Application of polypeptide in prevention and control of plant diseases

Abstract

The invention belongs to the technical field of plant disease prevention and control, and particularly relates to application of polypeptide in plant disease prevention and control. The invention provides an application of a polypeptide in prevention and control of plant diseases. The amino acid sequence of the polypeptide is shown as SEQ ID NO.1 or SEQ ID NO.2; wherein B in the amino acid sequence as shown in SEQ ID NO. 2 is hydroxyproline. The polypeptide can activate plant immune response, the resistance of plants to pathogenic bacteria can be improved by utilizing the polypeptide, and the polypeptide has the advantages of being natural, green, free of environment pollution, harmless to people and livestock, free of inducing pathogens to generate drug resistance and the like.

Description

Technical Field

[0001] The invention belongs to the technical field of plant disease prevention and control, and specifically relates to an application of a polypeptide in plant disease prevention and control. Background Art

[0002] In the long struggle with pathogenic microorganisms, plants have evolved two levels of immune systems to prevent the invasion of pathogens, namely pattern-triggered immunity (PTI) and effector-triggered immunity (ETI). Plants can sense the damage to the integrity of plant cells caused by pathogen infection, and produce damage-associated molecular patterns (DAMPs) or synthesize plant cytokines (phytocytokines). These DAMPs / phytocytokines stimulate plants to produce PTI immune responses through PRR receptor recognition, including reactive oxygen burst, activation of kinase cascades, callose deposition, expression of defense-related genes, etc., and finally show resistance to pathogens. PTI plays an important role in preventing non-host resistance (nonhost resistance) of plants from infecting non-adaptive microorganisms and limiting basal resistance (basal resistance) of adaptive pathogens from infecting susceptible host plants. The immunity stimulated by DAMPs / phytocytokines has the advantages of broad spectrum, strong, stable and long-lasting. In addition, since DAMPs / phytocytokines are natural products of plants themselves, using DAMPs / phytocytokines to stimulate immunity to prevent or control diseases is an environmentally friendly and green new disease control method.

[0003] Fusarium head blight is a fungal disease mainly caused by Fusarium graminearum (Lawrence E. Osborne et al, Epidemiology of Fusarium headblight on small-grain cereals, International Journal of Food Microbiology, 119 (1-2), 103-108, 2007). It is a global disease that not only reduces grain yield and quality, but also leads to crop failure in severe cases. At the same time, grains infected with Fusarium head blight contain high levels of deoxynivalenol (DON), nivalenol (NIV), fumonisin (FUM), mycoestrogen zearalenone (ZEN), T2 toxin and other fungal toxins, posing a serious threat to human and animal health.

[0004] At present, the prevention and control methods of fusarium head blight are mainly divided into several aspects: chemical prevention and control, biological prevention and control, agricultural prevention and control, and breeding of disease-resistant varieties. Among them, chemical prevention and control is still an important means of prevention and control of fusarium head blight. However, most pesticides have problems such as damaging the ecological environment, easily producing drug resistance, threatening human and animal health, and affecting plant growth. Excessive and long-term use of pesticides have exacerbated these problems. Therefore, new green broad-spectrum prevention and control preparations are urgently needed to be developed. Summary of the invention

[0005] The purpose of the present invention is to provide an application of a polypeptide in plant disease prevention and control, to activate plant immune response, to improve plant resistance to pathogens, especially to improve plant resistance to Fusarium graminearum, and to prevent and control fusarium head blight.

[0006] The present invention provides an application of a polypeptide in plant disease prevention and control, wherein the amino acid sequence of the polypeptide is shown in SEQ ID NO.1 or SEQ ID NO.2; wherein B in the amino acid sequence shown in SEQ ID NO.2 is hydroxyproline.

[0007] Preferably, the disease includes fusarium head blight.

[0008] Preferably, the plants include plants of the family Poaceae.

[0009] Preferably, the grass plants include Brachypodium distichum and / or wheat.

[0010] Preferably, the plant disease prevention and control includes improving the plant's resistance to pathogens.

