Anti-ccr9 antibody

EP4766731A1Pending Publication Date: 2026-07-01SUNROCK BIOPHARMA SL +1
View PDF 0 Cites 0 Cited by

Patent Information

Authority / Receiving Office
EP · EP
Patent Type
Applications
Current Assignee / Owner
SUNROCK BIOPHARMA SL
Filing Date
2024-12-27
Publication Date
2026-07-01

AI Technical Summary

Technical Problem

There is a lack of effective therapeutic strategies for diseases associated with elevated CCR9 expression, such as inflammatory bowel disease and various types of cancer, including T-cell acute lymphoblastic leukemia (T-ALL) and pancreatic cancer, as current treatments targeting CCR9 are limited and have shown limited efficacy.

Method used

Development of anti-CCR9 antibodies or antigen binding fragments with specific CDR sequences that bind to CCR9, including variants with at least 95% sequence identity to SEQ ID NO:1, and their use in antibody drug conjugates (ADCs) for targeted therapy, along with diagnostic methods to detect CCR9 expression.

Benefits of technology

The anti-CCR9 antibodies demonstrate high binding affinity and stability under various conditions, effectively targeting CCR9-expressing cells, leading to enhanced therapeutic outcomes in diseases like inflammatory bowel disease and cancer, with improved binding stability and internalization capabilities.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure IMGF000006_0001
    Figure IMGF000006_0001
  • Figure IMGF000007_0001
    Figure IMGF000007_0001
  • Figure IMGF000026_0001
    Figure IMGF000026_0001
Patent Text Reader

Abstract

The present invention provides an anti-CCR9 antibody or antigen binding fragment thereof comprising a variable light chain comprising SEQ ID NO:1 or a variant thereof having at least 95% sequence identity to SEQ ID NO:1, wherein the variable light chain comprises a CDR-L1 comprising the amino acid sequence RSSQSLXHSNGXTFLH (SEQ ID NO: 2), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHXPWT (SEQ ID NO: 4), wherein X can be any amino acid. Also provided is the anti-CCR9 antibody or antigen binding fragment thereof for use in the treatment or prevention of a disease, as well as methods of diagnosis and antibody drug conjugates.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] ANTI-CCR9 ANTIBODY

[0002] This application claims priority from EP23383408.4 filed 29 December 2023, the contents and elements of which are herein incorporated by reference for all purposes

[0003] Field of the Invention

[0004] The present invention relates to anti-CCR9 antibodies or antigen binding fragments thereof and uses thereof.

[0005] Background

[0006] Chemokines are a family of small structurally related proteins that bind to seven transmembrane G protein-coupled receptors, with predominantly chemotactic function, currently composed of 44 members in humans. Chemokines and their receptors have an essential role in organogenesis and lymphocyte trafficking, in both homeostatic and inflammatory conditions. Chemokines generate gradients, either soluble or immobilized, and are responsible for tasks as diverse as directing cell movement, stimulating cell growth, activation or differentiation, or even regulating organogenesis in mammals (Zlotnik and Yoshie 2000, Raman, Sobolik-Delmaire et al. 2011 ). In the immune system, chemokines play a key role in homeostasis and in both innate and acquired immunity, by controlling the trafficking and recruitment of leukocytes.

[0007] Chemokines exert their biological effects through their interaction with specific receptors present on the cell surface. Structurally, these receptors belong to the G-protein-coupled seven-transmembrane-domain receptor (GPCR) superfamily (Bachelerie, Ben-Baruch et al. 2014). This system is characterized by key molecules in the activation of different genes, giving rise to different cellular responses that include chemotaxis, cell survival and proliferation (DeVries, Kelvin et al. 2006). There is a strong association between aberrant tumour cell expression of chemokine receptors such as CXCR4 or CCR7 and cancer progression, organ-selective metastasis, and poor prognosis. At the same time, they have great potential for use in tumour-targeted therapy (Weitzenfeld and Ben-Baruch 2014) in which, cancer-related chemokines could promote tumour proliferation, angiogenesis, and chemoresistance (Lazennec and Richmond 2010, Mukaida and Baba 2012, Sarvaiya, Guo et al. 2013).

[0008] Human chemokine receptor CCR9 (GenBank accession number. U45982) is a member of this superfamily of receptors, identified by Zaballos et al. (Zaballos, Gutierrez et al. 1999) (EMBL database accession number AJ132337) and Youn et al. (Youn, Kim et al. 1999). Under physiological conditions, the expression of CCR9 is highly restricted: it has been described in thymocytes (Zaballos, Gutierrez et al. 1999, Carramolino, Zaballos et al. 2001), infiltrating immune cells in the small intestine (Kunkel, Campbell et al. 2000) and in small subpopulations of circulating memory T cells (Zabel, Agace et al. 1999) and plasmacytoid dendritic cells (Wendland, Czeloth et al. 2007). Unlike other chemokine receptors, CCR9 has a single ligand called CCL25 (Chemokine Ligand 25 or TECK) secreted by epithelial and dendritic cells from the thymus and the small intestinal crypt epithelium and that, when binding to its receptor, it activates intracellular signaling pathways related to cell survival and mobility (Wurbel, Malissen et al. 2006). The CCR9-CCL25 interaction is a key regulator of thymocyte migration in thymus and of cell homing to the intestinal tract. Recent insights into the mechanisms of CCL25 / CCR9 show that they are involved in tumour chemoresistance and metastasis (Tu, Xiao et al. 2016), and the potential application of CCR9 in targeted therapies.

[0009] Expression of CCR9 is reported on the majority of gut-homing immune cells, including CD4+ and CD8+ T cells, gamma-delta T cells, plasmacytoid dendritic cells (pDCs), neutrophils and intraepithelial lymphocytes (lELs) (Pathak and Lal 2020; Wu et al, 2021). In this regard, evidence supports the role of the CCR9+-effector T-cells as a driver of inflammatory bowel disease (IBD) as clinical studies illustrate increased numbers of CCR9+ T cells in blood from individuals with small bowel inflammation (Trivedi and Adams, 2018) In addition to circulating gut homing T cells, subsets of proinflammatory monocytes also express high levels of CCR9 and their frequencies in the circulation correlate with clinical activity in some IBD patients (Trivedi and Adams, 2018).

[0010] Elevated CCR9 expression has been observed in various types of cancer. These include hematological tumours (T-cell acute lymphoblastic leukemia (T-ALL), follicular lymphoma and diffuse cell lymphoma B) (Qiuping, Z. et al. 2003, Wu, W. et al. 2014) and in solid tumours (lung, prostate, pancreas, breast and melanoma cancer). Such elevated expression of CCR9 would be advantageous for cells since, by binding to its ligand, CCL25, different signaling pathways would be activated, including PI3K / Akt, increasing the cell survival of transformed T lymphocytes and resistance to apoptosis mediated by this signaling pathway in different types of cancer (Sharma, Singh et al. 2010, Johnson-Holiday, Singh et al. 2011 ), as well as activation of the JNK1 anti-apoptotic pathway, and enhancement of proliferation by activating Notchl in leukemia cells, especially in T-lineage acute lymphoblastic leukemia (T-ALL) (Mirandola, Chiriva-lnternati et al. 2012). In addition, moderate levels of CCR9 expression have been observed in T cell chronic lymphocytic leukemia (T-CLL) CD4+ cells. In particular, when CCR9 is internalized into T-ALL CD4+ T cells, the chemotactic and adhesive ability of the leukemia cells are eliminated, indicating that CCR9 is closely associated with the infiltration and metastasis of leukemia cells.

