or DMSO (vehicle control) for 4 hours. Following the incubation period, samples were heated to one of the following temperatures: 40.0, 42.9, 46.0, 49.6, 53.2, 56.8, 60.8, 64.0, 67.1, 70.0°C. Each test condition was performed in duplicate.

[0339] Following heating, cells were lysed, and the samples digested with trypsin. The digested soluble peptide fractions corresponding to individual temperatures were then labelled with a different isobaric tag, using the TMTIOplex system as described in Bantscheff, M., et al (2007), Bantscheff, M., et al (2012) and Franken, H., et al (2015), each of which are incorporated by reference in their entirety. Labelling of fractions from individual temperatures with an individual TMT1 OPlex tag allows the samples to be pooled and analysed by mass spectroscopy in a single run.

[0340] Following TMT1 OPlex labelling and pooling, the samples were fractionated using hydrophilic strong anion exchange (hSAX) (24 fractions per sample) and Liquid Chromatography with tandem mass spectrometry (LC-MS / MS) performed. The LC-MS / MS data was analysed to identify proteins whose thermal stability was shifted in the presence of the MCIM compound using the TPP R Package (Franken, H., et al (2015)) with a procedure described in Savitski., MM et al (2014). Generally, upon compound binding, proteins become more stable and thus more resistant to thermal denaturation. Therefore, a shift in thermal stability of a protein in the described CETSA assay can indicate direct binding of a compound to the protein with shifted thermal stability. Alternatively, a shift on thermal stability may indicate the protein is involved in a downstream event from the bound protein, for example, a post-translation modification as a result of an altered metabolic or signalling pathway.

[0341] Briefly, criteria for target candidate selection were as follows:

[0342] • Min p-value <0.4 (Benjamini-Hochberg corrected)

[0343] • DTm of Run 1 (R1 ) and Run 2 (R2) have same sign

[0344] • DTm (drug vs DMSO) > DTm (DMSO R1 vs DMSO R2)

[0345] • Minimum slope less than -0.06 Using the above criteria, 105 proteins were identified as showing a thermal shift when incubated with the MCIM compound indicating that they were either stabilised or destabilised. Of these 105 proteins, 73 were classified as high confidence and 32 as medium confidence hits.

[0346] Functional protein interactions and / or associations of the 105 identified candidate proteins were retrieved using the freely available STRING software (https: / / string-db.org). STRING analysis identified candidates involved in oxidative phosphorylation (e.g. NDUFA6 and SDHB), mitochondrial function and the ER to Golgi apparatus interface.

[0347] In addition, thermal shifts were observed in proteins involved in adaptive stress responses (e.g. YME1 L1, OXSR1 , MKNK1 ) and other proteins which play a role in NF-KB signalling (e.g. OXSR1, RASA1 and BIRC2).

[0348] It was therefore concluded, in line with the data in Example 3, that incubation with MCIM compounds alters the metabolic activity of cells specifically through modulation of oxidative phosphorylation, as indicated by the thermal shift of NDUFA6 (a Respiratory Complex 1 component). It was hypothesised that such modulation of Complex 1 and the oxidative phosphorylation pathway would alter NFKB and adaptive response pathways in cells, as indicated by the thermal shift observed for proteins such as YMEL1 L1, OXSR1 , MKNK1 , RASA1 and BIRC2.

[0349] EXAMPLE 11 - Photoaffinity labelling (PAL) and quantitative stable isotope labelling by amino acids in cell culture (SI LAC)

[0350] To investigate the binding partner(s) of the MCIM compounds, and the cellular activities modulated by them, Photoaffinity labelling (PAL) and quantitative stable isotope labelling by amino acids in cell culture (SILAC) was performed. A clickable linker probe MCIM compound was generated to do this.

[0351] This identified NDUFS2, a subunit of Mitochondrial Complex I, as a binder of the clickable linker probe MCIM compound. Together, the CETSA and PAL / SILAC-MS results strongly indicate that MCIM compounds can modulate oxidative phosphorylation and stress response pathways by binding and modulating the activity of the Mitochondrial Complex I.

[0352] EXAMPLE 12 - Computational modelling to identify binding sites in NDUFS2

[0353] Given that both CETSA and PAL / SILAC-MS methods identified Complex I subunits as targets of MCIM compounds, an in silico computer modelling approach was used to determine the binding site of MCIM compounds with the Complex I subunits.

[0354] Initially, homology models were built from publicly available structures of mitochondrial Complex I from five organisms, including human (Table 6). The putative targets were fully resolve in 5 structures. Mitochondrial Complex 1 used for the following modelling approaches is show in Figure 19.