[0011] Preferably, the pathogen includes Fusarium graminearum.

[0012] Preferably, the polypeptide is applied during the plant growth period and then the plant is kept moisturized for 48 to 72 hours.

[0013] Preferably, the plant growth period includes the flowering period.

[0014] Preferably, the application amount of the polypeptide is ≥12 g / mu.

[0015] Preferably, the site of administration of the polypeptide includes the ear of a plant.

[0016] Beneficial effects:

[0017] The present invention provides an application of a polypeptide in plant disease prevention and control, wherein the amino acid sequence of the polypeptide is shown in SEQ ID NO.1 or SEQ ID NO.2; wherein, in the amino acid sequence shown in SEQ ID NO.2, B is hydroxyproline. The polypeptide of the present invention can activate plant immune response, and the use of the polypeptide of the present invention can improve plant resistance, and the polypeptide has the advantages of being natural and green, not polluting the environment, harmless to humans and animals, and not inducing pathogens to produce drug resistance. The results of the embodiment show that the application of the polypeptide during the flowering period can improve the resistance of Brachypodium distachyon and wheat to fusarium head blight. BRIEF DESCRIPTION OF THE DRAWINGS

[0018] In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings required to be used in the embodiments are briefly introduced below.

[0019] Figure 1 The protein purification detection diagram in Example 1; wherein A is the SDS-PAGE Coomassie Brilliant Blue staining diagram of His-GST protein purification; B is the His-GST-Bradi3g30158 Δsp Protein purification SDS-PAGE Coomassie Brilliant Blue staining image; C is a Western blot detection image;

[0020] Figure 2 This is an identification diagram of the resistance of Brachypodium distachyon to Fusarium graminearum after treatment for 24 hours in Application Example 1; wherein A is the incidence of fusarium head blight on the ears of Brachypodium distachyon, with a scale of 1 cm; B is the diseased ear rate of Brachypodium distachyon, and ns indicates no significant difference;

[0021] Figure 3 This is an identification diagram of the resistance of Brachypodium distachyon to Fusarium graminearum after 48 hours of treatment in Application Example 2; A is the incidence of fusarium head blight on the ears of Brachypodium distachyon, with a scale of 1 cm; B is the diseased ear rate of Brachypodium distachyon, and *** represents p<0.0001; C is a fluorescent photo of Brachypodium distachyon 3 days after inoculation with Fusarium graminearum;

[0022] Figure 4 This is an identification diagram of wheat resistance to Fusarium graminearum after 48 hours of treatment in Application Example 3; A is the incidence of wheat head scab, with a scale of 1 cm; B is the diseased ear rate of wheat, with ** representing p<0.001; C is a fluorescent photograph of wheat 7 days after inoculation with Fusarium graminearum, with BF representing a bright field photograph and RFP representing a fluorescent photograph;

[0023] Figure 5 This is an identification diagram of the resistance of Brachypodium distachyon to Fusarium graminearum in Application Examples 4 to 7, wherein A is the incidence of fusarium wilt on the ears of Brachypodium distachyon, with a scale of 1 cm; B is the diseased ear rate of Brachypodium distachyon, and different lowercase letters indicate significant differences, p<0.05. DETAILED DESCRIPTION

[0024] The present invention provides an application of a polypeptide in plant disease prevention and control, wherein the amino acid sequence of the polypeptide is shown in SEQ ID NO.1 or SEQ ID NO.2; wherein B in the amino acid sequence shown in SEQ ID NO.2 is hydroxyproline.

[0025] As an embodiment, the amino acid sequence of the polypeptide of the present invention is shown in SEQ ID NO.1, which is a Brachypodium distachyon Bradi3g30158 polypeptide, and the amino acid sequence is as follows: RRIPELDAAMKTLE PPPAKGYSSEQTSSSSSTATQHPADDYPRMHSVSKRLVPQGPNPLHN. As an implementation, the amino acid sequence of the polypeptide of the present invention is shown in SEQ ID NO.2, which is a Brachypodium distachyon Bradi3g30158 short peptide, and the amino acid sequence is as follows: RLVBQGBNPLHN; B in the amino acid sequence is hydroxyproline. As an embodiment, the Brachypodium distachyon Bradi3g30158 polypeptide is expressed and purified using a prokaryotic expression system. As an embodiment, the Brachypodium distachyon Bradi3g30158 short peptide is obtained by artificial synthesis.