[0011] Specific therapeutic tools to treat human CCR9+tumours growing in xenogeneic models are limited to the use of toxin-coupled ligands (CCL25-PE38 fusion protein) (Hu et al., 2011 , Leukaemia Res 35:1254-60) or ligand-specific antibodies alone or combined with the cytotoxic agent etoposide (Sharma et al., 2010, Int J Cancer 127:2020-30). In these strategies, the CCL25-CCR9 interaction is targeted to eliminate tumour cells; although the results have been limited, they provide evidence that CCR9 is a potential target for cancer immunotherapy.

[0012] Given the lack of therapies targeted to CCR9, there is still a need in the art to provide agents recognising CCR9 specifically that are suitable for the diagnosis, prognosis and / or treatment of a disease or condition concomitant with cells expressing CCR9. WQ2015 / 075269A1 discloses anti-CCR9 antibodies and their use in the treatment of cancers, including T cell acute lymphoblastic leukaemia (T-ALL), prostate cancer, breast cancer, melanoma, ovarian cancer, colorectal cancer and lung cancer. WO 2022 / 195028 also discloses anti-CCR9 antibodies and their use. WQ2015 / 075269A1 also discloses immunoconjugates in which the anti-CCR9 antibody is conjugated to or in the form of a fusion protein with another therapeutic agent such as a chemotherapeutic agent, including vincristine.

[0013] Despite the advances described above, there remains an urgent need for therapeutic strategies for the treatment of diseases such as inflammatory bowel disease and cancer, including T-cell acute lymphoblastic leukaemia (T-ALL) and pancreatic cancer. The present invention seeks to address this need and, as described in detail herein, provides further related advantages.

[0014] Summary of the Invention

[0015] The present invention relates generally to anti-CCR9 antibodies or antigen binding fragments thereof.

[0016] According to a first aspect, there is provided an anti-CCR9 antibody or antigen binding fragment thereof, comprising a variable light chain comprising SEQ ID NO:1 or a variant thereof having at least 95% sequence identity to SEQ ID NO:1 , wherein the variable light chain comprises a CDR-L1 comprising the amino acid sequence RSSQSLXHSNGXTFLH (SEQ ID NO: 2), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHXPWT (SEQ ID NO: 4), wherein X can be any amino acid.

[0017] In some embodiments, the CDR-L1 comprises the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5) or the amino acid sequence RSSQSLLHSNGNTFLH (SEQ ID NO: 6). In some embodiments, the CDR-L3 comprises the amino acid sequence SQTTHVPWT (SEQ ID NO: 7) or the amino acid sequence SQTTHLPWT (SEQ ID NO: 8).

[0018] The antibody or antigen binding fragment thereof may comprise a CDR-H1 comprising the amino acid sequence GFTFSXYWMX (SEQ ID NO: 9), a CDR-H2 comprising the amino acid sequence EIRSKSXNYATHYXESXXG (SEQ ID NO: 10) and a CDR-H3 comprising the amino acid sequence XYSPY (SEQ ID NO: 11), wherein X can be any amino acid. In some embodiments, the CDR-H1 comprises the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12) or the amino acid sequence GFTFSNYWMD (SEQ ID NO: 13). In some embodiments, the CDR-H2 comprises the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14) or the amino acid sequence EIRSKSNNYATHYAESMKG (SEQ ID NO: 15). The CDR-H3 may comprise the amino acid sequence FYSPY (SEQ ID NO: 16) or the amino acid sequence YYSPY (SEQ ID NO: 17).

[0019] In some embodiments, the antibody or antigen binding fragment thereof comprises a variable heavy chain comprising SEQ ID NO: 18 or a variant thereof having at least 95% sequence identity to SEQ ID NO: 18. In some embodiments, the antibody or antigen binding fragment thereof comprises a variable heavy chain comprising SEQ ID NO: 18 or SEQ ID NO: 19. In some embodiments, the variable light chain comprises SEQ ID NO: 1 or SEQ ID NO: 20.

[0020] In some embodiments, the antibody or antigen binding fragment thereof comprises: a variable light chain comprising SEQ ID NO:1 , wherein the variable light chain comprises a CDR-L1 comprising the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3), a CDR-L3 comprising the amino acid sequence SQTTHVPWT (SEQ ID NO: 7); and a variable heavy chain comprising a CDR-H1 comprising the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12), a CDR-H2 comprising the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14) and a CDR-H3 comprising the amino acid sequence FYSPY (SEQ ID NO: 16).

[0021] The antibody or antigen binding fragment thereof may bind to an epitope comprising amino acids 11 , 12, 13, 15 and 16 of the N-terminal extracellular domain of CCR9 isoform A (SEQ ID NO: 21).

[0022] In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof comprises an IgG anti-CCR9 antibody.

[0023] In some embodiments, the antibody or antigen binding fragment exhibits a binding affinity dissociation constant KD for human CCR9 of about 1 x 10-6M or less.

[0024] In some embodiments, the antibody or antigen binding fragment thereof exhibits a binding affinity dissociation constant KD for human CCR9 of from about 1 x 10-8M to about 1 x 10-10M.

[0025] Also provided by the present invention is an anti-CCR9 antibody or antigen binding fragment thereof comprising a variable light chain comprising SEQ ID NO:39, wherein SEQ ID NO: 39 comprises a CDR- L1 comprising the amino acid sequence RSSQSLXHSNGXTFLH (SEQ ID NO: 2), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHXPWT (SEQ ID NO: 4), wherein X can be any amino acid.

[0026] In some embodiments, the CDR-L1 comprises the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5) and the CDR-L3 comprises the amino acid sequence SQTTHVPWT (SEQ ID NO: 7).

[0027] The present invention also provides an anti-CCR9 antibody or antigen binding fragment thereof comprising a variable light chain comprising SEQ ID NO: 40, wherein SEQ ID NO: 40 comprises a CDR- L1 comprising the amino acid sequence RSSQSLXHSNGXTFLH (SEQ ID NO: 2), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHXPWT (SEQ ID NO: 4), wherein X can be any amino acid.

[0028] In some embodiments, the CDR-L1 comprises the amino acid sequence RSSQSLLHSNGNTFLH (SEQ ID NO: 6) and the CDR-L3 comprises the amino acid sequence SQTTHLPWT (SEQ ID NO: 8).

[0029] According to a further aspect of the invention, there is provided an anti-CCR9 antibody or antigen binding fragment thereof, wherein the anti-CCR9 antibody or antigen binding fragment thereof binds to a discontinuous epitope comprising amino acids at positions 11, 12, 13, 15 and 16 of the of the N-terminal extracellular domain of CCR9 isoform A (SEQ ID NO: 21). In some embodiments, the discontinuous epitope consists of amino acids at positions 11 , 12, 13, 15 and 16 of the N-terminal extracellular domain of CCR9 isoform A (SEQ ID NO: 21). The anti-CCR9 antibody or antigen fragment thereof may be as defined in accordance with the first aspect of the invention.