[0355] The homology modelling revealed a lid pocket in the NDUFS2 subunit of Complex I which is in contact with the Q-tunnel. In four of the models the lid pocket was seen to be in an “open” conformation while in the remaining model it was in a “closed” conformation.

[0356] A homology model of the “open” confirmation was constructed and then SiteFinder was used to map NDUFS2 in the open and closed conformations. In particular, SiteFinder (Halgren T. A., 2009) was used to build a model of the “drugability” of NDUFS2, as measured by the volume of buried non-polar available surface area (ASA; Figure 21). This model identified two binding sites on NDUFS2. The first binding site (“Pocket A”) is located on the lid pocket in the open conformation and is represented on Figure 20 by a cluster of spheres. Pocket A has a percentage buried non-polar available surface area of 72%. The second binding site (“Pocket B”) is located at the “back” of the mitochondrial Complex I, relative to the position of the mitochondrial Complex I subunits NDUFS7 and ND1 and is represented by a second cluster of spheres. Pocket B has a percentage buried non-polar available surface area of 71%.

[0357] Further modelling of Q10, the natural ligand of the Q-tunnel, within the Q-site of Complex 1 using SiteFinder indicated that the space for binding in this pocket is limited (Figure 21). The spheres in Figure 21 illustrate the space and channels around NDUFS2 when NDUFS2 is associated with Complex 1 . This modelling approach also revealed a further ligand binding site at the junction between NDUFS2 and NDUFS7 (Figure 22). In particular, the MCIM compound is predicted to interact with His38 and Tyr141 of NDUFS2.

[0358] Using these protein models it was determined that the optimal binding site of each of ABD900, HMC-C-01-A and HMC-N-01-A was the NDUFS2 lid pocket (as illustrated in Figure 20, “Pocket A”), specifically the lid pocket in the open conformation (Glide score ~6), which is close to the Q-site. Even more particularly, the inventors were able to predict which amino acid residues in NDUFS2 contributed to the binding of the compounds:

[0359] • H-bonding with backbone carbonyl of Gly85, backbone amine of Leu95 and carboxylic acid of Asp193

[0360] • H-bonding to Tyr141 and His38 • TT- TT stacking with Phe458 and His88

[0361] In conclusion, analysis of the Q-site of NDUFS2 indicates that this site needs to be in the open confirmation to accommodate Q10 or small drug-like compounds.

[0362] Example 13 - Virtual Screening to assess structure-activity relationship against the NDUFS2 pocket

[0363] As discussed in Example 12, it is has been determined that the optimal binding site for MCIM compounds is in the lid pocket of NDUFS2 which is in close proximity to the Q-tunnel. From the data in Example 12, a ligand-protein pharmacophore model was built which identified 9 pharmacophoric features (Figure 23 and Tables 7A to 7C). Table 7-A describes the relationship between the type of pharmacophoric feature and the permissible variation in 3D space for the location of the given pharmacophoric feature. Table 7-B shows a distance matrix describing the 3D relationship between the centre of each pharmacophoric feature. Table 7-C describes the angle between each triplet combination of pharmacophoric features, wherein column “Y” describes the vertex of each angle. Using the parameters described in Tables 7-A to 7-C a visual representation of the pharmacophore model has been produced using the unified annotation scheme in Molecular Operating Environment (MOE) software tool (Figure 23). Using Molecular Operating Environment (MOE), the parameters can also be used to determine if a molecule conforms to the pharmacophore model - i.e. if 4 or more of the annotation points of the pharmacophore model are occupied by a corresponding annotation point located on a test molecule.

[0364] Using the Molecular Operating Environment (MOE), 2022.02 Chemical Computing Group ULC, 1010 Sherbooke St. West, Suite #910, Montreal, QC, Canada, H3A 2R7, 2022 MOE docking using the pharmacophore algorithm for ligand placement and the GBVI / WSA dG scoring function, 117 compounds were assessed for their ability to dock in the predicted binding site using the pharmacophore model described above. To be treated as a successful docking in the predicted binding site, it is required that a molecule hits at least 4 features of the pharmacophore model shown in Figure 23 and has a half-maximal inhibitory concentration (ICso) 1 pM.