[0026] The polypeptide of the present invention can activate plant immune response and improve plant resistance to pathogens. The polypeptide of the present invention is derived from plants and has the advantages of being natural and green, not polluting the environment, harmless to humans and animals, and not inducing drug resistance in pathogens.

[0027] As an embodiment, the diseases of the present invention include fusarium head blight. As an embodiment, the plants of the present invention include gramineous plants. As an embodiment, the gramineous plants of the present invention include Brachypodium distachyon and / or wheat. In a specific embodiment, the gramineous plants may be Brachypodium distachyon, wheat, or Brachypodium distachyon and wheat.

[0028] As an embodiment, the plant disease control of the present invention includes improving the resistance of plants to pathogens. As an embodiment, the pathogens of the present invention include Fusarium graminearum. The polypeptide of the present invention can activate the plant immune response, improve the resistance of plants to Fusarium graminearum, and is used to prevent and control Fusarium graminearum-induced head blight.

[0029] As an embodiment, the plant is moisturized for 48 to 72 hours after the polypeptide is applied during the plant growth period. In a specific embodiment, the moisturizing time after the polypeptide is applied during the plant growth period can be any integer value between 48 and 72 hours; the present invention moisturizes the plant after the polypeptide is applied during the plant growth period, which can reduce polypeptide degradation, promote plant absorption of the polypeptide, and promote the polypeptide to play a protective role.

[0030] As an embodiment, the plant growth period of the present invention includes the flowering period. Plant diseases often occur in the critical growth period of parasitic plants, such as fusarium head blight, which often occurs in the flowering period. Applying the polypeptide of the present invention in the flowering period can activate the plant immune response and improve the plant's resistance to pathogens.

[0031] As an embodiment, the application amount of the polypeptide of the present invention is ≥12 g / mu.

[0032] As an embodiment, the application site of the polypeptide of the present invention includes the ear of the plant. The ear of the plant is a high-incidence site of scab, and applying the polypeptide of the present invention to the ear of the plant can effectively stimulate the plant immune response and improve the plant's resistance to scab.

[0033] As another embodiment, the polypeptide of the present invention is applied by spraying, which allows the polypeptide to fully contact the plant and effectively stimulate the plant immune response.

[0034] In order to further illustrate the present invention, the application of a polypeptide provided by the present invention in plant disease prevention and control is described in detail below in conjunction with the accompanying drawings and examples, but they should not be construed as limiting the scope of protection of the present invention.

[0035] Example 1

[0036] (1)His-GST and His-GST-Bradi3g30158 Δsp Engineering bacteria construction

[0037] ① Using the cDNA of the wild type Bd21 of Brachypodium distachyon [published in: Establishment of Genetic Transformation System of Mature Embryo Callus of Wheat and Brachypodium distachyon, Liu Yangyang, 2015] as a template, PCR amplification was performed using primers Bradi3g30158Δsp-FP-BamHI and Bradi3g30158Δsp-RP-StuI (completed by Beijing Qingke Biotechnology Co., Ltd.) to obtain the Bradi3g30158Δsp gene fragment. The primer sequence information is as follows:

[0038] Bradi3g30158Δsp-FP-BamHI (SEQ ID NO.3): 5'-CGGGATCCATGCGGAGAATCCCAGAG-3';

[0039] Bradi3g30158Δsp-RP-StuI (SEQ ID NO. 4): 5'-GAAGGCCTTCAGTTGTGCAGTGGATTCGG-3'.

[0040] The PCR reaction system is: 1 μL cDNA, 47 μL Gold Mix, and 1 μL each primer; the Gold Mix was purchased from Beijing Qingke Biotechnology Co., Ltd.