[0030] Also provided is an antibody drug conjugate (ADC) comprising the anti-CCR9 antibody or antigen binding fragment thereof of any of the above aspects conjugated to a drug, optionally a cytotoxic or chemotherapy drug.

[0031] In some embodiments the ADC comprises the formula A-L-C, wherein A comprises the anti-CCR9 antibody or antigen-binding fragment thereof, L comprises a linker and C comprises the drug.

[0032] C may comprise a topoisomerase I inhibitor or a tubulin inhibitor. In some embodiments, C comprises deruxtecan, monomethyl auristatin E, monomethyl auristatin F, SN38, exatecan, or analogs or derivatives thereof.

[0033] In some embodiments L comprises a protease cleavable linker. L may comprise a valine-citrulline unit or an mc-GGFG linker.

[0034] In some embodiments, L-D has the structure:

[0035] In some embodiments, L-D has the structure:

[0036] According to a further aspect, there is provided a polynucleotide comprising a nucleotide sequence encoding the anti-CCR9 antibody or antigen binding fragment thereof of any of the above aspects.

[0037] According to another aspect, there is provided a vector comprising the polynucleotide as described herein.

[0038] Also provided by the present invention is a cell comprising the anti-CCR9 antibody or antigen binding fragment thereof of the first aspect, the polynucleotide as described herein, or the vector as described herein.

[0039] According to a further aspect, there is provided a method of diagnosing a disease associated with elevated CCR9 expression in a subject, the method comprising: a) contacting the antibody or antigen binding fragment thereof of the first aspect with a sample comprising cells from the subject; b) detecting and / or quantifying CCR9 expression in the subject sample; c) comparing the level of CCR9 expression detected in the subject sample with the level of CCR9 expression detected in a control sample; d) correlating the comparison obtained in step c) with the presence of a disease associated with elevated CCR9 expression.

[0040] According to a further aspect, the present invention provides a pharmaceutical composition comprising the anti-CCR9 antibody or antigen binding fragment thereof of the first aspect, the ADC as described herein, the polynucleotide as described herein, the cell or the vector as described herein and a pharmaceutically or physiologically acceptable diluent and / or carrier.

[0041] There is also provided a kit comprising the anti-CCR9 antibody or antigen binding fragment thereof of the first aspect, the ADC as described herein, the polynucleotide as described herein, the vector as described herein, the cell as described herein or the pharmaceutical composition as described herein.

[0042] According to a further aspect of the invention, there is provided the anti-CCR9 antibody or antigen binding fragment thereof of the first aspect, the ADC, the polynucleotide as described herein, the vector as described herein, the cell or the pharmaceutical composition as described herein for use in the treatment or prevention of a disease. In some embodiments, the disease is an inflammatory disease.

[0043] In some embodiments, the disease comprises cancer, liver fibrosis, acute liver inflammation, inflammatory bowel disease (IBD), Crohn’s Disease, colitis, ulcerative colitis, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), psoriasis, Systemic Lupus Erythematosus (SLE), Systemic Sclerosis (SSc) or ankylosing spondylitis.

[0044] Preferably, the inflammatory disease is cancer or inflammatory bowel disease. In some embodiments the disease is inflammatory bowel disease. In some embodiments, the disease is selected from cancer, Crohn’s disease, colitis, ulcerative colitis, inflammatory bowel disease, liver fibrosis and acute liver inflammation. The disease may be cancer. In some embodiments, the cancer is selected from ovarian cancer, prostate cancer, breast cancer, melanoma, T-cell acute lymphoblastic leukaemia (T-ALL), pancreatic cancer, colorectal cancer, lung cancer, circulating cells from a solid tumour (CTCs), T-cell lineage lymphomas, acute myeloid leukaemia (AML) and lung cancer.

[0045] The invention includes the combination of the aspects and preferred features described except where such a combination is clearly impermissible or expressly avoided.

[0046] Summary of the Figures

[0047] Embodiments and experiments illustrating the principles of the invention will now be discussed with reference to the accompanying figures in which:

[0048] Figure 1. Alignment of the sequences of the variable domains of the anti-CCR9 antibodies.

[0049] Figure 2A-B. SDS-PAGE analysis of humanized anti-CCR9 antibodies. SDS-PAGE analysis of the different anti-CCR9 antibodies (hulAbOl , hulAbO2-VL1 , hulAbO2-VL2, huC9Mab-16-VL1 , huC9Mab-16- VL2, huC9Mab-19-VL1 , and huC9Mab-19-VL2) under reducing (A) and non-reducing (B) conditions (12% PAA; 6 pg for reducing and 4 pg for non-reducing conditions).

[0050] Figure 3A-C. Size-exclusion chromatography of humanized anti-CCR9 antibodies. Size-exclusion chromatography (SEC) of anti-CCR9 antibodies by HPLC using a TSKgelSuperSW mAb column.

[0051] Figure 4. Binding of humanized antibodies. Binding to the biotinylated peptide (TPTDFTSPIPNMADDYGSESTSS, SEQ ID NO: 22) from the N-terminal region of huCCR9 by ELISA. Mean ± SD; n=2.

[0052] Figure 5. Binding analysis of humanized anti-CCR9 antibodies using MOLT-4 cells. In this experiment, serial dilutions (1 :4 titration) of anti-CCR9 antibodies were incubated for 1 hour at 4°C with cells. Bound antibodies were detected with a PE-labelled anti-human Fc antibody. Mean ± SD; n=3.

[0053] Figure 6. Binding analysis of humanized anti-CCR9 antibodies using HEK293-CCR9 cells. In this experiment, serial dilutions (1 :4 titration) of anti-CCR9 antibodies were incubated for 1 hour at 4°C with cells. Bound antibodies were detected with a PE-labelled anti-human Fc antibody. Mean ± SD; n=3. Figure 7. Blocking analysis of CCL25-moFc and humanized anti-CCR9 antibodies. Detection of bound CCL25 to MOLT-4 cells alone and in the presence of CCR9 targeting antibodies. None of the candidates interfere with the binding of the ligand, suggesting different binding domains. In this experiment, 100 nM of humanized anti-CCR9 antibodies were incubated for 1 hour at 4°C with CCR9- expressing MOLT-4 cells. After three washing steps, 400 nM of CCL25 was added and incubated for 1 hour at 4°C. Bound ligand was detected with a FITC-labelled anti-moFc antibody. Mean ± SD; n=1.

[0054] Figure 8. Peptide inhibition assay using MOLT-4 cells. 1 pg / mL of antibodies was pre-incubated with 100 pg / mL of each peptide. After 1 hour at RT, the pre-incubation was transferred to MOLT-4 cells and incubated for 1 hour at 4 °C. Bound antibody was detected with a PE-labelled anti-human Fc antibody (Jackson ImmunoResearch 109-115-098; 1 :500) and cells were analysed using a Miltenyi MACS-Quant. Mean ± SD; n=1.

[0055] Figure 9A-B. Epitope mapping of C9Mab-16 and C9Mab-19. Binding analysis after 2 x Ala-scan method. The mutations showing reduced binding of the antibody candidates indicate a role of that residue on antibody binding. (A) C9Mab-16. (B) C9Mab-19.