[0365] Figure 24 shows a MCIM compound that conforms to the pharmacophore model and satisfies 7 out of the 9 annotation points determined to be important for binding to Complex I. Surprisingly, it was also found that out of the 117 compounds assessed for their ability to bind in the pharmacophore model, only 13 compounds had an ICso > 1 pM, which indicates that these compounds would fail to dock in the predicted binding sites. The remaining 104 compounds hit at least 4 of the pharmacophore features and are predicted to have an ICso 1 pM. Figure 25 shows representative compound CHMSA-02-A, which fulfils the pharmacophore model and is predicted to have a pAct (-Log(ICso) of ~7.

[0366] EXAMPLE 14 - Ultra-high throughput virtual screening (uHTVS)

[0367] Following building of the pharmacophore model, the inventors next wanted to identify additional NDUFS2 binders using this model.

[0368] The 3D model of the entire Complex 1 described in Example 12 (Figure 19) was validated by docking Q10 and active MCIM compounds. This allowed establishment of the bioactive conformation of the MCIM compounds when docked in the Q-tunnel of Complex I. This further allowed a structure-based hypothesis to be generated and to rationalise the structure-activity relationship (SAR) of the compounds and to build the pharmacophore model described in Example 13 and a QSAR model (Figure 26) for activity prediction. The QSAR model is a linear regression model which includes docking scores and parameters related to ligand energies and electrostatics.

[0369] For uHTVS, a library of compounds was screened against the pharmacophore model described in Example 9. The model identified 37.6 million compounds from the library of compounds which generally hit 3-6 of the pharmacophore features. Of these 37.6 million compounds, those up to a molecular weight of -350 Da were then virtually docked in the 3D Complex I model without imposing pharmacophore constraints. 67,000 compounds were predicted to dock in Complex I and were retained for further screening.

[0370] The retained compounds were then filtered through a more theoretically rigorous docking method and evaluated with a QSAR model to predict biological activity of each compound (Figure 26). The GBVI / WSA AG forcefield-based scoring function (Naim et al. 2007) on the MOE dock (Molecular Operating Environment (MOE), 2022.02 Chemical Computing Group ULC, 1010 Sherbooke St. West, Suite #910, Montreal, QC, Canada, H3A 2R7) was used. Using the screening process described, 756 compounds were identified as potential drug candidates for targeting NDUFS2 / NDUFS7 of Complex 1 . 008340309

[0371] References

[0372] A number of publications are cited above in order to more fully describe and disclose the invention and the state of the art to which the invention pertains. Full citations for these references are provided below. The entirety of each of these references is incorporated herein.

[0373] Bantscheff, M., et al (2007) Quantitative mass spectrometry in proteomics: a critical review, Anal Bioanal Chem 389(4): 1017-31

[0374] Bantscheff, M., et al (2012) Quantitative mass spectrometry in proteomics: critical review update from 2007 to the present. Anal Bioanal Chem 404(4):939-65

[0375] Bridges HR, Fedor JG, Blaza JN, Di Luca A, Jussupow A, Jarman OD, Wright J J, Agip AA, Gamiz- Hernandez AP, Roessler MM, Kaila VRI, Hirst J. Structure of inhibitor-bound mammalian complex I. Nat Commun. 2020 Oct 16;11(1 ):5261.

[0376] Berardi S, Corrado A, Maruotti N, Cici D, Cantatore FP. Osteoblast role in the pathogenesis of rheumatoid arthritis. Mol Biol Rep. 2021 Mar;48(3):2843-2852. Doi: 10.1007 / s11033-021 -06288-y. Epub 2021 Mar 27. PMID: 33774802; PMCID: PMC8060181.

[0377] Cai S, Zhao M, Zhou B, Yoshii A, Bugg D, Villet O, Sahu A, Olson GS, Davis J, Tian R. Mitochondrial dysfunction in macrophages promotes inflammation and suppresses repair after myocardial infarction. J Clin Invest. 2022 Dec 8:E159498. Doi: 10.1172 / JC 1159498. Epub ahead of print. PMID: 36480284.

[0378] Chassaing B, Aitken JD, Malleshappa M, Vijay-Kumar M. Dextran sulfate sodium (DSS)-induced colitis in mice. Curr Protoc Immunol. 2014 Feb 4; 104: 15.25.1-15.25.14. doi: 10.1002 / 0471142735.im1525s104. PMID: 24510619; PMCID: PMC3980572.

[0379] Chen P, Zhou G, Lin J, Li L, Zeng Z, Chen M, Zhang S. Serum Biomarkers for Inflammatory Bowel Disease. Front Med (Lausanne). 2020 Apr 22; 7: 123. Doi: 10.3389 / fmed.2020.00123. PMID: 32391365; PMCID: PMC7188783.