[0041] The PCR reaction procedure was as follows: pre-denaturation at 98°C for 5 min; denaturation at 98°C for 30 s, annealing at 56°C for 30 s, extension at 72°C for 15 s, for a total of 35 cycles; final extension at 72°C for 10 min; and storage at 12°C for 10 min.

[0042] ② After the PCR product obtained in the above step ① was recovered using a column DNA recovery kit (purchased from Shanghai Shenggong Biotechnology Co., Ltd.), the Bradi3g30158Δsp gene fragment and the vector pGST-His were double-digested with restriction endonucleases BamHI and Stu I (purchased from Baoriyi Biological Co., Ltd.); the digestion products were recovered and connected using T4 ligase to obtain a ligation product; the ligation product was transformed into Escherichia coli MC1061; micro-extraction of plasmid DNA, restriction digestion and sequencing, and the sequencing was completed by Beijing Qingke Biotechnology Co., Ltd.; the correct vector plasmid was transferred into Escherichia coli competent DE3 cells to obtain His-GST-Bradi3g30158 Δsp Engineered bacteria, stored in glycerol, stored at -80℃.

[0043] ③Transform the empty vector pGST-His plasmid into competent E. coli DE3 cells to obtain His-GST engineered bacteria, which were stored in glycerol at -80°C.

[0044] (2)His-GST and His-GST-Bradi3g30158 Δsp Protein purification

[0045] ① The His-GST engineered bacteria and His-GST-Bradi3g30158 prepared in step (1) above were Δsp The engineered bacteria were streaked and activated, and His-GST single colonies and His-GST-Bradi3g30158 were picked out respectively. Δsp Single colony was added to 2mL LB liquid medium containing 50mg / L ampicillin (AMP) and shaken at 37℃ overnight; about 1mL of bacterial liquid was added to 200mL LB liquid medium containing 50mL / L AMP, placed in a 2L Erlenmeyer flask, shaken at 37℃ for 2-3h, and OD was measured. 600 , O.D. 600=0.5-1.0, stop culturing; add 20 μL of 1M isopropyl-β-D-thiogalactoside (IPTG, final concentration of IPTG is 0.2 mM) to the bacterial solution, shake and culture at 28°C for 6 h to induce protein expression; centrifuge at 4°C, 4000 rpm for 15 min, discard the supernatant, collect the bacteria, and obtain His-GST and His-GST-Bradi3g30158 Δsp The bacterial pellet was stored frozen at -20℃.

[0046] ②The following steps are all carried out on ice: Take the His-GST and His-GST-Bradi3g30158 obtained in step ① respectively Δsp The bacterial cell precipitate was added with 15 mL of His extraction buffer (the His extraction buffer was prepared by adding 5 mL of 2M Tris-HCl and 12 mL of 5M NaCl, and then adding PBS to make the volume 200 mL; imidazole and phenylmethylsulfonyl fluoride (PMSF) were added before use. The final concentration of imidazole in the extraction buffer is 5 mM, and the final concentration of PMSF is 1 mM), and the precipitate is resuspended with a vortexer; the cells are transferred to 50 mL round-bottom tubes (for ultrasound and centrifugation), and the cell resuspension is brown-yellow and viscous. 20 μL lysozyme is added and the reaction is carried out on ice for 15 min; the resuspensions are then placed on ice and the cells are disrupted with an ultrasonicator (Xinzhi JY99-IIDN, 6 mm amplitude rod, output power: 30%) for 30 s, and then disrupted again after an interval of 5 min. This process is repeated 3 to 4 times until the protein solution is clear and no longer viscous; the disrupted cells are centrifuged at 4°C, 12,000 rpm for 15 min, and the supernatant is transferred to a new 15 mL centrifuge tube.