[0056] Figure 10. Binding analysis of pHrodo-labeled anti-CCR9 antibodies using MOLT-4 cells. Flow cytometry analysis of pHrodo-labeled anti-CCR9 antibodies using CCR9-expressing MOLT-4 cells. In this experiment, serial dilutions (1 :4 titration) of anti-CCR9 antibodies were incubated for 1 hour at 4°C with cells. Bound antibodies were detected with a PE-labelled anti-human Fc antibody. Mean ± SD; n=1.

[0057] Figure 11A-B. Internalization of pHrodo-labeled anti-CCR9 antibodies using MOLT-4 cells. In this experiment 10 nM of pHrodo-labeled anti-CCR9 antibodies were incubated with cells for different incubation periods (5 minutes, 60 minutes, 4, hours, 6 hours, 8 hours, 16 hours, 24 hours, and 48 hours) at 37°C. Internalization was quantified as fluorescent signals were generated upon processing of the internalized antibody into the acidic endosome and lysosome pathway. CB6 is the receptor binding domain of the human anti-SARS-CoV-2 spike protein, employed as a control of unspecific internalization (A). Normalization of the internalization percentages of each molecule was performed to show the point at which their internalization is maximal (B). Mean ± SD; n=1.

[0058] Figure 12. Size-exclusion chromatography of humanized anti-CCR9 antibodies after 4 freeze-thaw- cycles. Anti-CCR9 antibodies were frozen at -80°C for up to one day and thawed on ice. The process was repeated for 3 times. After 4 days, the thawed antibodies were analysed using SEC-HPLC (TSKgelSuperSW mAb column).

[0059] Figure 13. Binding analysis of anti-CCR9 antibodies under thermal stress using MOLT-4 cells.

[0060] Flow cytometry analysis of anti-CCR9 antibodies at 4°C, 23°C, and 40°C using CCR9-expressing MOLT- 4 cells. Prior to flow cytometry analysis, the antibodies were incubated for 4 days at 4°C, 23°C, and 40°C. Then, serial dilutions (1 :10 titration) of anti-CCR9 antibodies were incubated for 1 hour at 4°C with cells. Bound antibodies were detected with a PE-labelled anti-human Fc antibody. The measurement of huC9Mab16-VL2, huC9Mab19-VL1 and huC9Mab19-VL2 was interrupted, so that the measurement was incomplete. Mean ± SD; n=1. Figure 14. Dynamic light scattering of humanized anti-CCR9 antibodies. Dynamic laser light scattering with ZetaSizer Nano ZS (Malvern) was measured while the temperature was increased in 1°C intervals from 35°C to 80°C with 2 minutes equilibration time for each temperature step. The aggregation point of the antibodies was defined as the temperature at which the mean count rate was increased. Mean ± SD; n=1

[0061] Figure 15. Binding analysis of anti-CCR9 antibodies under pH stress using MOLT-4 cells. Flow cytometry analysis of anti-CCR9 antibodies at pH 5 and pH 8.5 using CCR9-expressing MOLT-4 cells. Prior to flow cytometry analysis, the antibodies were respectively dialyzed overnight in 100 mM sodium acetate (with 150 mM NaCI) at pH 5 and in 100 mM Tris-HCI (with 150 mM NaCI) at pH 8.5. Next day, concentration of the antibodies was measured, and the antibodies were incubated for 7 days at 40°C. Then, serial dilutions (1 :10 titration) of anti-CCR9 antibodies were incubated for 1 hour at 4°C with cells. Bound antibodies were detected with a PE-labelled anti-human Fc antibody. Mean ± SD; n=1.

[0062] Figure 16. Binding analysis of anti-CCR9 antibodies, which were exposed to human serum using MOLT-4 cells. Flow cytometry analysis of anti-CCR9 antibodies, which were incubated for 0, 1 , 3, and 7 days to human serum using CCR9-expressing MOLT-4 cells. After the respective time of incubation, antibodies were stored at -20°C. In this experiment, serial dilutions (1 :10 titration) of anti-CCR9 antibodies were incubated for 1 hour at 4°C with cells. Bound antibodies were detected with a PE-labelled antihuman Fc antibody. Mean ± SD; n=1.

[0063] Figure 17A-B. ADCC analysis of anti-CCR9 antibodies using CFSE-stained MOLT-4 cells as well as two different PBMC batches. MOLT-4 cells were stained with CFSE, and then 2 x 104 cells were seeded overnight. The proportion of NK cells of two different PBMC batches were determined via flow cytometry analysis using anti-huCD3-PE and anti-huCD56-APC. PBMC batch HN#1 (A) displayed a proportion of NK cells of 12%, while PBMC batch HN#2 (B) exhibited 3.6%. CFSE-stained MOLT4 cells were pre-incubated with serial dilutions of the anti-CCR9 antibodies. Then, PBMCs were added on top to reach a concentration of 2 x 104 NK cells per well (equals target-to-effector ratio 1 :1 ). After incubating the plates for 24 hours, the cells were resuspended in PBA containing PI and the viability of the CFSE- labelled MOLT-4 cells was determined by flow cytometry. For representation of data as specific lysis, all values were normalized to the control wells containing CFSE-stained MOLT-4 and PBMCs. Mean ± SD; n=1.

[0064] Figure 18A-B. Pharmacokinetics of huC9Mab16-VL2, huC9Mab19-VL2 and SRB1. Serum concentrations of the antibodies were determined by ELISA after the intravenous injection of 1 mg / kg (A) or 10 mg / kg (B) of each antibody.

[0065] Figure 19. Flow cytometry analysis of global CCR9* T cell percentages in blood samples from IBD patients. Blood samples were treated in the presence of isotype (10 pg / mL) (control), SRB1 (10 pg / mL) or huC9Mab16-VL2 (10 pg / mL). N=4. Figure 20. Flow cytometry analysis of CCR9* T cell percentages in blood samples from IBD patients. Leukocyte cells isolated from the blood samples were treated in the presence of isotype (10 pg / mL) (control), SRB1 (10 pg / mL) or huC9Mab16-VL2 (10 pg / mL). N=4.

[0066] Figure 21. Flow cytometry analysis of global CCR9+T cell and CCR9* CD4+T cell percentages in intestinal explants from IBD patients. Explants were treated in the presence of isotype (10 pg / mL) (control), SRB1 (10 pg / mL) or huC9Mab16-VL2 (10 pg / mL). N=4.

[0067] Figure 22. Flow cytometry analysis of Effector CD4+CCR9+T cells (CD4 Eff) and Central Memory CD4+CCR9+T cells (CD4 CM) percentages and fluorescence intensity in blood samples from RA and PsA patients. (HC= Arthrosis Control, N= 6); (RA= Rheumatoid Arthritis, N=5); (PsA= Psoriatic Arthritis, N=6); (SLE= Systemic Lupus Erythematosus, N=3); (SSc= Systemic Sclerosis, N=4).

[0068] Figure 23. Flow cytometry analysis of Effector CD4+CCR9+T cells and Central Memory CD4+CCR9+T cells percentages and fluorescence intensity in synovial fluid samples and Peripheral Blood Mononuclear Cells (PBMC) from PsA patients. (HC= Arthrosis Control, N= 6); (RA= Rheumatoid Arthritis, N=5); (PsA= Psoriatic Arthritis, N=6).