[0380] Chung, I., et al (2021 ) Cork-in-bottle mechanism of inhibitor binding to mammalian complex I. Science Advances, 14 May 2021 , Vol 7, Issue 20

[0381] Diller, R.B.; Tabor, A.J. (2022) The Role of the Extracellular Matrix (ECM) in Wound Healing: A Review.

[0382] Biomimetics 7, 87. https: / / doi.org / 10.3390 / biomimetics7030087

[0383] Eming SA, Martin P, Tomic-Canic M. Wound repair and regeneration: mechanisms, signaling, and translation. Sci TransI Med. 2014 Dec 3;6(265):265sr6. Doi: 10.1126 / scitranslmed.3009337. PMID: 25473038; PMCID: PMC4973620.

[0384] Fu XB. Repair cell first, then regenerate the tissues and organs. Mil Med Res. 2021 Jan 15;8(1 ):2. Doi: 10.1186 / S40779-021 -00297-5. PMID: 33451321 ; PMCID: PMC7809804.

[0385] Franken, H., et al (2015) Thermal proteome profiling for unbiased identification of direct and indirect drug targets using multiplexed quantitative mass spectrometry. Nat. Protoc. 10(10): 1567-193.

[0386] Gutierrez-Fernandez, J., Kaszuba, K., Minhas, G.S. et al. Key role of quinone in the mechanism of respiratory complex I. Nat Commun 11 , 4135 (2020).

[0387] Halgren T. A. Identifying and characterizing binding sites and assessing druggability. J. Chem. Inf.

[0388] Model. 2009, 49, 377-389.

[0389] Hubner R-H et al (2008) Standardized quantification of pulmonary fibrosis in histological samples.

[0390] Biotechniques, 44(4), 5-7-511 008340309

[0391] Izreig, S., et al (2020) Repression of LKB1 by miR-17~92 Sensitizes MYC-Dependent Lymphoma to Biguanide Treatment. Cell Reports Medicine 1(2)

[0392] Jacob N, Kumagai K, Abraham JP, Shimodaira Y, Ye Y, Luu J, Blackwood AY, Castanon SL, Stamps DT, Thomas LS, Gonsky R, Shih DQ, Michelsen KS, Targan SR. Direct signaling of TL1 A-DR3 on fibroblasts induces intestinal fibrosis in vivo. Sci Rep. 2020 Oct 23; 10(1 ): 18189. doi: 10.1038 / s41598-020-75168-5. PMID: 33097818; PMCID: PMC7584589.

[0393] Jia LG, Bamias G, Arseneau KO, Burkly LC, Wang EC, Gruszka D, Pizarro TT, Cominelli F. A Novel Role for TL1A / DR3 in Protection against Intestinal Injury and Infection. J Immunol. 2016 Jul 1 ; 197( 1 ): 377-86. doi: 10.4049 / jimmunol.1502466. Epub 2016 May 27. PMID: 27233964; PMCID: PMC5016081.

[0394] Jin, S., Cordes, N. ATM controls DNA repair and mitochondria transfer between neighboring cells. Cell Commun Signal 17, 144 (2019)

[0395] Joh Y, Choi WS. Mitochondrial Complex I Inhibition Accelerates Amyloid Toxicity. Dev Reprod. 2017 Dec;21(4):417-424.

[0396] Kaspar S, Oertlin C, Szczepanowska K, Kukat A, Senft K, Lucas C, Brodesser S, Hatzoglou M, Larsson O, Topisirovic I, Trifunovic A. Adaptation to mitochondrial stress requires CHOP-directed tuning of ISR. Sci Adv. 2021 May 26;7(22):eabf0971. Doi: 10.1126 / sciadv.abf0971. PMID: 34039602; PMCID: PMC8153728.Kurelac Ivana, et al. NDUFS3 knockout cancer cells and molecular docking reveal specificity and mode of action of anti-cancer respiratory complex I inhibitors. Open Biol. 12: 220198 (2022)

[0397] Krafts KP. (2010) Tissue repair: The hidden drama. Organogenesis. 6(4):225-33. Doi: 10.4161 / org.6.4.12555. PMID: 21220961 ; PMCID: PMC3055648.

[0398] LaMoia et al. (2022) Metformin, phenformin, and galegine inhibit complex IV activity and reduceglycerol- derived gluconeogenesis. PNAS 119(10); e2122287119.

