New scheme of administration of a multivalent vaccine against swine infections

EP4766388A1Pending Publication Date: 2026-07-01CEVA SANTE ANIMALE SA
View PDF 0 Cites 0 Cited by

Patent Information

Authority / Receiving Office
EP · EP
Patent Type
Applications
Current Assignee / Owner
CEVA SANTE ANIMALE SA
Filing Date
2024-08-23
Publication Date
2026-07-01

AI Technical Summary

Technical Problem

Current vaccination schemes for swine infections require multiple injections and do not efficiently provide both active and passive immunization, leading to suboptimal protection against various pathogens in female pigs and their progeny.

Method used

A new administration scheme for a multivalent vaccine that includes a porcine parvovirus antigen combined with additional antigens inducing passive immunization in piglets through colostrum intake, administered to female pigs at least twice before insemination and once between insemination and farrowing.

Benefits of technology

This scheme reduces the number of injections, provides effective active and passive immunization, and ensures protection against multiple swine infections in both female pigs and their offspring.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 00000037_0000
    Figure 00000037_0000
  • Figure 00000038_0000
    Figure 00000038_0000
  • Figure 00000038_0001
    Figure 00000038_0001
Patent Text Reader

Abstract

The present disclosure relates to a multivalent vaccine composition and its use in the protection against swine infections in a female pig and its progeny with a new scheme of administration.
Need to check novelty before this filing date? Find Prior Art