[0069] Figure 24. Design of anti-CCR9-MMAE ADC. The anti-CCR9 antibody huC9Mab16-VL2 was conjugated to MMAE via a valine-citrulline linker with DAR 4.

[0070] Figure 25. Design of anti-CCR9-DxD ADC. The anti-CCR9 antibody huC9Mab16-VL2 was conjugated to DXd with DAR 8.

[0071] Figure 26. In vitro binding analysis of anti-CCR9 ADCs using MOLT-4 cells. Serial dilutions of anti- CCR9 ADCs and their parental antibodies were incubated with MOLT-4 cells. Bound antibodies were detected with a PE-labeled anti-human Fc antibody.

[0072] Figure 27. Cytotoxicity of anti-CCR9 ADCs using MOLT-4 cells by MTT. Serial dilutions of anti-CCR9 ADCs were incubated with MOLT-4 cells and cytotoxicity was determined.

[0073] Figure 28A-B. Cytotoxicity of SRB312, DXd, SRB3 and SRB3 + DXd (A) and SRB301, vc-MMAE, SRB3 and SRB3 + vc-MMAE (B) determined by MTT.

[0074] Figure 29A-B. Anti-CCR9 ADC in vivo efficacy in a patient derived xenograft model of ovarian cancer. (A) Average tumour volume from the start of treatment to day 55, expressed in mm3(mean ± SEM). 8 mice per group: control, SRB301, SRB312, carboplatin + paclitaxel. (B) Average body weight from the start of treatment to day 55 expressed in grams (mean ± SEM). 8 mice per group: control, SRB301 , SRB312, carboplatin + paclitaxel.

[0075] Figure 30. Individual tumour growth in the patient derived xenograft model of ovarian cancer of Figure 29. The tumour volumes of individual animals expressed in mm3are shown for each of the treatment groups: vehicle, carboplatin + paclitaxel, SRB301 and SRB312.

[0076] Figure 31. Binding analysis of anti-CCR9 Fab molecules using MOLT-4 cells. Serial dilutions of anti- CCR9 Fab molecules were incubated for 1 hour at 4°C with cells. Bound antibodies were detected with a PE-labeled anti-human Fc antibody. Figure 32. Comparison of VH and VL sequences from SRB10, SRB1, SRB3 and AB243LO0326 and AB102105 antibodies (from WO 2022 / 195028).

[0077] Detailed Description of the Invention

[0078] CCR9

[0079] Chemokines are a family of small, structurally related proteins that bind to seven transmembrane spanning G protein-coupled receptors. Chemokines and their receptors have an essential role in organogenesis and lymphocyte trafficking, in both homeostatic and inflammatory conditions. The antibody or antigen binding fragment thereof of the invention binds specifically to CCR9.

[0080] The amino acid sequence of human CCR9 (C-C chemokine receptor type 9) is disclosed at the UniProt accession number P51686 (see version 2 of 5 September 2006), the entire contents of which is incorporated herein by reference. Two alternatively spliced transcript variants have been described for the gene encoding CCR9, resulting in CCR9 isoform A and CCR9 isoform B, with UniProt accession numbers P51686-1 and P51686-2, respectively (see version 2 of 5 September 2006).

[0081] The term “CCR9” or “CCR9 chemokine receptor”, as used herein, refers to the chemokine (C-C motif) receptor 9. Other terms to designate CCR9 include GPR28; CDw199; GPR-9-6; CC-CKR-9. A specific ligand of CCR9 is CCL25. Typically, the chemokine receptor CCR9 is expressed on most small intestinal lamina propria and intraepithelial lymphocytes and on a small subset of peripheral blood lymphocytes. Generally, CCR9 is expressed on the majority of thymocytes, small intestinal lamina propria and intraepithelial lymphocytes, on a small subset of peripheral blood lymphocytes and in a subset of memory T cells cupz present in the circulation. It can also be expressed on IgA secreting B cells, macrophages and plasmacytoid dendritic cells.

[0082] CCR9 is organized into 15 domains, corresponding to an N-terminal extracellular domain (Nt), seven transmembrane domains, three intracellular domains, three extracellular domains and an intracellular C-terminal domain (Ct). In some embodiments, the epitope comprises amino acids at positions 11 , 12, 13, 15 and 16 of the N-terminal extracellular domain of CCR9 isoform A. SEQ ID NO: 21 represents amino acids at positions 2-22 of the N-terminal extracellular domain of CCR9 isoform A.

[0083] Anti-CCR9 antibody or antigen binding fragment thereof

[0084] According to a first aspect, there is provided an anti-CCR9 antibody or antigen binding fragment thereof, comprising a variable light chain comprising SEQ ID NO:1 or a variant thereof having at least 95% sequence identity to SEQ ID NO:1 , wherein the variable light chain comprises a CDR-L1 comprising the amino acid sequence RSSQSLXHSNGXTFLH (SEQ ID NO: 2), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHXPWT (SEQ ID NO: 4), wherein X can be any amino acid. In the context of the present invention, “anti-CCR9”, will be understood to mean that the antibody or antigen binding fragment thereof specifically binds to CCR9. Specifically binds in this context may be distinguished from non-specific binding by virtue of the degree of binding affinity and / or the selectivity of binding, wherein the binding affinity for CCR9 is greater than for other antigens. In the context of the present invention, a greater binding affinity may refer to a lower KD value.

[0085] The CDR sequences can be determined according to conventional criteria, for example by means of the criteria of IgBLAST: http: / / www.ncbi.nlm.nih.gov / igblast / (Ye et al., 2013, Nucleic Acids Res 41 (Web Server issue:W34-40), by following the numbering provided by Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, Md. (1991), as is used in the present application, and / or by following the numbering provided by Chothia et al. (1989, Nature 342:877-83).

[0086] The antibody or antigen binding fragment thereof may be selected from the group consisting of: Fv, Fab, F(ab')2, Fab', scFv, scFv-Fc, minibody, nanobody and diabody.

[0087] In some embodiments, the antigen binding fragment comprises an Fv, Fab, F(ab')2, Fab', scFv, scFv-Fc, minibody or nanobody.

[0088] In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof comprises an anti- CCR9 antibody.

[0089] The term “variant” as used herein, will be understood to refer to a sequence which does not have 100% sequence identity to its reference sequence, for example, SEQ ID NO:1 , but remains functionally active. For example, a variant of SEQ ID NO:1 of the invention will retain the functional activity of specifically binding to CCR9. The functional activity may be equivalent to the functional activity of the reference sequence, improved compared to the functional activity of the reference sequence or reduced compared to the functional activity of the reference sequence. In some embodiments, the variant has at least about 50% of the functional activity of the reference sequence. Optionally, the variant has at least about 60%, at least about 70%, at least about 80%, at least about 90% or at least about 95% of the functional activity of the reference sequence.

[0090] In the context of the present invention, a variant may comprise a sequence comprising one or more amino acid additions, substitutions or deletions relative to the reference sequence. For example, the variant may comprise a sequence comprising one or more substitutions relative to the reference sequence. In some embodiments, the variant comprises a sequence comprising at least two and optionally at least three amino acid substitutions relative to the reference sequence.

[0091] The variant may have a sequence identity of at least 96%, at least 97%, at least 98% or at least 99% to SEQ ID NO: 1. In some embodiments, the variant has a sequence identity of at least 98% to SEQ ID NO: 1.