[0399] Paul, W., and Sharma, CP., (2021 ), Chapter 1 - Tissue and organ regeneration: An introduction, Editor(s): Chandra P. Sharma, Regenerated Organs, Academic Press, 2021 , Pages 3-9,

[0400] Li M, Hou Q, Zhong L, Zhao Y, Fu X. Macrophage Related Chronic Inflammation in Non-Healing Wounds. Front Immunol. 2021 Jun 16;12:681710. Doi: 10.3389 / fimmu.2021.681710. PMID: 34220830; PMCID: PMC8242337.

[0401] Liehn EA, Postea O, Curaj A, Marx N. Repair after myocardial infarction, between fantasy and reality: the role of chemokines. J Am Coll Cardiol. 2011 Nov 29;58(23):2357-62. Doi: 10.1016 / j.jacc.2011.08.034. PMID: 22115639.

[0402] Zerina Lokmic, James Musyoka, Timothy D. Hewitson, Ian A. Darby; Chapter three - Hypoxia and Hypoxia Signaling in Tissue Repair and Fibrosis (Editor: Kwang W. Jeon), International Review of Cell and Molecular Biology, Academic Press, Volume 296, 2012

[0403] Lousa I, Reis F, Beirao I, Alves R, Belo L, Santos-Silva A. New Potential Biomarkers for Chronic Kidney Disease Management-A Review of the Literature. I nt J Mol Sci. 2020 Dec 22;22( 1 ):43. Doi: 10.3390 / ijms22010043. PMID: 33375198; PMCID: PMC7793089.

[0404] Maghsoudloo, M., Azimzadeh Jamalkandi, S., Najafi, A. et al. Identification of biomarkers in common chronic lung diseases by co-expression networks and drug-target interactions analysis. Mol Med 26, 9 (2020). https: / / doi.Org / 10.1186 / sl 0020-019-0135-9 008340309

[0405] Michael D. Wiese, Arkady T. Manning-Bennet & Ahmad Y. Abuhelwa (2020) Investigational IRAK-4 inhibitors for the treatment of rheumatoid arthritis, Expert Opinion on Investigational Drugs, 29:5, 475-482, DOI: 10.1080 / 13543784.2020.1752660

[0406] Naim et al.; J. Chem. Inf. Model. 47 (2007) 122-133

[0407] Nallagangula KS, Nagaraj SK, Venkataswamy L, Chandrappa M. Liver fibrosis: a compilation on the biomarkers status and their significance during disease progression. Future Sci OA. 2017 Oct 5;4(1):FSO250. Doi: 10.4155 / fsoa-2017-0083. PMID: 29255622; PMCID: PMO5729599.

[0408] Park MH, Hong JT. Roles of NF-KB in Cancer and Inflammatory Diseases and Their Therapeutic Approaches. Cells. 2016 Mar 29;5(2):15. Doi: 10.3390 / cells5020015. PMID: 27043634; PMCID: PMC4931664.

[0409] Peyrin-Biroulet, L (2020) Gastroenterology & Hepatology. 16(4) April 2020.

[0410] Rennert RC, Rodrigues M, Wong VW, Duscher D, Hu M, Maan Z, Sorkin M, Gurtner GC, Longaker MT. Biological therapies for the treatment of cutaneous wounds: Phase III and launched therapies. Expert Opin. Biol. The 2013;13:1523-1541.

[0411] Savitski, MM., et al (2015) Tracking cancer drugs in living cells by thermal profiling of the proteome. Science 346(6205).

[0412] Savu DI, Moisoi N. Mitochondria - Nucleus communication in neurodegenerative disease. Who talks first, who talks louder? Biochim Biophys Acta Bioenerg. 2022 Oct 1 ; 1863(7): 148588. Doi: 10.1016 / j.bbabio.2022.148588. Epub 2022 Jun 30. PMID: 35780856.

[0413] Schiller, J.; Zickermann, V. (2022) Binding of Natural Inhibitors to Respiratory Complex I.

[0414] Pharmaceuticals, 15, 1088. https: / / doi.org / 10.3390 / ph15091088

[0415] Shimodaira Y, More SK, Hamade H, Blackwood AY, Abraham JP, Thomas LS, Miller JH, Stamps DT, Castanon SL, Jacob N, Ha CWY, Devkota S, Shih DQ, Targan SR, Michelsen KS. DR3 Regulates Intestinal Epithelial Homeostasis and Regeneration After Intestinal Barrier Injury. Cell Mol Gastroenterol Hepatol. 2023;16(1 ):83-105. doi: 10.1016 / j.jcmgh.2023.03.008. Epub 2023 Apr 1. PMID: 37011811 ; PMCID: PMC10213104.