Description

[0001]NEW SCHEME OF ADMINISTRATION OF A MULTIVALENT VACCINE AGAINST SWINE INFECTIONS TECHNICAL FIELD The present disclosure relates to a multivalent vaccine composition and its use in the protection against swine infections in a female pig and its progeny with a new scheme of administration. BACKGROUND OF THE INVENTION Pig production accounts for more than one-fourth of total protein consumed worldwide. Infectious diseases impact pig health and productivity of the global swine industry. The most common pathogens in sows and their offspring include Parvovirus, Erysipelas rhusiopathiae, Leptospira, Salmonella, PCV2, PRRSV, Influenza-A virus, Mycoplasma hyopneumoniae, Actinobacillus pleuropneumoniae, PRRSV, PCV2, Influenza, pathogenic E. coli, and Clostridium. Sows and gilts are vaccinated against these different pathogens during their lifetime by multiple injections of different vaccines. Vaccine mediated protection declines over time, and thus, the required timing of maximum protection differs for active and passive immunization. Vaccines used to actively protect sows and gilts from diseases such as Erysipelas and Parvovirosis are usually administered before first insemination, usually between 6 and 3 weeks before insemination for gilts and between 3 weeks and one day before insemination for sow and for booster vaccination, usually 1 day to 3 weeks before following insemination in each cycle, or every 6 months by mass vaccination. By these vaccination schedules, it is ensured that protection is achieved during pregnancy because many of the above-mentioned pathogens are associated with reproductive failure and abortions in sows (i.e., protection during pregnancy is required). Vaccine can also be used for passive immunization. Indeed, maternal immunity at an early age is critical for passive protection of neonatal pigs. Vaccines for passive immunization of piglets against for example neonatal diarrhoea caused by Clostridium spp. or E. coli infections are administered twice between 7 and 2 weeks before farrowing and for booster vaccination, usually once between 4 and 2 weeks before each farrowing in sows to give piglets protection by passive immunization via colostrum intake. Multivalent vaccines capable of conferring simultaneous immunity to different pathogens or diseases upon one single injection emerge as the most manageable solution to protect animals. Indeed, it is desirable to inject all necessary antigens in a single vaccine, which makes the vaccination procedure less traumatic and painful for the animal, more time efficient and more manageable for the practitioner. Although some combined vaccines have already been successfully developed, immunological interferences might occur between two or more antigen specific immune responses simultaneously induced in vivo. Moreover, it is needed to elucidate the most appropriate vaccination scheme with multivalent vaccine to confer an efficient active and passive immunization protection in a pig and its progeny. It remains a need to develop a new efficient scheme of administration for a multivalent vaccine to give female pig protection via active immunization and give piglets protection via passive immunization through colostrum intake. SUMMARY In contrast to the classical administration schemes adapted either for passive or active immunization and which require a repeated number of injections in pigs, the inventors in the present application have developed for the first time a new administration scheme which allows both active and passive immunization at the same time while being highly effective. This highly effective new administration scheme thus allows to reduce the number of injections and facilitate the vaccination in pigs (Figure 1). By using this new administration scheme, the inventors showed that a multivalent vaccine confers an efficient protection against infections administered in a female pig. This multivalent vaccine has no negative effect in vaccinated female pigs and protects against infections by active immunization in vaccinated female pigs as well as to the progeny of the animals through the intake of colostrum. The demonstration of the efficacy and safety of the new scheme of administration of a multivalent vaccine made in the present application will allow to modify the primary vaccination protocols of pigs and facilitate greatly the vaccination of pigs by making it less traumatic for the pigs. The present invention relates to a vaccine composition for use in the protection against swine infections in a female pig, preferably a gilt and its progeny comprising a porcine parvovirus antigen, preferably a porcine inactivated parvovirus, in combination with at least a second antigen inducing maternally passive immunization in piglet through colostrum intake and wherein said composition is administered to said female pig (e.g., said gilt) as a primary vaccination at least two times before insemination and at least one time in the time interval between insemination and farrowing. In a preferred embodiment, the vaccine composition is administered at least two times no more than 10 weeks before insemination and at least one time no more than 4 weeks before farrowing, more preferably two times before insemination with an interval of at least two weeks. In a more preferred embodiment, said composition is administered at least one time between 10 and 4 weeks, preferably between 9 and 4, 8 and 4 or more preferably between 7 and 5 weeks before insemination, at least one time between 6 and 1 weeks, preferably between 5 and 1 weeks or between 4 and 1 weeks, more preferably between 3 and 2 weeks before insemination and, at least one time between 6 and 1 weeks, preferably between 5 and 1, between 4 and 1, more preferably between 3 and 2 weeks before farrowing. In a particular embodiment, said second antigen is selected from the group consisting of: Escherichia coli, Clostridium spp, Streptococcus suis, Swine Influenza virus, Porcine circovirus type 2 (PCV-2), Mycoplasma hyopneumonia, Porcine reproductive and respiratory syndrome virus (PRRSV), Porcine epidemic diarrhoea virus (PEDV), porcine rotavirus, transmissible gastroenteritis virus (TGEV), Actinobacillus pleuropneumoniae (APP), Haemophilus parasuis, Pasteurella multocida, Leptospira, Bordetella bronchiseptica, Salmonella spp, Lawsonia intracellularis, African swine fever virus (ASFV), Staphylococcus hyicus and Brachyspira hyopneumoniae antigens, preferably selected from the group consisting of: Escherichia coli, Clostridium spp and Streptococcus suis antigens. In a preferred embodiment, said vaccine composition comprises an Escherichia coli fimbrial adhesin antigen, preferably selected from the group consisting of: F4ab, F4ac, F5 and F6 antigens, preferably said composition comprises Escherichia coli fimbrial adhesins F4ab, F4ac, F5 and F6 antigens. In another preferred embodiment, said vaccine composition comprises a Clostridium spp toxoid, preferably selected from the group consisting of: Clostridium difficile toxoid, C. perfringens type A or C alpha toxoid, C. perfringens type A beta 2 toxoid, C. perfringens type C beta 1 toxoid, C. perfringens Type A or C Enterotoxin (CPE) and C. perfringens (all strains) theta toxoid (Perfringolysin, PFO), preferably said composition comprises C. perfringens type A or C alpha toxoid, C. perfringens type A beta 2 toxoid or C. perfringens type C beta 1 toxoid, more preferably said composition comprises Clostridium perfringens type A alpha toxoid, Clostridium perfringens type A beta 2 toxoid and Clostridium perfringens type C beta 1 toxoid. In another preferred embodiment, said vaccine composition comprises a Streptococcus suis antigen, preferably a Streptococcus suis IgM protease antigen. The vaccine composition can also comprise a Erysipelothrix rhusiopathiae antigen, preferably an inactivated Erysipelothrix rhusiopathiae bacteria. In a particular embodiment, the vaccine composition comprises an adjuvant, preferably aluminium hydroxide adjuvant or oil adjuvant. In a preferred embodiment, the vaccine composition comprises: a) porcine inactivated parvovirus, b) an inactivated Erysipelothrix rhusiopathiae bacteria, c) Escherichia coli fimbrial adhesins F4ab, F4ac, F5 and F6 antigens, d) Clostridium perfringens type A or C alpha toxoid, Clostridium perfringens type A beta 2 toxoid and Clostridium perfringens type C beta 1 toxoid and optionally e) a Streptococcus suis antigen, preferably a Streptococcus suis IgM protease antigen. The vaccine composition is preferably administered by intramuscular, intradermal, transdermal or subcutaneous route, preferably intramuscular route. DETAILED DESCRIPTION OF THE INVENTION Vaccine composition The inventors in the present application have developed for the first time a new primary vaccination (also named herein basic vaccination) administration scheme of a multivalent vaccine which allows efficient active and passive immunization protection against swine infections in a pig or its progeny. A primary vaccination refers to the initial series of vaccine doses that are given to subject to establish immunity to a particular disease. The number of doses and the timing of the doses can vary depending on the specific vaccine and the age of the individual. Booster doses can be thereafter administered to said vaccinated female pig (e.g., gilt) that has completed the primary vaccination series when, with time, the immunity and clinical protection has fallen below a rate deemed sufficient in that population. The present disclosure relates to a vaccine composition for use in the protection of infections in a female pig, preferably a gilt and its progeny comprising a porcine parvovirus antigen in combination with at least a second antigen inducing maternally passive immunization in piglet through colostrum intake and wherein said composition is administered to said female pig, preferably said gilt as a primary vaccination at least two times before insemination and at least one time in the time interval between insemination and farrowing. According to a preferred embodiment, when said composition is administered to a gilt, the vaccine composition is administered to said gilt as a primary vaccination at least two times before the first insemination and at least one time in the time interval between first insemination and first farrowing. A vaccine composition is a pharmaceutical composition that is safe to administer to a subject animal, and which elicits an immunological response when administered in a subject against a pathogenic micro-organism, i.e., to induce a successful protection against the micro- organism. Vaccine composition comprises molecules with antigenic properties such as immunogenic polypeptides. According to the present disclosure the vaccine composition comprises a porcine parvovirus (PPV) antigen in combination with at least one second antigen inducing maternally passive immunization. Porcine parvovirus (PPV) is a small ssDNA icosahedral nonenveloped virus with 5 kb-long genomic DNA, which belongs to the Parvoviridae family, Parvovirinae subfamily and Protoparvovirus genus. Said PPV can be classified in different genotypes PPV1 to PPV7, which were further classified based on their different characterization as a separate genus within the family Parvoviridae. In a preferred embodiment, the vaccine composition according to the present disclosure comprises PPV1. According to the present disclosure, the vaccine composition comprises an inactivated, subunit-antigen, or live-attenuated porcine parvovirus, preferably inactivated porcine parvovirus. Any strains of PPV can be used as a source of antigens according to the present disclosure. The strain can be selected, among others, from field strains, collection strains or genetically modified strains. In a particular embodiment, said vaccine composition may comprise any one of parvovirus strain including as non-limiting examples: NADL-2, MSV, Kresse, 143a, 27a or K22. In a preferred embodiment, said vaccine composition comprises inactivated porcine parvovirus K22 strain. Said inactivated PPV can be inactivated by any methods known in the art including heat treatment or chemical treatment for example by adding formalin, BEI (binary ethylenimine), or other chemical agents having properties like these agents. Said vaccine composition may comprise an attenuated live PPV that has been altered, typically by passaging in tissue culture cells, to attenuate its ability to cause disease, but which maintains its ability to protect against disease or infection when administered to animals. In another embodiment, said vaccine composition may comprise a subunit antigen such as an epitope, a protein, a polysaccharide, a polypeptide or a peptide, or a part of the antigen also called fragment, that can be directly administered to a subject or expressed by viral or bacterial vector administered into said subject. The subunit antigen may also be present in the form of a VLP. In a preferred embodiment, said subunit antigen may be PPV major structural protein, such as VP1 