[0092] In some embodiments, the variable light chain X amino acid is an aliphatic amino acid. As the skilled person will appreciate, aliphatic amino acids do not comprise cyclic structures with alternating double- bonds. Examples of aliphatic amino acids include, but are not necessarily limited to alanine, isoleucine, leucine, proline, valine and asparagine.

[0093] In some embodiments, the variable light chain X amino acid is an aliphatic non-polar amino acid or asparagine. In some embodiments, X is selected from the group consisting of valine, leucine, isoleucine and asparagine. In some embodiments, X is selected from the group consisting of valine, leucine and isoleucine.

[0094] In some embodiments, the CDR-L1 comprises or consists of the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5) or the amino acid sequence RSSQSLLHSNGNTFLH (SEQ ID NO: 6). In some embodiments, the CDR-L1 comprises or consists of the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5). Alternatively, the CDR-L1 may comprise or consist of the amino acid sequence RSSQSLLHSNGNTFLH (SEQ ID NO: 6).

[0095] In some embodiments, the CDR-L3 comprises or consists of the amino acid sequence SQTTHVPWT (SEQ ID NO: 7) or the amino acid sequence SQTTHLPWT (SEQ ID NO: 8). The CDR-L3 may comprise or consist of the amino acid sequence SQTTHVPWT (SEQ ID NO: 7). In some embodiments, the CDR- L3 may comprise or consist of the amino acid sequence SQTTHLPWT (SEQ ID NO: 8).

[0096] In some embodiments, the CDR-L1 comprises or consists of the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5), the CDR-L2 comprises or consists of the amino acid sequence KVSNRFS (SEQ ID NO: 3) and the CDR-L3 comprises or consists of the amino acid sequence SQTTHVPWT (SEQ ID NO: 7).

[0097] In some embodiments, the CDR-L1 comprises or consists of the amino acid sequence RSSQSLLHSNGNTFLH (SEQ ID NO: 6), the CDR-L2 comprises or consists of the amino acid sequence KVSNRFS (SEQ ID NO: 3) and the CDR-L3 comprises or consists of the amino acid sequence SQTTHLPWT (SEQ ID NO: 8).

[0098] The antibody or antigen binding fragment thereof may comprise a CDR-H1 comprising the amino acid sequence GFTFSXYWMX (SEQ ID NO: 9), a CDR-H2 comprising the amino acid sequence EIRSKSXNYATHYXESXXG (SEQ ID NO: 10) and a CDR-H3 comprising the amino acid sequence XYSPY (SEQ ID NO: 11), wherein X can be any amino acid.

[0099] In some embodiments, the variable heavy chain X amino acid is selected from the group consisting of asparagine, aspartic acid, lysine, glutamic acid, valine, arginine, alanine, methionine, phenylalanine and tyrosine.

[0100] In some embodiments, the CDR-H1 comprises or consists of the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12) or the amino acid sequence GFTFSNYWMD (SEQ ID NO: 13). In some embodiments, the CDR-H1 comprises or consists of the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12). In other embodiments, the CDR-H1 comprises or consists of the amino acid sequence GFTFSNYWMD (SEQ ID NO: 13). In some embodiments, the CDR-H2 comprises or consists of the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14) or the amino acid sequence EIRSKSNNYATHYAESMKG (SEQ ID NO: 15). In some embodiments, the CDR-H2 comprises or consists of the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14). In other embodiments, the CDR-H2 comprises or consists of the amino acid sequence EIRSKSNNYATHYAESMKG (SEQ ID NO: 15).

[0101] The CDR-H3 may comprise or consist of the amino acid sequence FYSPY (SEQ ID NO: 16) or the amino acid sequence YYSPY (SEQ ID NO: 17). In some embodiments, the CDR-H3 comprises or consists of the amino acid sequence FYSPY (SEQ ID NO: 16). In some embodiments, the CDR-H3 comprises or consists of the amino acid sequence YYSPY (SEQ ID NO: 17).

[0102] In some embodiments, the CDR-H3 comprises the amino acid sequence XFXYSPY (SEQ ID NO: 82). For example, the CDR-H3 may comprise the amino acid sequence MFXYSPY (SEQ ID NO: 83) or AFXYSPY (SEQ ID NO: 84). In some embodiments, the CDR-H3 comprises the amino acid sequence MFFYSPY (SEQ ID NO: 85). In some embodiments, the CDR-H3 comprises the amino acid sequence AFYYSPY (SEQ ID NO: 86).

[0103] The antibody or antigen binding fragment thereof may comprise a variable heavy chain comprising a CDR-H1 , CDR-H2 and CDR-H3 as defined above.

[0104] The antibody or antigen binding fragment thereof may comprise a variable heavy chain comprising a CDR-H1 comprising the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12), a CDR-H2 comprising the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14) and a CDR-H3 comprising the amino acid sequence FYSPY (SEQ ID NO: 16).

[0105] Alternatively, the antibody or antigen binding fragment thereof may comprise a variable heavy chain comprising a CDR-H1 comprising the amino acid sequence GFTFSNYWMD (SEQ ID NO: 13), a CDR-H2 comprising the amino acid sequence EIRSKSNNYATHYAESMKG (SEQ ID NO: 15) and a CDR-H3 comprising the amino acid sequence YYSPY (SEQ ID NO: 17).

[0106] In some embodiments, the antibody or antigen binding fragment thereof comprises a variable heavy chain comprising SEQ ID NO: 18 or a variant thereof having at least 95% sequence identity to SEQ ID NO: 18. The variant may have a sequence identity of at least 96%, at least 97%, at least 98% or at least 99% to SEQ ID NO: 18. In some embodiments, the variant has a sequence identity of at least 97% to SEQ ID NO: 18.

[0107] In some embodiments, the antibody or antigen binding fragment thereof comprises a variable heavy chain comprising SEQ ID NO: 18 or a variant thereof having at least 95% sequence identity to SEQ ID NO: 18, wherein the heavy chain comprises a CDR-H1 comprising the amino acid sequence GFTFSXYWMX (SEQ ID NO: 9), a CDR-H2 comprising the amino acid sequence EIRSKSXNYATHYXESXXG (SEQ ID NO: 10) and a CDR-H3 comprising the amino acid sequence XYSPY (SEQ ID NO: 11), wherein X can be any amino acid.

[0108] In some embodiments, the antibody or antigen binding fragment thereof comprises a variable heavy chain comprising or consisting of SEQ ID NO: 18 or SEQ ID NO: 19. In some embodiments, the antibody or antigen binding fragment thereof comprises a variable heavy chain comprising or consisting of SEQ ID NO: 18. In some embodiments, the antibody or antigen binding fragment thereof comprises a variable heavy chain comprising or consisting of SEQ ID NO: 19.

[0109] In some embodiments, the variable light chain comprises or consists of SEQ ID NO: 1 or SEQ ID NO: 20. The variable light chain may comprise or consist of SEQ ID NO: 1 . In other embodiments, the variable chain comprises or consists of SEQ ID NO: 20.