[0416] Spiegel S, Milstien S. The outs and the ins of sphingosine-1-phosphate in immunity. Nature reviews. Immunology. 2011 Jun; 11(6):403-415. DOI: 10.1038 / nri2974. PMID: 21546914; PMCID: PMC3368251. Trask OJ Jr. Nuclear Factor Kappa B (NF-KB) Translocation Assay Development and Validation for High Content Screening. 2012 Oct 1. In: Markossian S, Grossman A, Arkin M, et al., editors. Assay Guidance Manual [Internet], Bethesda (MD): Eli Lilly & Company and the National Center for Advancing T ranslational Sciences; 2004-. Available from: https: / / www.ncbi.nlm.nih.gov / books / NBK100914 / iraki

[0417] Tsogbadrakh B, et al (2018) HL156A, a novel pharmacological agent with potent adenosine- monophosphate-activated protein kinase (AMPK) activator activity ameliorates renal fibrosis in a rat unilateral ureteral obstruction model. PLoS One. 30;13(8):e0201692. doi: 10.1371 / journal. pone.0201692. PMID: 30161162; PMCID: PMC6116936.

[0418] Searfoss GH, Paisley BM, Goldstein KM, Baker TK, Willy JA. The Integrated Stress Response Regulates Cell Health of Cardiac Progenitors. Toxicol Sci. 2019 Jan 1 ; 167(1 ):202-210. doi: 10.1093 / toxsci / kfy229. PMID: 30215789.

[0419] Takeo M, Lee W, Ito M. Wound healing and skin regeneration. Cold Spring Harb Perspect Med. 2015 Jan 5;5(1):a023267. doi: 10.1101 / cshperspect.a023267. PMID: 25561722; PMCID: PMC4292081. 008340309

[0420] Way SW, Popko B. Harnessing the integrated stress response for the treatment of multiple sclerosis.

[0421] Lancet Neurol. 2016 Apr; 15(4):434-43. doi: 10.1016 / S1474-4422(15)00381 -6. Epub 2016 Feb 10. PMID: 26873788; PMCID: PMC4792730.

[0422] Wen L, Zhuang L, Luo X, Wei P. TL1 A-induced NF-kappaB activation and C-IAP2 production prevent DR3-mediated apoptosis in TF-1 cells. J Biol Chem. 2003 Oct 3;278(40):39251-8. doi: 10.1074 / jbc.M305833200. Epub 2003 Jul 25. PMID: 12882979.

[0423] Winkler A et al. The lnterleukin-1 Receptor-Associated Kinase 4 Inhibitor PF-06650833 Blocks Inflammation in Preclinical Models of Rheumatic Disease and in Humans Enrolled in a Randomized

[0424] Clinical Trial. Arthritis & Rheumatology. 2021 Dec 73(12): 2206-2218. https: / / doi.org / 10.1002 / art.41953 Xiong, N., Long, X., Xiong, J., Jia, M., Chen, C., Huang, J., Ghoorah, D., Kong, X., Lin, Z. and Wang, T. Mitochondrial complex I inhibitor rotenone-induced toxicity and its potential mechanisms in Parkinson’s disease models. Critical Reviews in Toxicology, 42:7. 11 May 2012.

[0425] Yap, T.A., Daver, N., Mahendra, M. et al. Complex I inhibitor of oxidative phosphorylation in advanced solid tumors and acute myeloid leukemia: phase I trials. Nat Med 29, 115-126 (2023). https: / / doi.Org / 10.1038 / S41591-022-02103-8

[0426] Yoga, EG., et al (2021 ) Ubiquinone Binding and Reduction by Complex I — Open Questions and Mechanistic Implications. Front. Chem., 30 April 2021

[0427] Xu WD, Li R, Huang AF. Role of TL1A in Inflammatory Autoimmune Diseases: A Comprehensive Review. Front Immunol. 2022 Jul 14;13:891328. doi: 10.3389 / fimmu.2022.891328. PMID: 35911746; PMCID: PMC9329929.

[0428] For standard molecular biology techniques, see Sambrook, J., Russel, D.W. Molecular Cloning, A

[0429] Laboratory Manual. 3 ed. 2001 , Cold Spring Harbor, New York: Cold Spring Harbor Laboratory Press

Claims

008340309Claims1. A pharmaceutical combination comprising a mitochondrial complex I modulator (MCIM) compound and an NF-KB pathway inhibitor.