and / or VP2 capsid proteins. The said subunit antigen may be present in the form of a virus-like particles (VLP) comprising a VP2 protein that assembles into VLP that are similar in size and morphology to the original virion. According to the present disclosure, said vaccine composition comprises at least one second antigen inducing maternally passive immunization. In passive immunization, immunity (e.g., antibodies or lymphocytes) is transferred from another individual’s immune system. Typically, in swine, passive immunization, also called lactogenic immunity or maternal immunity relates to the transfer of antibodies from a female pig to their piglets through colostrum intake. Passive immunity can be induced artificially by administering an antigen in a female pig that results in protecting efficacy against infections in suckling pigs through colostrum intake, in particular results in colostrum content (e.g., antibodies, lymphocytes, etc.) titers sufficient to protect said suckling pigs against infections. Said at least one second antigen inducing maternally immunization according to the present disclosure can be any antigens that confer protection to suckling pigs against infectious diseases and thereby decrease the number of infections in piglets, in particular decrease piglet mortality. Said at least one second antigen may be any antigens inducing maternally passive immunization well-known in the art. The second antigen may be bacterial or viral antigen. Said second antigen may be an inactivated bacteria or virus, live-attenuated bacteria or virus or a subunit antigen. An "inactivated" bacterial or viral strain is understood to be one that is not able to cause disease in an animal and includes any strain that a person of skill in the art would consider safe for administering to an animal as a vaccine. For example, a strain causing minor clinical signs, which may include fever, serous nasal discharge, or ocular discharge can be an inactivated strain since such clinical signs are considered acceptable vaccine side effects. Bacteria or virus can be inactivated by any methods known in the art including heat treatment, chemical treatment, or recombinant DNA method in which for example a gene mutation is introduced in the genome of the strain to abrogate its ability to cause disease. As used herein, a "modified live virus", “attenuated live virus”, "modified live bacteria" or “attenuated live bacteria” is a viral or bacterial strain that has been altered, typically by passaging in tissue culture cells, to attenuate its ability to cause disease, but which maintains its ability to protect against disease or infection when administered to animals. A “subunit antigen” is understood to be a part of the pathogen that is antigenic and elicits an immune response. It may be an epitope, such as a protein, a polysaccharide, a polypeptide or a peptide, or a part of the antigen also called fragment. In the present description, the terms “polypeptide”, “peptide” and “protein” are used interchangeably and refer to any molecule comprising a polymer of at least 5 consecutives amino acids. The term “fragment” designates a shorter part of an antigen eliciting an immune response against said antigen, and generally contains from 2 to 50 consecutive amino acid residues of an antigen, such as 2 to 40, or from 10 to 40. The said subunit antigen is produced by any methods known in the art, including in-vitro methods wherein the antigen will be purified and isolated by an industrial process, or in-vivo methods wherein the antigen will be directly expressed into the targeted organism, for example expressed by viral or bacterial vector. The subunit antigen may also be present in the form of a VLP. According to the present disclosure, said at least one second antigen inducing maternally passive immunization can be selected from the group consisting of: Escherichia coli, Clostridium spp., Streptococcus suis, Swine Influenza virus, Porcine circovirus type 2 (PCV- 2), Porcine reproductive and respiratory syndrome virus (PRRSV) type 1 or 2, Porcine epidemic diarrhoea virus (PEDV), porcine rotavirus, transmissible gastroenteritis virus (TGEV), Actinobacillus pleuropneumoniae (APP), Haemophilus parasuis, Pasteurella multocida, Leptospira spp., Bordetella bronchiseptica, Salmonella spp., Lawsonia intracellularis, African swine fever virus (ASFV), Staphylococcus hyicus and Brachyspira hyopneumoniae antigens, preferably selected from the group consisting of: Escherichia coli, Clostridium spp. and Streptococcus suis antigens. In a particular embodiment, said at least one second antigen may be a bacterial antigen, preferably selected from the group consisting of: Escherichia coli, Clostridium spp., Streptococcus suis, Actinobacillus pleuropneumoniae (APP), Pasteurella multocida, Leptospira spp., Bordetella bronchiseptica, Salmonella spp., Lawsonia intracellularis, Staphylococcus hyicus, Brachyspira hyopneumoniae and Haemophilus parasuis. In another particular embodiment, said at least one second antigen may be a viral antigen, preferably selected from the group consisting of: Porcine circovirus type 2 (PCV-2), Swine Influenza virus, Porcine reproductive and respiratory syndrome virus (PRRSV) type 1 or 2, Porcine epidemic diarrhoea virus (PEDV), Porcine rotavirus, transmissible gastroenteritis virus (TGEV) and African swine fever virus (ASFV). In a particular embodiment, said at least one second antigen may be any antigens that confer protection to a female pig, preferably a gilt and its progeny against swine infections, such as enteric, respiratory and / or systemic disease. In a particular embodiment, said at least one second antigen may be any antigens that confer protection to a female pig, preferably a gilt and its progeny against enteric diseases, caused by infectious agents preferably selected from the group consisting of: Escherichia coli, Clostridium spp., Brachyspira hyopneumoniae, Lawsonia intracellularis, Porcine epidemic diarrhoea virus (PEDV), Salmonella spp., Porcine rotavirus and transmissible gastroenteritis virus (TGEV) infection. In another particular embodiment, said at least one second antigen may be any antigens that confer protection to a female pig, preferably a gilt and its progeny against respiratory diseases, caused by infectious agents preferably selected from the group consisting of: Actinobacillus pleuropneumoniae (APP), Pasteurella multocida, Bordetella bronchiseptica, Porcine reproductive and respiratory syndrome virus (PRRSV) type 1 or 2. In another particular embodiment, said at least one second antigen may be any antigens that confer protection to a female pig, preferably a gilt and its progeny against systemic diseases, caused by infectious agents preferably selected from the group consisting of: Streptococcus suis, Porcine circovirus type 2 (PCV-2), African swine fever virus (ASFV) and Swine Influenza virus. According to the present disclosure, said at least one second antigen may be an Escherichia coli antigen. Escherichia coli is a Gram-negative, facultative anaerobic, rod-shaped, coliform bacterium of the genus Escherichia. The key virulence factors of enterotoxigenic E. coli (ETEC) infection are adhesins also called colonization factors and enterotoxins. The fimbrial adhesins allow them to adhere to or colonize the absorptive epithelial cells of the jejunum and ileum. According to the present disclosure, said at least one second antigen can be an E. coli antigen, preferably E. coli fimbrial adhesin antigen and / or E.coli enterotoxin antigen, more preferably selected from the group consisting of: F4ab (K88ab, UniProtKB - P02970, last modified on May 25, 2022), F4ac (K88ac, UniProtKB - P14190, last modified on May 25, 2020), F5 (K99, UniProtKB - P18103, last modified on May 25, 2022), F6 (987P, UniProtKB - P21413, last modified on May 25, 2022), F41 (F7, UniProtKB - P11900, last modified on May 25, 2022), F17 (F17a-g, UniProtKB – Q99003, Q47200, Q47033, Q47199, Q9RH92, Q9RH91, Q47341 respectively, last modified on May 25, 2022), F18 (UniProtKB - Q47212, last modified on June 2, 2021), F165 (UniProtKB - Q46685, last modified on May 25, 2022), CS1541(Crotty D. et al. Dev Biol. 2020 Mar 1;459(1):11-12) , CS31A (Song Li et al. Vet Med Sci.2020 Feb;6(1):69-75), LT, Sta, STb, EAST-1, alpha-hemolysin. The common antigenic types of fimbriae associated with pathogenicity are F4ab, F4ac, F5 (K99), F6, F41 (F7) and F18. Infection in neonates is commonly caused by F4ab, F4ac, F5 and F6 strains, whereas postweaning colibacillosis is nearly always due to the F4 and F18 strains (See Vet Rec.2002 Janl2; 150(2): 35-7). In a preferred embodiment, the vaccine composition comprises one or more E. coli antigens selected from fimbrial adhesins F4ab (K88ab), F4ac (K88ac), F5 (K99), F6 (987P), F41 (F7) and F18 antigens. In a more preferred embodiment, the vaccine composition according to the present disclosure comprises E. coli F4ab (K88ab), F4ac (K88ac), F5 (K99) and F6(987P) antigens. In a particular embodiment, said at least one second antigen can be a Clostridium spp. antigen. Clostridium is a genus of Gram-positive bacteria. This genus includes several significant human pathogens, including the causative agents of botulism and tetanus. The genus includes an important cause of diarrhoea, Clostridium difficile. According to the present disclosure, Clostridium spp. can be as non-limiting examples: Clostridium botulinum, Clostridium tetani, Clostridium difficile or Clostridium perfringens, preferably Clostridium difficile or Clostridium perfringens, more preferably Clostridium perfringens. Clostridium perfringens (formerly known as Bacillus aerogenes capsulatus, Bacillus perfringens, Bacillus welchii or Clostridium welchii) is a Gram positive, spore-forming, anaerobic, rod-shaped bacterium. C. perfringens is classified into different biotypes designated A through E according to the production of major toxins. Clostridium perfringens produces the following toxins: alpha toxin also known as Phospholipase C, hemolysin, lecithinase or phosphatidylcholine cholinephosphohydrolase (UniProtKB - Q0TV31, last modified on May 25, 2022), beta1 toxin (UniProtKB - Q46181, last modified on May 25, 2022), epsilon toxin (UniProtKB - Q02307, last modified on May 25, 2022), iota toxin (NCBI Reference Sequence: WP_003463422.1, last updated on July 29, 2019), beta2 toxin (UniProtKB - O86264, last updated on June 2, 2021), theta toxin also known as perfringolysin O (PFO) or Thiol-activated cytolysin (UniProtKB - P0C2E9, last modified on May 25, 2022), Mu toxin also known as hyaluronoglucosaminidase (UniProtKB - P26831, last modified on May 25, 2022), delta toxin also known as alpha hemolysin (UniProtKB - B8QGZ7, last modified on May 25, 2022), kappa toxin also known as collagenase A (UniProtKB - P43153, last modified on May 25, 2022), lambda toxin (UniProtKB - Q46237, last modified May 25, 2022) clostridium enterotoxin (CPE) also known as heat-labile enterotoxin B chain (UniProtKB - P01558, last modified on May 25, 2022), and necrotic enteritis B-like toxin (NetB) (UniProtKB - A0A2P0ZHP7, last modified on May 25, 2022). The term “toxoid” as used herein means inactivated toxin whose toxicity has been inactivated or suppressed either by chemical (e.g., glutaraldehyde), molecular or heat treatment while immunogenicity is maintained. When used during vaccination, an immune response is mounted, and immunological memory is formed against the molecular markers of the toxoid without resulting in toxin-induced illness. Most of the toxoids have the same polypeptide sequence as the toxin as described above from which they derive from. Toxoid can either be isolated from E coli or obtained by using recombinant DNA method. The Clostridium spp. toxoid (e.g., Clostridium perfringens) according to the present disclosure, can be derived from any naturally toxin encoded by a Clostridium strain. The strain can be selected, among others, from field strains, collection strains or genetically modified strains. The different toxoids can be obtained from the same strain for example for type A alpha and beta2 toxoid or from different strains. Alternatively, the Clostridium perfringens toxoid according to the present disclosure can be obtained by using recombinant DNA method. The toxoids can be obtained by chemical (e.g., glutaraldehyde), molecular or heat treatment, in particular by chemical treatment, protease cleavage, recombinant DNA methods by making fragments or mutations of the toxins (e.g., point mutations) or by thermal treatment of the corresponding toxins by routinary means known by the skilled in the art. In particular, treatment with EDTA or glutaraldehyde are examples of suitable chemical inactivating agents for use in inactivate bacterial toxoids of the invention. Other chemical inactivating agent is formalin or formaldehyde. The inactivation can be performed using standard methods known to those of skill in the art. In one embodiment, EDTA is preferably used in alpha toxoid preparation and glutaraldehyde used in beta 1 and beta 2 toxoid. Clostridium