[0110] In some embodiments, the antibody or antigen binding fragment thereof comprises: a. A variable light chain comprising SEQ ID NO:1 , wherein the variable light chain comprises a CDR-L1 comprising the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3), a CDR-L3 comprising the amino acid sequence SQTTHVPWT (SEQ ID NO: 7); and b. A variable heavy chain comprising a CDR-H1 comprising the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12), a CDR-H2 comprising the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14) and a CDR-H3 comprising the amino acid sequence FYSPY (SEQ ID NO: 16).

[0111] In some embodiments, the antibody or antigen binding fragment thereof comprises: a. A variable light chain comprising SEQ ID NO: 20, wherein the variable light chain comprises a CDR-L1 comprises amino acid sequence RSSQSLLHSNGNTFLH (SEQ ID NO: 6), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3), a CDR-L3 comprising the amino acid sequence SQTTHLPWT (SEQ ID NO: 8); and b. A variable heavy chain comprising a CDR-H1 comprising the amino acid sequence GFTFSNYWMD (SEQ ID NO: 13), a CDR-H2 comprising the amino acid sequence EIRSKSNNYATHYAESMKG (SEQ ID NO: 15) and a CDR-H3 comprising the amino acid sequence YYSPY (SEQ ID NO: 17).

[0112] In some embodiments, the antibody or antigen binding fragment thereof comprises: a) a variable light chain comprising or consisting of SEQ ID NO: 1 and a variable heavy chain comprising or consisting of SEQ ID NO: 18; or b) a variable light chain comprising or consisting of SEQ ID NO: 20 and a variable heavy chain comprising or consisting of SEQ ID NO: 19.

[0113] In some embodiments, the antibody or antigen binding fragment thereof comprises a variable light chain comprising or consisting of SEQ ID NO: 1 and a variable heavy chain comprising or consisting of SEQ ID NO: 18.

[0114] In some embodiments, the antibody or antigen binding fragment thereof comprises a variable light chain comprising or consisting of SEQ ID NO: 20 and a variable heavy chain comprising or consisting of SEQ ID NO: 19. The antibody or antigen binding fragment thereof may bind to an epitope comprising amino acids at positions 11 , 12, 13, 15 and 16 of the N-terminal extracellular domain of CCR9 isoform A. The epitope may be a discontinuous epitope comprising amino acids at positions 11 , 12, 13, 15 and 16 of the N- terminal extracellular domain of CCR9 isoform A. Positions 11 , 12, 13, 15 and 16 of the N-terminal extracellular domain of CCR9 isoform A may otherwise be referred to as P11 , N12, M13, D15 and D16.

[0115] In some embodiments, the epitope comprises amino acids at positions 10, 11 , 12, 13, 15 and 16 of the N- terminal extracellular domain of CCR9 isoform A. The epitope may be a discontinuous epitope comprising amino acids at positions 10, 11 , 12, 13, 15 and 16 of the N-terminal extracellular domain of CCR9 isoform A. Position 10 may otherwise be referred to as 110.

[0116] In some embodiments, the epitope comprises amino acids at positions 10, 11 , 12, 13, 15, 16 and 17 of the N-terminal extracellular domain of CCR9 isoform A. The epitope may be a discontinuous epitope comprising amino acids at positions 10, 11 , 12, 13, 15, 16 and 17 of the N-terminal extracellular domain of CCR9 isoform A. Position 17 otherwise be referred to as Y17.

[0117] In some embodiments, the epitope does not comprise position 14, which may otherwise be referred to as A14, of the N-terminal extracellular domain of CCR9 isoform A.

[0118] Various methods for epitope mapping are available and known to those skilled in the art. In particular, the epitope may be as determined by a peptide scan. In certain cases, the epitope may be as determined by alanine scanning mutagenesis.

[0119] In some embodiments, the antibody of the invention is bispecific or multispecific. Preferably, the antibody of the invention is a monoclonal antibody.

[0120] In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof is humanised. The term “humanised”, as used herein, will be understood to refer to derivation from a non-human antibody or antigen binding fragment thereof, typically a murine antibody, that retains the antigen-binding properties of the parent antibody or antigen binding fragment thereof, but which is less immunogenic in humans. This may be achieved by various methods, including (a) grafting the entire non-human variable domains onto human constant regions to generate chimeric antibodies; (b) grafting only the non-human complementarity determining regions (CDRs) into human framework and constant regions with or without retention of critical framework residues; or (c) transplanting the entire non-human variable domains, but “cloaking” them with a human-like section by replacement of surface residues.

[0121] Methods for humanizing non-human antibodies have been described in the art. A humanised antibody may have one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain.

[0122] Various humanisation methods are available to the skilled person. For example, the skilled person can compare the VH and VL sequences of the murine antibodies to the human germline V segment repertoire, e.g. using the tool Igblast. V segments with high homology can then be identified, and a comparison of humanness scores defined by Andrew Martin (Abhinandan, K. R. and Martin, Andrew C. R. (2007) Analyzing the 'degree of humanness' of antibody sequences, J. Mol. Biol, 369, 852-862.) included to identify segments with a high H or Z-score.

[0123] The antibody of the invention can be of any isotype. For example, the isotype may be IgM, IgD, IgG, IgE, and IgA. Preferably, the anti-CCR9 antibody or antigen binding fragment thereof comprises an IgG anti- CCR9 antibody. In some embodiments, the antibody comprises an IgG 1 , lgG2, lgG3 or lgG4 anti-CCR9 antibody. For example, the antibody may comprise an lgG1 anti-CCR9 antibody.

[0124] In some embodiments, the antibody is the antibody described herein as SRB3 (which may alternatively be referred to as huC9Mab16-VL2).

[0125] In some embodiments, the antibody or antigen binding fragment exhibits a binding affinity dissociation constant KD for human CCR9 of about 1 x 10-6M or less.

[0126] In some embodiments, the antibody or antigen binding fragment exhibits a binding affinity dissociation constant KD for human CCR9 of about 1 x 10-7M or less.

[0127] In some embodiments, the antibody or antigen binding fragment thereof exhibits a binding affinity dissociation constant KD for human CCR9 of from about 1 x 10-6M to about 1 x 10-12M. In some embodiments, the antibody or antigen binding fragment thereof exhibits a binding affinity dissociation constant KD for human CCR9 of from about 1 x 10-7M to about 1 x 10-12M. In some embodiments, the antibody or antigen binding fragment thereof exhibits a binding affinity dissociation constant KD for human CCR9 of from about 1 x 10-8M to about 1 x 10-10M. For example, the antibody or antigen binding fragment thereof may exhibit a binding affinity dissociation constant KD for human CCR9 of from about 1 x 10-9M to about 9 x 10-9M. The antibody or antigen binding fragment thereof may exhibit a binding affinity dissociation constant KD for human CCR9 of from about 1 x 10-9M to about 5 x 10-9M. The KD value may be determined by any appropriate method. In particular, the KD value may be as determined by Surface Plasmon Resonance (SPR) (e.g., BIACORE). In certain cases, the binding affinity constant KD may be as determined by, or inferred from, whole cell-based antibody binding determination.

[0128] The antibody or antigen binding fragment thereof may have an ECso of less than 15nM, preferably less than 5nM. In the context of the present invention, “ECso” will be understood to refer to the concentration of antibody that gives half-maximal binding in vitro. Therefore, a lower ECso can be indicative of a greater binding affinity. ECso can be calculated by determining the concentration of bound antibody in an antibody dilution series to the target antigen. Alternatively, ECso can be calculated by determining the binding of the antibody to an immobilised target antigen in the presence of a series of soluble target antigen in a competitive ELISA format.