[0047] ③ Take the supernatant of step ② respectively, add 500 μL of 20% Triton-X-100 (the final concentration of Triton-X-100 volume is 1%), mix well, add 5-10 mM imidazole to reduce nonspecific binding, and mix well again; add 100 μL of 50% (v / v) Ni-NTA agarose beads respectively, pre-wash twice with His extraction buffer (Triton-X-100 is added now, the final concentration of Triton-X-100 volume is 1%) (1000 rpm, horizontal centrifugation at room temperature for 1 min); incubate with rotation at 4°C for 3 h; centrifuge at 1000 rpm for 1 min, then let the test tube stand in the centrifuge for 1 min, let the precipitate sink to the bottom, and aspirate the supernatant; use 10 mL of His washing buffer (the configuration method of the His washing buffer is: 2M Tris-HCl 5 mL and 5M NaCl 12 mL, add PBS to 200 mL; add imidazole before use, the His The precipitate was washed three times with 1 mL of His washing buffer (the final concentration of imidazole in the His washing buffer was 20 mM); the precipitate was transferred to a 1.5 mL centrifuge tube, washed again with 1 mL of His washing buffer, centrifuged horizontally at 1000 rpm for 1 min, and the supernatant was completely aspirated; 300 μL of His elution buffer (the configuration method of the His elution buffer is: 2 M Tris-HCl 5 mL and 5 M NaCl 12 mL, and PBS was added to make the volume 200 mL; imidazole and PMSF were added before use, and the final concentration of imidazole in the His elution buffer was 250 mM, and the final concentration of PMSF was 1 mM), incubated at room temperature for 15 min, and incubated at 4°C for 15 min; centrifuged horizontally at 1000 rpm for 1 min, and the supernatant was the separated protein; secondary elution, dialyzed the eluate to obtain His-GST protein eluate and His-GST-Bradi3g30158 Δsp Protein eluent.

[0048] ④ The eluate in the above steps is subjected to Coomassie Brilliant Blue staining test. The test results are as follows: Figure 1 As shown in A and B, A is the SDS-PAGE Coomassie Brilliant Blue staining of His-GST protein purification; B is the His-GST-Bradi3g30158 ΔspProtein purification SDS-PAGE Coomassie Brilliant Blue staining; Lanes S1 in A and B: protein after disruption; S2: protein supernatant after disruption; W1: protein supernatant after incubation; E1: first elution: E2: second elution: B: Ni-NTA agarose beads. Δsp The protein eluate was subjected to Western blotting detection, and the results are shown in Figure 1 C in.

[0049] according to Figure 1 It can be seen that the purified His-GST and His-GST-Bradi3g30158 Δsp The protein size was consistent with the predicted size, indicating that His-GST and His-GST-Bradi3g30158 Δsp The protein eluate is of good quality and can be used for the next experiment.

[0050] Example 2

[0051] The Shanghai Sangon Biotechnology Co., Ltd. was commissioned to synthesize the Brachypodium distachyon Bradi3g30158 short peptide; the amino acid sequence of the Brachypodium distachyon Bradi3g30158 short peptide is shown in SEQ ID NO.2, and B in the amino acid sequence is hydroxyproline.

[0052] Application Example 1

[0053] (1) The His-GST and His-GST-Bradi3g30158 prepared in Example 1 were Δsp The protein eluate was diluted to obtain a His-GST protein solution with a concentration of 150 μg / mL and a His-GST-Bradi3g30158 solution with a concentration of 150 μg / mL. Δsp Protein solution.

[0054] (2) Separately mix the His-GST protein solution prepared in step (1) and His-GST-Bradi3g30158 Δsp The protein solution is sprayed on the ears of two-spike short-stalked grass in the peak flowering period, and then bagged to keep moist for 24 hours.

[0055] (3) After moisturizing, use the single flower drip method to inoculate 3 μL of 5×10 5The spores of fluorescent strain PH-1-RFP of Fusarium graminearum (published in the literature [Q.Gu, Yun Chen, et al. The transmembrane protein FgSho1 regulates fungal development and pathogenicity via the MAPK module Ste50-Ste11-Ste7 in Fusarium graminearum, New Phytologist 206, 315-328, 2015.]) were sprayed at 100 mL / mL; the spores were bagged to keep moist for 3 days after spraying, and the diseased ear rate was calculated; the above experiment was repeated 10 times, and the test results were all the average values ​​of the 10 repeated experiments, as shown in Tables 1 and Figure 2 shown.