perfringens type A infections are common causes of enteric diseases in pigs, diarrhoea in neonatal piglets and other animal. Clostridium perfringens type A mainly produces alpha toxin with or without beta2 toxin. Clostridium perfringens type C strains cause severe and lethal necrotic enteritis (NE) in newborn piglets and are defined by carrying the two toxin genes cpa (encoding for α-toxin or CPA), cpb1 (encoding for β1-toxin). In a preferred embodiment, the vaccine composition according to the present disclosure comprises a Clostridium perfringens type A antigen and / or Clostridium perfringens type C antigen, preferably a Clostridium perfringens type A toxoid and / or Clostridium perfringens type C toxoid. In a preferred embodiment, said vaccine composition comprises at least one antigen selected from the group consisting of: Clostridium perfringens type A or C alpha toxoid, Clostridium perfringens type A beta2 toxoid and Clostridium perfringens type C beta1 toxoid, more preferably said vaccine composition comprises Clostridium perfringens type A alpha toxoid, Clostridium perfringens type A beta2 toxoid and Clostridium perfringens type C beta1 toxoid. Streptococcus suis (S.suis) is a gram-positive bacterium from the genus Streptococcus. The bacteria are divided into different serotypes. The strains can be selected, among others, from field strains, collection strains or genetically modified strains. S.suis serotypes 2 has been considered the most virulent serotypes and the most frequently isolated from diseased animals. According to the present disclosure, said at least one second antigen can be a Streptococcus Suis bacterin. A bacterin is a suspension of killed bacteria. Said bacterin can be autogeneous bacterins made from strains cultured from a particular herd and given to no immune saws. In another particular embodiment, said at least one second antigen can be a Streptococcus Suis live attenuated bacteria, preferably a Streptococcus Suis serotype 2 or 9, more preferably a Streptococcus Suis serotype 2. In another preferred embodiment, said at least one second antigen can be a Streptococcus Suis antigen, preferably selected from the group consisting of suilysin, MRP, EF, MAP, SAO, and IgM protease. In a more preferred embodiment, said at least one second antigen is a Streptococcus suis IgM protease antigen, more preferably an IdeSsuis. IdeSsuis, also named IgM protease of Streptococcus suis is an enzyme that specifically degrades porcine IgM (Seele et al. Journal of Bacteriology, 2013, 195:930-940, Seele et al. Vaccine, 2015, 33:2207-2212). The IdeSsuis antigen according to the present disclosure encodes an enzyme of 1141 amino acids (SEQ ID NO: 1, UniProtKB / Swiss-Prot: C5W022.1). In one particular embodiment, the IdeSsuis antigen is the protein sequence without the signal peptide sequence (SEQ ID NO: 2). Said IdeSsuis antigen can be derived from any serotypes of IdeSsuis. In a preferred embodiment, said IdeSsuis antigen is serotype 2 IdeSsuis antigen. Said IdeSsuis antigen can be IdeSsuis protein or an immunogenic variant thereof. IdeSsuis immunogenic capacity of a variant may be assessed by any method known by the skilled person in the art. For instance, immunogenic activity may be assessed for example by bactericidal assays or challenge assays in pigs. As used herein, the term “IdeSsuis immunogenic variant” refers to a polypeptide sequence that is derived from IdeSsuis protein as described above and comprises an alteration, i.e., a substitution, insertion, and / or deletion, at one or more (e.g., several) positions, but retains the immunogenic capacity. The variant may be derived from different serotypes of Streptococcus suis or obtained for example by techniques for altering the DNA sequence encoding the native protein, include, but are not limited to, site-directed mutagenesis, random mutagenesis and synthetic oligonucleotide construction. In a preferred embodiment, the IdeSsuis immunogenic variant comprises at least the Mac-1 domain (SEQ ID NO: 3) known to retain the immunogenic capacity of IdeSsuis protein. In another preferred embodiment, the IdeSsuis immunogenic variant comprises the Mac-1 domain and does not comprise the peptide signal sequence and transmembrane domain of IdeSsuis protein (SEQ ID NO: 4). Preferably, as used herein, the term "immunogenic variant” refers to a polypeptide comprising an amino acid sequence having at least 70, 75, 80, 85, 90, 95 or 99% sequence identity to amino acid sequence of SEQ ID NO: 1, 2, 3 or 4. According to the present disclosure, said IdeSsuis immunogenic variant can comprise or consist of SEQ ID NO: 3 or an amino acid sequence having at least 70, 75, 80, 85, 90, 95 or 99% sequence identity to amino acid sequence of SEQ ID NO: 3. In a particular embodiment, said IdeSsuis immunogenic variant comprises an amino acid sequence of at least 350, preferably 400, 450, 500, 550 or 600 amino acids and comprises or consist of SEQ ID NO: 3 or an amino acid sequence having at least 70, 75, 80, 85, 90, 95 or 99% sequence identity to amino acid sequence of SEQ ID NO: 3. As used herein, the term "sequence identity" or "identity" refers to the number (%) of matches (identical amino acid residues) in positions from an alignment of two polypeptide sequences. The sequence identity is determined by comparing the sequences when aligned so as to maximize overlap and identity while minimizing sequence gaps. In particular, sequence identity may be determined using any of a number of mathematical global or local alignment algorithms, depending on the length of the two sequences. Sequences of similar lengths are preferably aligned using a global alignment algorithm (e.g. Needleman and Wunsch algorithm; Needleman and Wunsch, 1970) which aligns the sequences optimally over the entire length, while sequences of substantially different lengths are preferably aligned using a local alignment algorithm (e.g. Smith and Waterman algorithm (Smith and Waterman, 1981) or Altschul algorithm (Altschul et al, 1997; Altschul et al., 2005). Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software available on internet web sites such as http: / / blast.ncbi.nlm.nih.gov / or http: / / www.ebi.ac.uk / Tools / emboss / . Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, % amino acid sequence identity values refers to values generated using the pair wise sequence alignment program EMBOSS Needle that creates an optimal global alignment of two sequences using the Needleman-Wunsch algorithm, wherein all search parameters are set to default values, i.e. Scoring matrix = BLOSUM62, Gap open = 10, Gap extend = 0.5, End gap penalty = false, End gap open = 10 and End gap extend = 0.5. According to the present disclosure, said IdeSsuis immunogenic variant can comprise an amino acid sequence that differs from a sequence of SEQ ID NO: 1, 2, 3 or 4 by less than 50, 45, 40, 35, 30, 25, 20, 15, 10 or 5 substitutions, insertions and / or deletions. In a preferred embodiment, said IdeSsuis immunogenic variant can comprise an amino acid sequence that differs from the amino acid sequence of SEQ ID NO: 1, 2, 3 or 4 by one or more conservative substitutions, preferably by less than 50, 45, 40, 35, 30, 25, 20, 15, 10 or 5 conservative substitutions. By "substituted" or "modified" the present invention includes those amino acids that have been altered or modified from naturally occurring amino acids. The term "conservative substitution" as used herein denotes the replacement of an amino acid residue by another, without altering the overall conformation and function of the peptide, including, but not limited to, replacement of an amino acid with one having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, shape, hydrophobic, aromatic, and the like). Examples of conservative substitutions are within the groups of basic amino acids (arginine, lysine and histidine), acidic amino acids (glutamic acid and aspartic acid), polar amino acids (glutamine and asparagine), hydrophobic amino acids (methionine, leucine, isoleucine and valine), aromatic amino acids (phenylalanine, tryptophan and tyrosine), and small amino acids (glycine, alanine, serine and threonine). In another particular embodiment, said at least one second antigen may be a swine Influenza antigen. Said swine Influenza may be inactivated swine influenza, live-attenuated swine influenza or a subunit antigen including as non-limiting example hemagglutinin (HA) antigen. In a particular embodiment, said antigen is whole inactivated virus, preferably including H1N1, H1N2 and / or H3N2 virus subtypes. Any strains of swine influenza virus can be used as a source of antigens according to the present disclosure. In another particular embodiment, said at least one second antigen may be Porcine circovirus 2 (PCV-2) antigen. Said PCV2 antigen may be inactivated PCV2 virus, live-attenuated PCV2 or a subunit vaccine including as non-limiting examples ORF2 expressing encoding structural capsid (Cap) protein. In a particular embodiment, said antigen may be PCV2 inactivated virus such as Circovac® or FosteraTM. Said antigen may also be a subunit vaccine made from the components of the main immunogen of the virus such as Ingelvac CircoflexTM, Circumvent or Porcilis PCV ® expressing ORF2 encoding structural capsid (Cap) protein., or PCV capsid expressed by Mhyo bacteria. In another particular embodiment, said at least one second antigen may be African swine fever virus (ASFV) antigen. Said ASFV antigen may be inactivated ASFV, live-attenuated ASFV or subunit antigen. In a particular embodiment, subunit vaccines can be based on some of the most extensively studied ASFV antigens, such as p32, p54, and p72 envelope proteins. In another particular embodiment, said at least one second antigen may be a Porcine reproductive and respiratory syndrome virus (PRRSV) type 1 pr 2, Porcine epidemic diarrhoea virus (PEDV), Transmissible gastroenteritis virus (TGEV) or porcine rotavirus antigen. Said PRSSV, PEDV, TGEV or porcine rotavirus antigen may be inactivated virus, live-attenuated virus or subunit antigen. In another particular embodiment, said at least one second antigen may be an Actinobacillus pleuropneumoniae (APP) antigen. Said APP antigen may be an attenuated bacterium, live- inactivated bacteria also named bacterin or subunit antigen such as Apx toxins including ApxIA, ApxIIA, ApxIIIA and / or ApxIV or outer membrane proteins. Any strains of Actinobacillus pleuropneumoniae can be used as a source of antigens according to the present disclosure. In another particular embodiment, said at least one second antigen may be a Haemophilus parasuis antigen. Said Haemophilus parasuis antigen may be a bacterin, live-attenuated bacteria or subunit antigen including as non-limiting examples: outer membrane proteins such as OmpA, PalA, Omp2, D15 or HPS06257. Any strains of Haemophilus parasuis can be used as a source of antigens according to the present disclosure. In another particular embodiment, said at least one second antigen may be a Pasteurella multocida antigen. Said a Pasteurella multocida may be a bacterin, live-attenuated bacteria or subunit antigen including Pasteurella multocida toxoid (PMT) or recombinant PMT. Any strains of Pasteurella multocida can be used as a source of antigens according to the present disclosure. In another particular embodiment, said at least one second antigen may be a Bordetella bronchiseptica antigen. Said a Bordetella bronchiseptica may be a bacterin, live-attenuated bacteria or subunit antigen including Bordetella bronchiseptica dermonecrotic toxoid (DNT) or recombinant DNT. Any strains of Bordetella bronchiseptica can be used as a source of antigens according to the present disclosure. In another particular embodiment, said at least one second antigen may be a Salmonella spp. antigen. Said Salmonella spp. antigen may be a bacterin, live attenuated bacteria or subunit antigen, preferably attenuated live bacteria such as Salmoporc®. The Salmonella bacteria may be a Salmonella enterica serovar Typhimurium, Salmonella enterica serovar Enteritidis, Salmonella enterica serovar Infantis, Salmonella enterica serovar Heidelberg, Salmonella enterica serovar Derby, Salmonella enterica serovar Agona, Salmonella enterica serovar Cholerasuis, Salmonella enterica serovar Johannesburg, Salmonella enterica serovar Anatum, Salmonella enterica serovar Senfenberg, Salmonella enterica serovar Newport, Salmonella enterica serovar München, Salmonella enterica serovar Worthington. In another particular embodiment, said at least one second antigen may be Lawsonia intracellularis antigen. Said Lawsonia intracellularis antigen may be a bacterin, live- attenuated bacteria or subunit antigen. In a particular embodiment, said antigen may be inactivated Lawsonia intracellularis such as Porcilis® Lawsonia or a modified live attenuated such as ENTERISOL® Ileitis. In another particular embodiment, said at least one second antigen may be Bordetella bronchiseptica, Leptospira spp., Staphylococcus Brachyspira, or hyopneumoniae hyicus antigen. Said Bordetella