2. A pharmaceutical composition comprising a mitochondrial complex I modulator (MCIM) compound and an NF-KB pathway inhibitor.

3. A pharmaceutical combination or composition according to claim 1 or claim 2 for use in medicine.

4. A pharmaceutical composition comprising a mitochondrial complex I modulator (MCIM) compound for use in the of an inflammatory and / or progressive disease in a subject in need thereof, wherein the treatment comprises the separate, sequential or simultaneous administration of the pharmaceutical composition and an NF-KB pathway inhibitor to the subject.

5. A pharmaceutical composition comprising an NF-KB pathway inhibitor for use in the treatment of an inflammatory and / or progressive disease in a subject in need thereof, wherein the treatment comprises the separate, sequential or simultaneous administration of the pharmaceutical composition and a mitochondrial complex I modulator (MCIM) compound to the subject.

6. A pharmaceutical composition comprising a mitochondrial complex I modulator (MCIM) compound and an NF-KB pathway inhibitor for use in the treatment of an inflammatory and / or progressive disease in a subject in need thereof, wherein treatment comprises administration of the composition to the subject.

7. The composition for the use according to any one of claims 4 to 6, wherein the treatment achieves disease control, regression, or tissue repair, or any combination thereof.

8. The composition for the use according to claim 7, wherein disease control comprises inhibiting disease progression.

9. The composition for the use according to claim 7 or 8, wherein disease control comprises supporting tissue repair.

10. The composition for the use according to any one of claims 7 to 9, wherein disease control comprises the prevention of a loss of anatomically normal tissue architecture, or a reduction in the speed of the loss of anatomically normal tissue architecture.

11. The composition for the use according to any one of claims 7 to 10, wherein the disease control, regression, or tissue repair, or any combination thereof, comprises an increased repair score and / or increased wound healing.

12. The composition for the use according to any one of claims 7 to 11 , wherein the disease control, regression, or tissue repair, or any combination thereof, comprises an increased cell count of reparative cells and / or a decreased cell count of pathology driving cells.

13. The composition for the use according to any one of claims 7 to 12, wherein the disease control, regression, or tissue repair, or any combination thereof, induces a restoration of anatomically normal tissue architecture.00834030914. The composition for the use according to any one of claims 4 to 13, wherein the inflammatory and / or progressive disease is associated with or caused by pathological activation of NF-KB activity.

15. The composition for the use according to claim 14, wherein pathological activation of NF- KB activity is caused by overstimulation of Toll-like receptor (TLR), overstimulation of IL1 receptor (IL1 R), overstimulation of S1 P receptor (S1 R), elevated S1 P production, or elevated TL1 A expression.

16. The composition for the use according to any one of claims 4 to 15, wherein the inflammatory and / or progressive disease is an autoimmune disease or an autoinflammatory disease.

17. The composition for the use according to any one of claims 4 to 16, wherein the inflammatory and / or progressive disease is rheumatoid arthritis (RA), psoriatic arthritis, inflammatory arthritis, ankylosing spondylitis, juvenile idiopathic arthritis, reactive arthritis, osteoarthritis, inflammatory bowel disease (IBD), Crohn’s disease, fistulising Crohn’s disease, ulcerative colitis, multiple sclerosis, psoriasis, graft versus host disease (GVHD), atopic dermatitis, or lupus.

18. The composition for the use according to any one of claims 4 to 17, wherein the disease control, regression, or tissue repair, or any combination thereof, comprises a reduction in cytokine production from pro-inflammatory myeloid cells.

19. The combination according to any one of claims 1 to 3 or the composition for the use according to any one of claims 4 to 18, wherein the binding of the MCIM compound to complex I modulates complex I activity, wherein complex I modulation is determined by detecting a reduction in cellular O2 consumption without a reduction of cell viability.

20. The combination according to claim 1 , the composition according to claim 2, or the combination or the composition for the use according to any one of claims 3 to 19, wherein the binding of the MCIM compound to complex I modulates complex I activity, leading to a reversible reduction in cell proliferation.

21. The combination, composition, combination for use or composition for the use according to any one of the preceding claims, wherein the MCIM compound interacts with complex I at a binding site outside the Q tunnel.

22. The combination, composition, combination for use or composition for the use according to any one of the preceding claims, wherein the MCIM binding site comprises one or more amino acid residues from NDUSF2 and / or NDUSF7.

23. The combination, composition, combination for use or composition for use according claim 21, wherein the MCIM compound interacts with one or more amino acid residues in NDUFS2 selected from His92, Gly85, Tyr141, His88, Leu95, Asp193 and Phe458.