[0056] Table 1 Diseased ear rate of Brachypodium distichum in each group of moisturizing for 24 hours

[0057] Group His-GST His-GST-Bradi3g30158Δsp Diseased ear rate (%) 45.02 42.86

[0058] According to Table 1 and Figure 2 It can be seen that compared with His-GST, His-GST-Bradi3g30158 Δsp Moisturizing for 24 hours failed to improve the resistance of Brachypodium distachyon to ergot.

[0059] Application Example 2

[0060] (1) According to step (1) in Application Example 1, a His-GST protein solution with a concentration of 150 μg / mL and a His-GST-Bradi3g30158 with a concentration of 150 μg / mL were prepared. Δsp Protein solution.

[0061] (2) Separately mix the His-GST protein solution prepared in step (1) and His-GST-Bradi3g30158 Δsp The protein solution is sprayed on the ears of two-spike short-stalked grass in the peak flowering period, and then bagged to keep moist for 24 hours.

[0062] (3) After moisturizing, use the single flower drip method to inoculate 3 μL of 5×10 5 / mL of fluorescent spore liquid of Fusarium graminearum strain PH-1-RFP; after spraying, bagging and moisture preservation for 3 days, the diseased ear rate was counted, and fluorescent photos were taken with a stereo fluorescence microscope; the above experiment was repeated 10 times, and the test results were the average of 10 repeated experiments. The results are shown in Table 2 and Figure 3 shown.

[0063] Table 2 Diseased ear rate of Brachypodium distichum in each group after 48h moisturizing

[0064] Group His-GST His-GST-Bradi3g30158Δsp Diseased ear rate (%) 42.56 25.00

[0065] According to Table 2 and Figure 3 It can be seen that compared with His-GST, His-GST-Bradi3g30158 Δsp Treatment for 48 hours can significantly improve the resistance of Brachypodium distachyon to ergot.

[0066] Application Example 3

[0067] (1) According to step (1) in Application Example 1, a His-GST protein solution with a concentration of 150 μg / mL and a His-GST-Bradi3g30158 with a concentration of 150 μg / mL were prepared. Δsp Protein solution.

[0068] (2) Separately mix the His-GST protein solution prepared in step (1) and His-GST-Bradi3g30158 Δsp The protein solution was sprayed on the wheat ears at the peak flowering stage and then bagged to keep moist for 48 hours.

[0069] (3) After moisturizing, use the single flower drip method to inoculate 10 μL of 1×10 6 / mL of fluorescent spore liquid of Fusarium graminearum strain PH-1-RFP; after spraying, bagging and moisture preservation for 3 days, statistically analyze the diseased ear rate, and take fluorescent photos with a stereo fluorescence microscope; the above experiment was repeated 10 times, and the test results were the average of 10 repeated experiments. The results are shown in Table 3 and Figure 4 shown.

[0070] Table 3 Diseased ear rate of wheat in each group of moisturizing for 48h

[0071] Group His-GST His-GST-Bradi3g30158Δsp Diseased ear rate (%) 22.88 17.50

[0072] According to Table 3 and Figure 4 It can be seen that compared with His-GST, His-GST-Bradi3g30158 Δsp Treatment for 48 hours can significantly improve wheat resistance to ergot.

[0073] Application Example 4

[0074] (1) The short peptide of Brachypodium distachyon Bradi3g30158 prepared in Example 2 was treated with ddH 2 O to prepare a 1 μM Bradi3g30158 short peptide solution.

[0075] (2) Using the 1 μM Bradi3g30158 short peptide solution prepared in step (1), spray the spikes of Brachypodium distichum in the blooming period, and then bag the plants to keep them moist for 48 hours.