bronchiseptica, Leptospira spp., Staphylococcus Brachyspira spp., or hyopneumoniae hyicus antigen may be a bacterin, live attenuated bacteria or subunit antigen. The vaccine composition according to the present disclosure can further comprise an Erysipelothrix rhusiopathiae antigen. Erysipelothrix rhusiopathiae is a Gram-positive, catalase-negative, rod-shaped, non-spore-forming, non-acid-fast, nonmotile bacterium. According to the present disclosure, said vaccine composition may further comprise an E. rhusiopathiae antigen selected from the group consisting of: E. rhusiopathiae attenuated- live bacteria, E. rhusiopathiae inactivated bacteria, also called E. rhusiopathiae bacterin, or E. rhusiopathiae bacteria subunit antigen including as non-limiting examples: SpaA, cbpB, rspaA, GAPDH, HP0728, HP1472, CpbA and ERT2T-A antigens. In a particular embodiment, said vaccine composition may comprise a E. rhusiopathiae bacteria serotype 1 and / or 2 antigens. Any strains of E. rhusiopathiae can be used as a source of antigens according to the present disclosure. In a preferred embodiment, said E. rhusiopathiae strain is E. rhusiopathiae IM950 strain. In a preferred embodiment, said vaccine composition comprises an inactivated Erysipelothrix rhusiopathiae bacteria, preferably inactivated Erysipelothrix rhusiopathiae serotype 2 bacteria. Said inactivated E. rhusiopathiae can be inactivated by any methods known in the art including heat treatment or chemical treatment for example by adding thiomersal, or other chemical agents having properties like these agents. In a preferred embodiment, said vaccine composition comprises: i) E. coli fimbrial adhesin F4ab, F4ac, F5 and F6 antigens, ii) C. perfringens type A alpha toxoid, Clostridium perfringens type A beta2 toxoid and C. perfringens type C beta1 toxoid iii) inactivated porcine parvovirus, iv) an inactivated E. rhusiopathiae bacteria and optionally v) a Streptococcus Suis antigen, preferably Streptococcus suis IgM protease antigen. Pharmaceutical carrier The vaccine composition according to the present disclosure can comprise said antigens as described above in combination with a pharmaceutically acceptable carrier, i.e., a biocompatible medium, i.e., a medium that after administration does not induce significant adverse reactions in the subject animal, capable of presenting the antigen to the immune system of the host animal after administration of the vaccine. Such a pharmaceutically acceptable carrier may for example be a liquid containing water and / or any other biocompatible solvent or a solid carrier such as commonly used to obtain freeze-dried vaccines (based on sugars and / or proteins), optionally comprising immunostimulating agents (adjuvants). Optionally other substances such as stabilizers, viscosity modifiers or other components are added depending on the intended use or required properties of the vaccine. In a preferred embodiment, the vaccine composition according to the present disclosure may comprise an adjuvant. Adjuvants, as is well known in the art, are nonspecific stimulants of the immune system, which, administered together with the antigen, enhance the immunological response. Conventional adjuvants, well-known in the art are e.g., Freund's Complete and Incomplete adjuvant, aluminium hydroxide, -phosphate or -oxide, silica, Kaolin, Bentonite, oil emulsion such as oil-in-water (O / W), water-in-oil-in-water emulsion (W / O / W), water-in-oil (W / O), tocopherol-alpha, vitamin E, non-ionic block polymers, muramyl dipeptides, Quil A®, mineral oil, e.g. Bayol® or Markol®; Drakeol®, vegetable oil, saponine, DEAE Dextran, and carbomer or combinations thereof. In a preferred embodiment, said adjuvant is aluminium hydroxide or oil adjuvant or a combination thereof. Adjuvants can be incorporated in the vaccine composition as described above to enhance the effectiveness thereof. Alternatively, the adjuvant may be administered before, or after the administration of the vaccine of the invention. Prophylactic uses The present disclosure relates to the vaccine composition as described above for use in the protection against swine infections in a female pig and its progeny in need thereof. By “protection against an infection” as used herein relates to the protection against a micro- organism resulting from the stimulation of the immune response against said micro- organism, preventing, ameliorating one or more clinical signs associated with a pathogenic infection or a disorder arising from that infection, for example to prevent or reduce one or more clinical signs resulting from the infection with the pathogen or in particular embodiment, to decrease the mortality associated with said pathogenic infection. By “Swine infection” as used herein relates to a swine disease caused by an infectious agent such as virus, bacteria, parasite, and other agents, such as fungi or prions. Infectious disease is a common contributing factor to mortality in all growth stages of swine. Mortality categories with the largest proportions include respiratory, gastrointestinal, meningeal / central nervous system signs, and failure to thrive. In a particular embodiment, said swine infection can be selected from the group of disease caused by an infectious agent selected from the group consisting of: Porcine parvovirus, Escherichia coli, Clostridium spp., Streptococcus suis, Swine Influenza virus, Porcine circovirus 2 (PCV-2), Porcine reproductive and respiratory syndrome virus type 1 and 2 (PRRSV1 and -2), Porcine epidemic diarrhoea virus (PEDV), Porcine rotavirus, transmissible gastroenteritis virus (TGEV), Actinobacillus pleuropneumoniae (APP), Haemophilus parasuis, Pasteurella multocida, Leptospira spp., Bordetella bronchiseptica, Salmonella spp., Lawsonia intracellularis, African swine fever virus (ASFV), Staphylococcus hyicus, Brachyspira hyopneumoniaei and E. rhusiopathiae. In a preferred embodiment, said swine infection(s) can be a disease caused by a Porcine parvovirus, and at least one disease caused by at least one of the infectious agents selected from the group consisting of: Escherichia coli, Clostridium spp., Streptococcus suis, Swine Influenza virus, Porcine circovirus 2 (PCV-2), Porcine reproductive and respiratory syndrome virus (PRRSV) type 1 and 2, Porcine epidemic diarrhoea virus (PEDV), Porcine rotavirus, transmissible gastroenteritis virus (TGEV), Actinobacillus pleuropneumoniae (APP), Haemophilus parasuis, Pasteurella multocida, Leptospira spp., Bordetella bronchiseptica, Salmonella spp., Lawsonia intracellularis, African swine fever virus (ASFV), Staphylococcus hyicus, and Brachyspira hyopneumoniae. In another preferred embodiment, said swine infection(s) can be a disease caused by a Porcine parvovirus, E. rhusiopathiae and at least one disease caused by at least one of infectious agents selected from the group consisting of: Escherichia coli, Clostridium spp., Streptococcus suis, Swine Influenza virus, Porcine circovirus 2 (PCV-2), Porcine reproductive and respiratory syndrome virus (PRRSV) type 1 and 2, Porcine epidemic diarrhoea virus (PEDV), Porcine rotavirus, transmissible gastroenteritis virus (TGEV), Actinobacillus pleuropneumoniae (APP), Haemophilus parasuis, Pasteurella multocida, Leptospira spp., Bordetella bronchiseptica, Salmonella spp., Lawsonia intracellularis, African swine fever virus (ASFV), Staphylococcus hyicus, and Brachyspira hyopneumoniae, preferably Escherichia coli, Clostridium spp. and Streptococcus suis. Porcine parvovirus (PPV) infection can cause reproductive failure in naïve dams. It is characterized by the occurrence of large numbers of mummified foetuses, an increase in the number of returns to oestrus, small litters, failures to farrow, decreased farrowing rate, weak born and viraemic piglets; rarely abortion. Porcine parvoviral infection (PPV) is endemic in most swine herds and probably the most diagnosed infectious cause of reproductive failure in swine. Clostridium difficile is a bacterium that causes an infection of the colon. Symptoms can range from diarrhoea to life threatening damage to the colon. Clostridium perfringens type A causes catarrhalis enteritis resulting in creamy-pasty diarrhoea (with low mortality) and Clostridium perfringens type C causes haemorrhagic- necrotizing enteritis resulting in peracute, acute or chronic bloody diarrhoea with high mortality. Both Infections are oral and occur at birth and the organisms rapidly reach very high numbers within the last part of the small intestine and the large intestine. The beta1 toxin of C. perfringens type C rapidly destroys the cells lining the small intestine, so that blood is lost into the intestine resulting in death. The alpha and beta 2 toxins of C. perfringens type A cause secretion of fluid in the small intestine, and some inflammation and diarrhoea. It may also reach high numbers and cause diarrhoea in the suckling pig. E. rhusiopathiae infection causes the disease known as erysipelas that may affect a wide range of animals. Erysipelas describes a bacterial disease seen in naïve animals of any age and characterized clinically for example by septicaemia, cutaneous erythema, including characteristic diamond-shaped lesions, chronic degenerative arthritis, endocarditis, shock or death. E. coli commonly found in the lower intestine of warm-blooded organisms is the causative agent of a wide range of diseases in pigs, which are important causes of death occurring worldwide in suckling and weaned pigs respectively. Two main pathotypes are involved in enteric colibacillosis: enterotoxigenic E. coli (ETEC) and enteropathogenic E. coli (EPEC). ETEC is the most important pathotype in swine. Escherichia coli infection, in particular enterotoxigenic E. coli (ETEC) infection is responsible for watery diarrhoea in farm animals, in particular in newborn, suckling, and as well as in post-weaning piglets and is associated with reduced growth rate, morbidity, and mortality. Influenza in pigs is a highly contagious disease characterized by fever, coughing, sneezing, conjunctivitis, nasal discharge, lethargy, depressed appetite, and death. It causes a significant reduction in the growth rate of affected pigs and contributes to the porcine respiratory disease complex. Porcine circovirus-associated diseases (PCVAD) include PCV2 systemic disease, PCV2 reproductive disease (PCV2-RD), porcine dermatitis and nephropathy syndrome, and subclinical infections. Porcine reproductive and respiratory syndrome virus type 1 and 2 (PRRSV1 and -2) are causing disease characterized by inappetence and severe reproductive failure, including late term abortions, increased numbers of still-born, mummified, and weak-born piglets, and respiratory affection in pigs of all ages. Immune suppression causing increased risk of secondary infection, and compromised response to vaccinations are less distinct consequences. Porcine epidemic diarrhoea virus (PEDV), a member of the genus Alphacoronavirus in the family Coronaviridae of the order Nidovirales, causes acute diarrhoea, vomiting, dehydration and high mortality in neonatal piglets. Rotavirus infection may occur with rotavirus A being the most common and pathogenic to pigs, B being less common, and C primarily affecting preweaning pigs. Rotavirus infections also occur with other aetiologies, increasing the severity of disease. A common presentation of rotavirus infections occurs within the preweaning period as piglet diarrhoea but can be a contributing ethology to postweaning diarrhoea also. Rotavirus can result in significant malabsorptive diarrhoea in postweaning pigs due to villous blunting and, especially in the presence of coinfections, can be a contributor to postweaning mortality from other causes, such as colibacillosis, salmonellosis, or inanition. Transmissible gastroenteritis is a viral disease of swine caused by the coronavirus TGEV, which belongs to the family Coronaviridae. TGEV disease is characterized by acute diarrhoea and vomiting and result in high mortality in pigs less than two weeks age. Actinobacillus pleuropneumoniae (APP or A.p.) is a major pig pathogen that causes a highly contagious severe necrotizing haemorrhagic pneumonia (pleuropneumoniae) with high mortality, but also sustained subacute, or subclinical pleuropneumoniae. All usually developing into long-lasting chronic disease. Infected animals usually become lifelong tonsillar carriers. Until alveolar infection, the animal will be sero-negative. Haemophilus parasuis causes systemic disease characterized by polyserositis, polyarthritis, and meningitis. Pasteurella multocida associated disease occurs as either upper respiratory tract disease known as progressive atrophic rhinitis (PAR, commonly PMT-positive serotype D) or lower respiratory tract pneumonia (commonly PMT-negative serotype A). Leptospirosis is a vector (mainly rodent) transmitted sporadic reproductive disease, except in the case of Leptospira pomona which can also be contagious between swine. Leptospira spp. comprises a large group of serovars. The family Leptospiraceae contains eight pathogenic