24. The combination, composition, combination for use or composition for use according to claim 20, wherein the MCIM compound interacts with at least one amino acid residues in NDUFS2 selected from Tyr141 , His92 and Asp139.

25. The combination, composition, combination for use or composition for the use according to any one of the preceding claims, wherein a 3D conformation of the MCIM compound as annotated by008340309Molecular Operating Environment (MOE) 2022 unified annotation scheme comprises 4 or more pharmacophore features which conform to the pharmacophore model represented in Figure 15, and Tables 6-A, 6-B and 6-C.

26. The combination, composition, combination for use or composition for the use according to any one of the preceding claims, wherein the MCIM compound is an MCIM compound, or a pharmaceutically acceptable salt, hydrate, or solvate thereof, of the following formula:defined in claim 1 of WO2010 / 032009.

27. The combination, composition, combination for use or composition for the use according to any one of the preceding claims, wherein the MCIM compound is an MCIM compound, or a pharmaceutically acceptable salt, hydrate, or solvate thereof, of the following formula:defined in claim 1 of W02020 / 035560 A1.

28. The combination, composition, combination for use or composition for the use according to any one of the preceding claims, wherein the MCIM compound is an MCIM compound, or a pharmaceutically acceptable salt, hydrate, or solvate thereof, of the following formula:

29. The combination, composition, combination for use or composition for use according to any one of claims 25 to 27, wherein the MCIM compound is an MCIM compound selected from compounds of the following formulae, or a pharmaceutically acceptable salt, hydrate, or solvate thereof:00834030900834030900834030900834030930. The combination, composition, combination for use or composition for the use according to any one of the preceding claims, wherein the NF-KB pathway inhibitor comprises an IRAK inhibitor (IRAKi) compound, an S1 P receptor (S1 PR) modulator compound, or a TL1A inhibitor, or a combination thereof.

31. The combination, composition, combination for use or composition for the use according to claim 30, wherein: the IRAKi compound is selected from emavusertib, EVO1 , KT-413, R289, R835, GS-5718, zimlovisertib, zabedosertib, KT-474 / SAR444656, PF-06650833, BAY1834845, BAY1830839, and CA-4948, or any combination thereof; and / or the S1 PR modulator compound is selected from etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, cenerimod, or any combination thereof; and / or the TL1A inhibitor is selected from tulisokibart, RVT-3101 , TEV-48574, FG-M701 , and SPY002, or any combination thereof.

32. The combination for use or composition for the use according to claim 31 , wherein the IRAKi compound is selected from emavusertib, EVO1, KT-413, R289, R835, GS-5718, zimlovisertib, zabedosertib, KT-474 / SAR444656, PF-06650833, BAY1834845, BAY1830839, and CA-4948, or any combination thereof; and008340309 wherein the inflammatory and / or progressive disease is selected from rheumatoid arthritis (RA), psoriatic arthritis, inflammatory arthritis, ankylosing spondylitis, juvenile idiopathic arthritis, reactive arthritis, and osteoarthritis.

33. The combination for use or composition for the use according to claim 31 , wherein the S1PR modulator compound is selected from etrasimod, ozanimod, fingolimod, ponesimod, siponimod, ceralifimod, zectivimod, cenerimod, or any combination thereof; and wherein the inflammatory and / or progressive disease is selected from inflammatory bowel disease (IBD), ulcerative colitis, multiple sclerosis, graft versus host disease (GVHD), psoriasis, Crohn’s disease, fistulising Crohn’s disease, atopic dermatitis, and lupus.

34. The combination, composition, combination for use or composition for the use according to claim 30, wherein the TL1A inhibitor is selected from tulisokibart, RVT-3101 , TEV-48574, FG-M701 , and SPY002, or any combination thereof; and the inflammatory and / or progressive disease is selected from inflammatory bowel disease (IBD), ulcerative colitis, Crohn’s disease, fistulising Crohn’s disease, RA, psoriasis, ankylosing spondylitis, fibrosis, and intestinal fibrosis.

35. The combination, composition, combination for use or composition for the use according to any one of the preceding claims, wherein the MCIM compound and the NF-KB pathway inhibitor are uniformly dispersed in a solution, suspension, semi-solid or solid mixture within a single dosage form and one or more pharmaceutically acceptable excipients.

36. The combination, composition, combination for use or composition for the use according to any one of the preceding claims, wherein the MCIM compound and the NF-KB pathway inhibitor are heterogeneously dispersed and separated from each other in different regions within a single dosage form.

Images