[0076] (3) After moisturizing, use the single flower drip method to inoculate 3 μL of 5×10 5 / mL of fluorescent spore liquid of Fusarium graminearum strain PH-1-RFP; after spraying, bag and keep moist for 3 days, take pictures and count, and calculate the diseased ear rate; the above experiment was repeated 10 times, and the test results are the average of 10 repeated experiments. The results are shown in Table 4 and Figure 5 shown.

[0077] Application Example 5

[0078] (1) The short peptide of Brachypodium distachyon Bradi3g30158 prepared in Example 2 was treated with ddH 2 O to prepare a 2.5 μM Bradi3g30158 short peptide solution.

[0079] (2) Follow the method described in step (2) of Application Example 4.

[0080] (3) The method described in step (3) of Application Example 4 was followed, and photos were taken and counted to calculate the diseased ear rate; the above experiment was repeated 10 times, and the test results were the average of the 10 repeated experiments. The results are shown in Tables 4 and Figure 5 shown.

[0081] Application Example 6

[0082] (1) The short peptide of Brachypodium distachyon Bradi3g30158 prepared in Example 2 was treated with ddH 2 O to prepare a 5 μM Bradi3g30158 short peptide solution.

[0083] (2) Follow the method described in step (2) of Application Example 4.

[0084] (3) The method described in step (3) of Application Example 4 was followed, and photos were taken and counted to calculate the diseased ear rate; the above experiment was repeated 10 times, and the test results were the average of the 10 repeated experiments. The results are shown in Tables 4 and Figure 5 shown.

[0085] Application Example 7

[0086] (1) Using ddH 2 O Spray the spike of two-eared short-handled grass in full flowering stage, and bag it to keep it moist for 48 hours after spraying.

[0087] (2) Follow the method described in step (3) of Application Example 4, take photos and count, and calculate the diseased ear rate; the above experiment is repeated 10 times, and the test results are the average of the 10 repeated experiments. The results are shown in Tables 4 and Figure 5 shown.

[0088] Table 4 Diseased ear rate of Brachypodium distichum in application examples 4 to 7

[0089] Group Diseased ear rate (%) Application Example 4 22.82 Application Example 5 18.67 Application Example 6 29.37 Application Example 7 48.16

[0090] According to Table 4 and Figure 5 It can be seen that compared with the application example 7 spraying ddH 2 Compared with the O treatment, 1μM, 2.5μM and 5μM Bradi3g30158 short peptide treatment for 48h can all improve the resistance of Brachypodium distachyon to ergot.

[0091] In summary, spraying Brachypodium distachyon Bradi3g30158 polypeptide or Brachypodium distachyon Bradi3g30158 polypeptide during the flowering period can improve the resistance of Brachypodium distachyon and wheat to Fusarium graminearum, and can be used to prevent and control plant fusarium ergot.

[0092] Although the above embodiment describes the present invention in detail, it is only a part of the embodiments of the present invention, not all of the embodiments. People can also obtain other embodiments based on this embodiment without creativity, and these embodiments all fall within the protection scope of the present invention.

Claims

1. An application of a polypeptide in plant disease prevention and control, characterized in that: The amino acid sequence of the polypeptide is shown in SEQ ID NO.1 or SEQ ID NO.2; wherein, in the amino acid sequence shown in SEQ ID NO.2, B is hydroxyproline.

2. The use according to claim 1, characterized in that: The diseases include fusarium head blight.

3. The use according to claim 1, characterized in that: The plants include plants of the family Poaceae.

4. The use according to claim 3, characterized in that: The grass plants include Brachypodium distachyon and / or wheat.

5. The use according to claim 1, characterized in that: The plant disease control includes improving the resistance of plants to pathogens.

6. The use according to claim 5, characterized in that: The pathogenic bacteria include Fusarium graminearum.

7. The use according to any one of claims 1 to 6, characterized in that: After applying the polypeptide during the plant growth period, moisturize for 48 to 72 hours.

8. The use according to claim 7, characterized in that: The plant growth period includes the flowering period.

9. The use according to claim 7, characterized in that: The application amount of the polypeptide is ≥12g / mu.

10. The use according to claim 7, characterized in that: The site of administration of the polypeptide includes the ear of a plant.

Images