species of which three are of most importance to swine: L. interrogans (serovars pomona, icterohaemorrhagiae, canicola, and bratislava), L. borgpetersenii (serovars sejroe and tarassovi) and L. kirschneri (serovar grippotyphosa). Reproductive failure, as evidenced by infertility and sporadic abortion, are the most common clinical signs of leptospirosis in swine. Bordetella bronchiseptica is a primary cause of upper respiratory disease and pneumonia through colonization, potentially enhanced by other infectious agents, as influenza virus. Bordetella bronchiseptica is commonly isolated from the respiratory tract of pigs and often contributes to multifactorial disease processes historically, including atrophic rhinitis and most commonly Porcine Respiratory Disease Complex. Clinical disease due to Salmonella spp. are primarily due to S. enterica serotype typhimurium and S. enterica serotype choleraesuis. Host-adapted S. choleraesuis affects postweaning pigs and results in septicaemia, whereas S. typhimurium is more like to be manifested with diarrhoea and dehydration. Lawsonia intracellularis is an obligate intracellular bacterium that causes either acute disease (proliferative haemorrhagic enteritis) or a chronic disease (porcine proliferative enteropathy). It occurs commonly in in pigs 1½ to 6 months of age. The organism causes an increase in the thickness of the intestinal wall because of hyperplasia of infected enterocytes and can cause significant losses due to reduced appetite, enteric absorption and diarrhoea. The acute haemorrhagic enteritis results in enterocyte necrosis, bloody diarrhoea, and sudden death in elder finishers, gilts and young sows is less commonly seen, however disastrous when reappearing. The chronic form developing progressively in weaners, growers and finishers, disease symptoms are lethargy, chronic enteritis, weight loss, and ultimately wasting. African swine fever virus (ASFV) is a highly contagious and fatal haemorrhagic swine disease. Staphylococcus hyicus infection is the primary cause of Exudative epidermitis (EE). Staphylococcus hyicus produces exfoliative toxins namely ExhA, ExhB, ExhC and ExhD, SHETA and SHETB. The lesions caused by Staphylococcus hyicus infection can be generalized or localized in specific parts of the body such as the head and the neck, and are characterized by sebaceous exudation, which then develops into epidermal erosions and crusts. The most common ages affected are suckling and weaned pigs up to six weeks of age. Brachyspira hyodysenteriae infection caused swine dysentery, is a contagious mucohaemorrhagic diarrhoeal disease which is mainly seen in grower / finisher pigs, characterised by extensive inflammation and necrosis of the epithelial surface of the large intestine. Morbidity of this worldwide occurring disease can be up to 90%, mortality varies between 9-30%. Disease caused by Glaesserella parasuis, previously named Haemophilus parasuis, (is characterized by fibrinous serositis or polyserositis and septicaemia with tissue localizations in meninges, joints, peritoneum, pleura and / or peritoneum. G. parasuis is commonly present and can lead to significant mortality in populations of animals with no previous exposure. As used herein, the term "host" or "subject" is intended for the target individuals in need thereof to whom the immunogenic composition or vaccine of the invention are administered, among other humans, mammals, livestock, or any other animal species susceptible to be vaccinated with the compositions of the invention. Preferably, the mammal is a porcine specie, more preferably is a pig, and more preferably is a female pig. As used herein, the term "pig" or "swine" is intended for porcine species including, among others, pigs, boars, sows, gilts, and piglets of any age or in any phase of their production cycle. According to the present disclosure, said pig is preferably female pig. Said female pig can be a sow or a gilt. In a preferred embodiment, said pig is a gilt. A gilt is a female pig who has not farrowed. Once a pig has had a litter and is past her first year, she is called a sow. New scheme of administration The inventors determined the most appropriate timing of administration of the multivalent vaccine composition according to the present disclosure for a primary vaccination conferring simultaneous immunity to different pathogens by active immunization in vaccinated gilts and sows and their progeny via the intake of colostrum. The present disclosure relates to a vaccine composition as described above for use in the protection against swine infections in a female pig and its progeny wherein said composition is administered to a female pig at least two times before insemination and one time in the time interval between insemination and farrowing. In a preferred embodiment, the present disclosure relates to a vaccine composition as described above for use in the protection against swine infections in a gilt and its progeny wherein said composition is administered to said gilt at least two times before insemination and one time in the time interval between insemination and farrowing. By “insemination”, it is intended natural mating or artificial insemination. Artificial insemination is the insertion and delivery of semen into the reproductive canal of a female pig (gilt or sow). The most common method of artificial insemination involves delivering semen to traverse the cervix. By “farrowing”, it is intended the process of birthing a litter of pigs. By “weeks before insemination” or “weeks before farrowing”, it is respectively intended the expected natural mating or artificial insemination date regarding the hormonal reproductive cycle of the female pig the expected date of delivering the piglets. In a particular embodiment, said composition is administered for a primary vaccination, at least two times no more than 10 weeks before insemination, preferably no more than 9, 8, 7, 6, 5 and again 2 weeks before insemination and more preferably with an interval of at least two weeks between each of the two administrations before insemination, and at least one time no more than 4 weeks, preferably no more than 3, more preferably no more than 2 weeks before farrowing. In a preferred embodiment, said vaccine composition is administered for a primary vaccination: - at least two times between 10 and 1 weeks, preferably between 8 and 1 weeks before the insemination, and preferably with an interval of at least two weeks between each of the two administrations before insemination, - and at least one time between 6 and 1 weeks, preferably between 4 and 1 before farrowing. Booster doses can be thereafter administered to said vaccinated female pig (e.g., gilt) that has completed the primary vaccination series when, with time, the immunity and clinical protection has fallen below a rate deemed sufficient in that population. In a particular embodiment, said primary vaccination course is followed by a booster vaccination one time between 6 and 1 weeks, preferably between 4 and 1 week, again more preferably between 3 and 2 weeks before each subsequent farrowing. In a preferred embodiment, said vaccine composition is administered for a primary vaccination: - at least one time between 10 and 4 weeks, preferably between 9 and 4 weeks, more preferably between 8 and 4 weeks before insemination, again more preferably between 7 and 5 weeks before insemination, - at least one time between 6 and 1 weeks before insemination, preferably between 5 and 1 weeks, between 4 and 1 weeks before insemination, more preferably between 3 and 2 weeks before insemination and, - at least one time between 6 and 1 weeks before farrowing, preferably between 5 and 1, or between 4 and 1 weeks before farrowing, again more preferably between 3 and 2 weeks before farrowing. In another preferred embodiment, said vaccine composition is administered for a primary vaccination: - at least one time 6 weeks before insemination, - at least one time 3 weeks before insemination and, - at least one time 2 weeks before farrowing. In a particular embodiment, said primary vaccination course is followed by a booster vaccination one time between 6 and 1 weeks, preferably between 5 and 1, or between 4 and 1 weeks, again more preferably between 3 and 2 weeks before each subsequent farrowing. In another particular embodiment, the said vaccine composition is administered as a primary vaccination two times before insemination, wherein the two injections are performed within an interval of 2, 3 or 4 weeks, and the second injection is administered at least 1 week before insemination, preferably 2 or 3 weeks before insemination, even more preferably 4 weeks before insemination, and said vaccine composition is administered at least one time between 4 and 1 weeks, again more preferably between 3 and 2 weeks before farrowing. In a particular embodiment, said primary vaccination course is followed by a booster vaccination one time between 6 and 1 weeks, preferably between 5 and 1, or between 4 and 1 weeks, again more preferably between 6 and 1 weeks, preferably between 5 and 1, or between 4 and 1 weeks, again more preferably between 3 and 2 weeks before each subsequent farrowing. In a particular embodiment, the present disclosure relates to the use of a vaccine composition as described above in the manufacture of a medicament for the protection against swine infections in a female pig, preferably a gilt and its progeny in need thereof wherein said composition is administered to said female pig, preferably gilt at least two times before insemination and at least one time in the time interval between insemination and farrowing. In another particular embodiment, the present disclosure relates to a method for protecting against swine infections a female pig and its progeny in need thereof comprising administering an immunologically effective amount of the vaccine composition as described above in said female pig, wherein said composition is administered to a female pig at least two times before insemination and at least one time in the time interval between insemination and farrowing. In a particular embodiment, said primary vaccination course is followed by a booster vaccination one time between 6 and 1 weeks, preferably between 5 and 1, or between 4 and 1 weeks, again more preferably between 6 and 1 weeks, preferably between 5 and 1, or between 4 and 1 weeks, again more preferably between 3 and 2 weeks before each subsequent farrowing. An " immunologically effective amount " as used herein relates to the amount of antigen that is necessary to induce an immune response in subjects to the extent that it decreases an infection or the pathological effects caused by the infection with a wild-type infectious agent, when compared to the pathological effects caused by infection with a wild-type infectious agent in non-immunized pigs. The immunologically effective amount can be established by the skilled person via routine methods commonly known in the art, for instance by administering an experimental challenge infection to vaccinated animals and next determining a target animal’s pathological scoring, feed intake, clinical signs of disease, serological parameters or by measuring re-isolation of the pathogen, followed by comparison of these findings with those observed in field-infected pigs. The vaccine according to the present invention may be administered by any suitable route of administration, including parenteral administration, e.g., through all routes of injection into or through the skin, e.g., intramuscular, intravenous, intraperitoneal, intradermal, submucosal, or subcutaneous, but is typically adapted, i.e. suitable, for intramuscular injection. In a preferred embodiment, said vaccine composition is administered by intramuscular route. In a particular embodiment, immunologically effective amounts of said antigens are mixed before administration of the vaccine composition to the female pig. In a preferred embodiment, the different antigens are mixed no more than 48 or 24 hours, preferably no more than 10 hours before administration, more preferably between 1 and 10 hours before administration. In one embodiment, said vaccine composition according to the present disclosure can be administered in a female pig for protecting against swine infections said female pig and its progeny at doses well known by one skilled in the art at which protective immunity is obtained, such as those indicated for commercially available vaccines. The doses can be established by routine experimentation and depends i.e., on the immunogenic properties of the antigen chosen but also on the required level of protection. In a particular embodiment, commercially available vaccines comprising said antigens are mixed before administration to the pig as illustrated in the example of the present application. FIGURE LEGENDS Figure 1: Comparison of the conventional (above) and new (below) scheme for vaccines Figure 2: Mean rectal body temperature after the first vaccination in piglets. Figure 3: Mean rectal temperature after the second vaccination in piglets. Figure 4: Antibody titers in blood of piglets at Day 0 and Day 35 after vaccination in piglets. Figure 5: Rectal body temperatures post vaccination in sows. Figure 6: Antibody titers in blood and colostrum in sows at different days before and after vaccination. EXAMPLES EXAMPLE 1: Safety and efficacy studies in piglets The purpose of the first study was to investigate whether the associated use of two vaccines for either active or passive immunization has any impact on the safety or the level of induced antibodies following vaccination. Piglets were vaccinated at 9 weeks of age. They were selected as free of antibodies against the respective antigens, and because it was not expected that the immunological response of sows or young piglets differs from each other. Furthermore, due to the lower body weight of animals of this age compared to sows, any possible safety reactions would have been observed with higher probability. The objective of this study was to assess the efficacy and safety of ENTEROPORC Coli AC mixed with a commercial batch PARVORUVAX after vaccination (twice vaccination at an interval of 3 weeks) of piglets. Group 1 (n=10 animals) received a mixture of the vaccines ENTEROPORC Coli AC and PARVORUVAX (IVP), Group 2 (n=10 animals) received ENTEROPORC Coli AC (CP1) and Group 3 received PARVORUVAX (CP2). All animals were vaccinated twice. Day of first vaccination was study day 0, day of second vaccination was study day 21. Blood samples were taken from the animals at the days of vaccination and 14 days after second vaccination (study day 35) to demonstrate the gain of antibody levels evoked by vaccination. Local reactions at the injection sites were evaluated until 14 days post each vaccination. Rectal temperatures were recorded one day before each vaccination, at the day of vaccination (before vaccination), 2, 4 and 6 h after vaccination and afterwards once daily until 7 days post first and 4 days post second vaccination, respectively. General health was checked daily throughout the study. The study was terminated after last blood sampling of the animals (study day 35). Serological response to each of the vaccine antigens was measured before vaccination (study day 0) and 2 weeks after 2nd vaccination (study day 35). 1.1 Material and methods - Animals For this study 30 piglets are used and first vaccinated at age of 9 weeks + / - 3 days. Animals of the herd are regularly monitored. The animals were derived from sows which are known to be free of Influenza A viruses, PRRS, Mycoplasma hyopneumoniae, pseudorabies, classical swine fever virus and as well as partially positive for PCV2, E. coli (ETEC) and Pasteurella multocida. - Vaccines For demonstration of the efficacy of the combined vaccine, two registered products ENTEROPORC Coli AC and PARVORUVAX from IDT Biologika GmbH and Ceva Santé Animale were used. The investigational Veterinary Product (IVP) is ENTEROPORC Coli AC (comprising E. coli fimbrial adhesins F4ab, F4ac, F5 and F6 antigens and Clostridium perfringens toxoid type A alpha toxoid, type A beta 2 toxoid and type C beta 1 toxoid), mixed with PARVORUVAX (comprising an inactivated Erysipelothrix rhusiopathiae bacteria and inactivated porcine Parvovirus). The PARVORUVAX product may also be found in the market with the brand name PARVORUVAC, both products have the same components, only different registered trade names. CP1 and CP2 corresponds respectively to ENTEROPORC Coli AC alone and PARVORUVAX alone. Enteroporc COLI (3 x 10 doses = 67.5 ml) was transferred into a 100 ml sterile Schott flask. Of this, 15 ml Enteroporc COLI suspension was discarded and the remaining 52.5 ml of the ENTEROPORC Coli suspension were used for resuspension the lyophilizate of ENTEROPORC AC (25 doses). Mixing was performed by transferring approximately 5 mL of the ENTEROPORC Coli suspension to the vial containing the ENTEROPORC AC lyophilizate. The vial was gently shaken, and the content retransferred to the sterile Schott flask. This process was repeated once more. From this reconstituted vaccine, 25 mL were mixed with 25 mL PARVORUVAX (ready to use vaccine) to achieve 50 mL of IVP. The final vaccine was stored at 2-8°C until vaccination and used within 2 hours after reconstitution. Animals were vaccinated by intramuscular route at the right and left side of the neck. All study animals received 2 x 4 mL of the respective treatment on two days. No misdosing occurred during administration. All animals were observed daily for general health by an Animal Technician to positively confirm if an animal was healthy or not. - Rectal body temperature Rectal body temperature was measured using a calibrated thermometer on the time points indicated in the schedule of events. - Examination of injection sites Immediately before vaccination and on the days specified in the schedule of events injection sites were examined according to standard procedures. The lesion of the insertion of the injection needle and an area of 0.1 cm around this lesion was not considered as a relevant local reaction and therefore was recorded neither as colour change nor as swelling. The size (length and width) of swellings and colour changes (redness) was measured by a calliper. The scoring system described in Table 1 was used for redness and sensible heat at the injection site. Parameter Score 0 = no redness Redness 1 = mild redness (slightly reddened) 2 = moderate redness (reddish) 3 = severe redness (purple colour) Sensible heat 0 = no sensible heat detectable 1 = sensible heat detected Table 1: Injection site scoring system - Sample collection and storage Blood samples (approximately 5-8 ml) were taken from jugular vein without addition of anti- coagulant. Serum was prepared from the clotted blood samples. The samples were not heat- inactivated. Until use the sera were stored at -15°C to -25°C. The period between blood sampling and storage did not exceed 24 hours. - ELISA tests A 96 well microtiter plate (MTP) was coated with monoclonal antibodies which specifically bind the respective antigens. Antibodies were detected by enzyme-linked anti-pig-IgG antibodies and an enzyme dependent colour change of a substrate by measuring the optical density. 1.2 Results There was a slight increase in rectal temperature at the day of vaccination in the groups vaccinated with Enteroporc COLI AC alone or Enteroporc COLI AC plus Parvoruvax. The increase in rectal temperature did not differ within these two groups (Figure 2 and 3). The simultaneous use of Enteroporc COLI AC and Parvoruvax resulted in comparable antibodies against Erysipelas and Parvovirosis compared to Parvoruvax alone (Figure 4). The antibody response against E coli antigens was slightly lower in the associated use group compared to the Enteroporc COLI AC group but still above the antibody titers in gilts that had previously been shown to protect their offspring. In conclusion, no relevant interference of the mixture Enteroporc COLI AC and PARVORUVAC could be observed following 2 vaccinations of the mixture compared to single use in terms of safety and (serological) efficacy. EXAMPLE 2: safety and efficacy study in sows The purpose of the second study was to confirm the piglet results in sows. Sows from Group IVP received mixed vaccine Enteroporc Coli AC and Parvoruvax, 6 and 3 weeks before insemination and Enteroporc COLI AC alone 2 weeks before farrowing. The mixing of the vaccines was performed just before vaccination. The vaccine composition and analytical methods used in this study are similar to those used in the first example. Sows from Group CP received Parvoruvax vaccine at 6 and 3 weeks before insemination. Rectal temperature was measured at days -1, 0, 0+4h, 0+6h, as well as on the four following days of each vaccination. Local and systemic reactions were examined for 14 days after each vaccination. Serologiocal response was measured at 14 days before 1st vaccination, at day of 2nd vaccination (study day 21), before insemination (study day 44) and 4 days after farrowing (study day 167). In addition, antibody titers in colostrum were determined. There was a slight increase in rectal temperature at the day of vaccination in the group vaccinated with Enteroporc COLI AC plus Parvoruvax which was however within the acceptable range given for the two vaccines in the respective SPCs (Figure 5). No local and no systemic reactions were observed for any of the two vaccinated groups. The simultaneous use of Enteroporc COLI AC and Parvoruvax resulted in comparable antibodies against Erysipelas and Parvovirosis compared to Parvoruvax alone. Unexpectedly, the antibody response against E coli and Clostridia antigens in blood and also colostrum was considerably above the protective antibody titers compared to Enteroporc COLI AC alone (Figure 6). Together, these results indicate that the simultaneous use of 9 different antigens of E. coli, Clostridium spp., Parvovirus and Erysipelothrix rhusiopathie is safe and efficacious in gilts and sows and provides piglets with protection through colostrum intake. Sequences for use in practicing the disclosure: SEQ ID NO: 1: IdeSsuis protein NIQERFSLRKSAVGLVSVSLLCAIYTSTVAADTVVTGVNEIIEESQVKDEVSIESEKNESLDGSNIEIVEEIA DNIPSPVIAEGEVAVEMKVDRGTENVVSRNDTEVTTSEQNQIEVTETKEILNQTSYQTESGEQRQIIWAHGIT PPAMEQSGGFVKEKYGDYLNYTAPFEAGKGYYDTNKSLNASFIDLNLCFAAVSSNMVHWWLEQNSSYVERYLK EKKGTVNVEENYAITDLRRYINSFQNQQNSRVFDMFKTYYGYRTNGFVSDALVDLFINGYKPKAQGGVNLEDS QLVPDSRGGFFYDVFKEKKLTNRIFSGSYERFGEDVRTVLESKGLLGLTYRTLGYATHIVTVWGAEYDNQGKI KAVYITDSDDQQEQIGLKRMGITRDASGNPRLNNHMKNNSAGALLDYVHTIRLGQDLWEEYFNPLAKAKETAS QTLADTKKALDLSIQGQSELPESMRLIYLEKLNNLYNQGILSIQKAESSEMLSGALENGLNSLKSLDFPISEV GNALAPDLPVGDRSTVSDVDSLSSQETSSTNLEADTENAGIIADGTNQLHFPVEAQTTSSVEAEGDNVFEQEA DTLPIIIENKDEFGSELSRNMQTSETDSLVVAVEEDVKNDEVAQVEELLESEKVENQSSELLSDTLIVESAND KEEDRVEAVVSEQPDSIPHQNVEISLVEPTNVETETVVTPINDAATPHGSPTYIDNSVTESVATPLEKDSIQA GETEIAEPTSSESTNVETETVVTPVNDVATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTNV ETETVVTPVNDVATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTSVEAELVDNSEIHAATSS VTPCGSSAYADGSTTESVATPLEKDSIQTGNTEIAEPTSSKSTNVEAASVDNSEIHADASLTAVSSVNLDNPV IEPVAISLIGSKRDTNAEVEVSSLSKREVRKTNTDGLISVQSKVIKKELLESSLAEAGSPLLEATIAQSSNSN STEIGMSYQNTVLLESNNTERQVSKAEIVMEHKETELVETVSSASEPVVLVENISQTSNNTIESGKNMGVQSQ AGAKQILGVEQSSKVSTPTSRQIMGVGLLTLVLGSALGLLKKRRK SEQ ID NO: 2: IdeSsuis protein without peptide signal DTVVTGVNEIIEESQVKDEVSIESEKNESLDGSNIEIVEEIADNIPSPVIAEGEVAVEMKVDRGTENVVSRND TEVTTSEQNQIEVTETKEILNQTSYQTESGEQRQIIWAHGITPPAMEQSGGFVKEKYGDYLNYTAPFEAGKGY YDTNKSLNASFIDLNLCFAAVSSNMVHWWLEQNSSYVERYLKEKKGTVNVEENYAITDLRRYINSFQNQQNSR VFDMFKTYYGYRTNGFVSDALVDLFINGYKPKAQGGVNLEDSQLVPDSRGGFFYDVFKEKKLTNRIFSGSYER FGEDVRTVLESKGLLGLTYRTLGYATHIVTVWGAEYDNQGKIKAVYITDSDDQQEQIGLKRMGITRDASGNPR LNNHMKNNSAGALLDYVHTIRLGQDLWEEYFNPLAKAKETASQTLADTKKALDLSIQGQSELPESMRLIYLEK LNNLYNQGILSIQKAESSEMLSGALENGLNSLKSLDFPISEVGNALAPDLPVGDRSTVSDVDSLSSQETSSTN LEADTENAGIIADGTNQLHFPVEAQTTSSVEAEGDNVFEQEADTLPIIIENKDEFGSELSRNMQTSETDSLVV AVEEDVKNDEVAQVEELLESEKVENQSSELLSDTLIVESANDKEEDRVEAVVSEQPDSIPHQNVEISLVEPTN VETETVVTPINDAATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTNVETETVVTPVNDVATP HGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTNVETETVVTPVNDVATPHGSPTYIDNSVTESVA TPLEKDSIQAGETEIAEPTSSESTSVEAELVDNSEIHAATSSVTPCGSSAYADGSTTESVATPLEKDSIQTGN TEIAEPTSSKSTNVEAASVDNSEIHADASLTAVSSVNLDNPVIEPVAISLIGSKRDTNAEVEVSSLSKREVRK TNTDGLISVQSKVIKKELLESSLAEAGSPLLEATIAQSSNSNSTEIGMSYQNTVLLESNNTERQVSKAEIVME HKETELVETVSSASEPVVLVENISQTSNNTIESGKNMGVQSQAGAKQILGVEQSSKVSTPTSRQIMGVGLLTL VLGSALGLLKKRRK SEQ ID NO: 3: Mac-1 domain EIADNIPSPVIAEGEVAVEMKVDRGTENVVSRNDTEVTTSEQNQIEVTETKEILNQTSYQTESGEQRQIIWAH GITPPAMEQSGGFVKEKYGDYLNYTAPFEAGKGYYDTNKSLNASFIDLNLCFAAVSSNMVHWWLEQNSSYVER YLKEKKGTVNVEENYAITDLRRYINSFQNQQNSRVFDMFKTYYGYRTNGFVSDALVDLFINGYKPKAQGGVNL EDSQLVPDSRGGFFYDVFKEKKLTNRIFSGSYERFGEDVRTVLESKGLLGLTYRTLGYATHIVTVWGAEYDNQ GKIKAVYITDSDDQQEQIGLKRMGITRDASGNPRLNNHMKNNSAGALLDYVHTIRLGQDLW SEQ ID NO: 4: IdeSsuis variant TVVTGVNEIIEESQVKDEVSIESEKNESLDGSNIEIVEEIADNIPSPVIAEGEVAVEMKVDRGTENVVSRNDT EVTTSEQNQIEVTETKEILNQTSYQTESGEQRQIIWAHGITPPAMEQSGGFVKEKYGDYLNYTAPFEAGKGYY DTNKSLNASFIDLNLSFAAVSSNMVHWWLEQNSSYVERYLKEKKGTVNVEENYAITDLRRYINSFQNQQNSRV FDMFKTYYGYRTNGFVSDALVDLFINGYKPKAQGGVNLEDSQLVPDSRGGFFYDVFKEKKLTNRIFSGSYERF GEDVRTVLESKGLLGLTYRTLGYATHIVTVWGAEYDNQGKIKAVYITDSDDQQEQIGLKRMGITRDASGNPRL NNHMKNNSAGALLDYVHTIRLGQDLWEEYFNPLAKAKETASQTLADTKKALDLSIQGQSELPESMRLIYLEKL NNLYNQGILSIQKAESSEMLSGALENGLNSLKSLDFPISEVGNALAPDLPVGDRSTVSDVDSLSSQETSSTNL EADTENAGIIADGTNQLHFPVEAQTTSSVEAEGDNVFEQEADTLPIIIENKDEFGSELSRNMQTSETDSLVVA VEEDVKNDEVAQVEELLESEKVENQSSELLSDTLIVESANDKEEDRVEAVVSEQPDSIPHQNVEISLVEPTNV ETETVVTPINDAATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTNVETETVVTPVNDVATPH GSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTNVETETVVTPVNDVATPHGSPTYIDNSVTESVAT PLEKDSIQAGETEIAEPTSSESTSVEAELVDNSEIHAATSSVTPCGSSAYADGSTTESVATPLEKDSIQTGNT EIAEPTSSKSTNVEAASVDNSEIHADASLTAVSSVNLDNPVIEPVAISLIGSKRDTNAEVEVSSLSKREVRKT NTDGLISVQSKVIKKELLESSLAEAGSPLLEATIAQSSNSNSTEIGMSYQNTVLLESNNTERQVSKAEIVMEH KETELVETVSSASEPVVLVENISQTSNNTIESGKNMGVQSQAGAKQILGVEQSSKVSTPTSRQ

Claims

CLAIMS 1. A vaccine composition for use in the protection against swine infections in a female pig and its progeny comprising a porcine parvovirus antigen in combination with at least one second antigen inducing maternally passive immunization in piglets through colostrum intake and wherein said composition is administered to said female pig at least two times before insemination and at least one time in the time interval between insemination and farrowing.

2. The vaccine composition for use according to claim 1 wherein said composition is administered at least two times no more than 10 weeks before insemination and at least one time no more than 4 weeks before farrowing.

3. The vaccine composition for use according to claim 1 or 2 wherein said composition is administered two times before insemination with an interval of at least two weeks.

4. The vaccine composition for use according to any one of claims 1 to 3 wherein said composition is administered: - at least one time between 10 and 4 weeks, preferably between 8 and 6 weeks before insemination, - at least one time between 6 and 1 weeks, preferably between 5 and 1 weeks before insemination and, - at least one time between 6 and 1 weeks, preferably between 4 and 1 weeks before farrowing.

5. The vaccine composition for use according to any one of claims 1 to 4 wherein said at least one second antigen is selected from the group consisting of: Escherichia coli, Clostridium spp., Streptococcus suis, Swine Influenza virus, Porcine circovirus 2 (PCV-2), Porcine reproductive and respiratory syndrome virus (PRRSV) type 1 or 2, porcine epidemic diarrhoea virus (PEDV), Porcine rotavirus, transmissible gastroenteritis virus (TGEV), Actinobacillus pleuropneumoniae (APP), Haemophilus parasuis, Pasteurella multocida, Leptospira spp., Bordetellabronchiseptica, Salmonella spp., Lawsonia intracellularis, African swine fever virus (ASFV), Staphylococcus hyicus, and Brachyspira hyopneumoniae antigens, preferably selected from the group consisting of: Escherichia coli, Clostridium spp. and Streptococcus suis antigens.

6. The vaccine composition for use according to any one of claims 1 to 5 wherein said composition comprises an Escherichia coli fimbrial adhesin antigen, preferably selected from the group consisting of: F4ab, F4ac, F5 and F6 antigens, preferably said composition comprises Escherichia coli fimbrial adhesins F4ab, F4ac, F5 and F6 antigens.

7. The vaccine according to any one of claims 1 to 6 wherein said composition comprises a Clostridium spp. toxoid, preferably selected from the group consisting of: Clostridium difficile, C. perfringens type A or C alpha toxoid, C. perfringens type A beta 2 toxoid, C. perfringens type C beta 1 toxoid, C. perfringens Type A or C Enterotoxin (CPE) and C. perfringens (all strains) theta toxoid (Perfringolysin, PFO).

8. The vaccine composition for use according to claim 7 wherein said composition comprises Clostridium perfringens type A or C alpha toxoid, Clostridium perfringens type A beta 2 toxoid and Clostridium perfringens type C beta 1 toxoid.

9. The vaccine composition for use according to any one of claims 1 to 8 wherein said composition comprises Streptococcus suis antigen, preferably an IgM protease antigen.

10. The vaccine composition for use according to any one of claims 1 to 9 comprising a porcine inactivated parvovirus.

11. The vaccine composition for according to any one of claims 1 to 10 further comprising a Erysipelothrix rhusiopathiae antigen, preferably an inactivated Erysipelothrix rhusiopathiae bacteria.

12. The vaccine composition for use according to any one of preceding claims comprising an adjuvant, preferably aluminium hydroxide adjuvant or oil adjuvant.

13. The vaccine composition for use according to any one of preceding claims comprising: a) porcine inactivated parvovirus, b) an inactivated Erysipelothrix rhusiopathiae bacteria, c) Escherichia coli fimbrial adhesins F4ab, F4ac, F5 and F6 antigens, d) Clostridium perfringens type A alpha toxoid, Clostridium perfringens type A beta 2 toxoid and Clostridium perfringens type C toxoid, and optionally e) a Streptococcus suis antigen, preferably a Streptococcus suis IgM protease antigen.

14. The vaccine composition for use according to any one of claims 1 to 13 wherein said vaccine composition is administered by intramuscular, intradermal, transdermal or subcutaneous route, preferably intramuscular route.