[0129] The present inventors have found that antibodies of the present invention advantageously exhibit decreased ECso compared to other anti-CCR9 antibodies, such as SRB1 , in an ELISA format when testing binding against an immobilised human CCR9 extracellular N-terminal region peptide (SEQ ID NO: 21 ). SRB1 comprises a CDR-L1 comprising the amino acid sequence RSSQSLVHSNGNTYLN (SEQ ID NO: 37), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQSTHFPRT (SEQ ID NO: 38). SRB1 is the humanised version of the antibody 92R, which is disclosed in WO 2015 / 075269.

[0130] In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof has an ECso of less than 1nM. In some embodiments, the antibody or antigen binding fragment thereof has an ECso of from about 0.5nM to about 15nM. In some embodiments, the antibody or antigen binding fragment thereof has an ECso of from about 0.5nM to about 5nM. In some embodiments, the antibody or antigen binding fragment thereof has an EC50 of less than 0.6nM.

[0131] The present inventors have also advantageously found that the antibodies or antigen binding fragments thereof of the present invention retain binding capacity to human CCR9 after exposure to high temperatures (e.g. a temperature of 23°C or a temperature of 40°C). Thus, in some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 at 23°C at at least about 80% of the level of binding which is exhibited by the antibody or antigen binding fragment at 4°C. In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 at 40°C at at least about 80% of the level of binding which is exhibited by the antibody or antigen binding fragment at 4°C. In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 at 23°C at at least about 90%, optionally at least about 95%, of the level of binding which is exhibited by the antibody or antigen binding fragment at 4°C. In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 at 40°C at at least about 90%, optionally at least about 95% of the level of binding which is exhibited by the antibody or antigen binding fragment at 4°C.

[0132] In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 after incubation at 23°C for at least 24 hours at at least about 80% of the level of binding which is exhibited by the antibody or antigen binding fragment at 4°C. In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 after incubation at 40°C for at least 24 hours at at least about 80% of the level of binding which is exhibited by the antibody or antigen binding fragment at 4°C. In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 after incubation at 23°C for at least 24 hours at at least about 90%, optionally at least about 95%, of the level of binding which is exhibited by the antibody or antigen binding fragment at 4°C. In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 after incubation at 40°C for at least 24 hours at at least about 90%, optionally at least about 95% of the level of binding which is exhibited by the antibody or antigen binding fragment at 4°C.

[0133] Measurement of the effect of temperature on the stability and subsequent level of binding of the antibody or antigen binding fragment thereof to human CCR9 can be achieved by in vitro incubation of the antibody or antigen binding fragment thereof at a temperature of about 23°C or about 40°C for at least 24 hours, optionally at least 48 or 72 hours, further optionally for about 96 hours. As a control, the antibody or antigen binding fragment thereof can be incubated in vitro at 4°C for the same period of time (e.g. at least 24 hours, optionally about 96 hours). After incubation, serial dilutions of the incubated antibodies can be incubated with CCR9-expressing cells (e.g. MOLT-4 cells) or CCR9 peptide for 1 hour at 4°C and bound antibodies detected, for example by flow cytometry or fluorescence imaging.

[0134] Advantageously, the present inventors have also found that antibodies of the present invention exhibit binding stability at low and high pH (pH 5 and pH 8.5, respectively), relative to a neutral pH. This is improved relative to other anti-CCR9 antibodies such as SRB1. By “neutral pH”, this will be understood to refer to the pH of culture media or buffer such as PBS. A neutral pH will be considered to be a pH of from about 7 to about 7.6. Preferably, a neutral pH is about 7.4. Thus, in some embodiments, the antibody or antigen binding fragment thereof binds to human CCR9 at about pH 5 at at least about 80% of the level of binding which is exhibited by the antibody or antigen binding fragment at a neutral pH. In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 at about pH 8.5 at at least about 80% of the level of binding which is exhibited by the antibody or antigen binding fragment at a neutral pH. In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 at about pH 5 at at least about 90%, optionally at least about 95%, of the level of binding which is exhibited by the antibody or antigen binding fragment at a neutral pH. In some embodiments, the anti-CCR9 antibody or antigen binding fragment thereof binds to human CCR9 at about pH 8.5 at at least about 90%, optionally at least about 95% of the level of binding which is exhibited by the antibody or antigen binding fragment at a neutral pH.

[0135] The pH stability of the antibodies of the invention can be measured by various methods in the art. An exemplary method may comprise flow cytometric analysis of antibody binding after the antibody has been incubated at about pH 5 or about pH 8.5 with CCR9 expressing cells, for example MOLT-4 cells. Incubation of the antibody at about pH 5 or about pH 8.5 may occur overnight, for example for at least eight hours. Incubation at about pH 5 may be achieved by dialysis in 100 mM sodium acetate (with 150 mM NaCI), while incubation at about pH 8.5 may be achieved by dialysis in in 100 mM Tris-HCI (with 150 mM NaCI).

[0136] The present inventors have advantageously found that certain anti-CCR9 antibodies exhibit CCR9 binding that is essentially unaffected by the presence of the ligand CCL25. This contrasts with an anti- CCR9 antibody such as “3C3” disclosed in WOOO / 53635 which displays significant sensitivity to the presence of CCL25. Indeed, at physiologically relevant concentrations of CCL25 the binding of the antibody “3C3” to CCR9 is effectively abolished. In some embodiments the antibody or antigen-binding fragment thereof exhibits CCR9 specific binding in the presence of 400nm concentration of human CCL25, as measured by flow cytometry.

[0137] The present inventors have also observed that certain anti-CCR9 antibodies are internalised intracellularly upon binding to a CCR9-expressing cell. Thus, the antibody or antigen-binding fragment thereof may be internalized by CCR9-expressing cells. As the skilled person will appreciate, various methods of measuring antibody internalization are known and available to those skilled in the art. For example, the present inventors used pHrodo labelling of the antibodies to monitor internalization. pHrodo dyes are non-fluorescent at a neutral pH and become fluorescent in the intracellular acidic environment. Fluorescence can then be measured, for example, by flow cytometry. In some embodiments, the melting point of the antibody or antigen-binding fragment thereof is of from about 60°C to about 70°C. The melting point of the antibody or antigen-binding fragment thereof may be of from about 60° to about 67°C. In some embodiments the melting point of the antibody or antigenbinding fragment thereof may be of from about 61 °C to about 67°C. The melting point may otherwise be referred to herein as the aggregation point and can be measured using dynamic light scattering (DLS).

[0138] The present inventors have observed that certain anti-CCR9 antibodies exhibit binding stability after in vitro incubation in 50% human plasma for at least about 24 hours. Therefore, in some embodiments, the antibody or antigen-binding fragment thereof binds to human CCR9 after incubation in 50% human plasma at at least about 50% of the level of binding exhibited by the antibody or antigen binding fragment without incubation in 50% human plasma. Incubation in 50% human plasma may be for at least about 24 hours, at least about 72 hours or at least about 168 hours. In some embodiments, the antibody or antigen-binding fragment thereof binds to human CC49 after incubation in 50% human plasma at at least about 80% of the level of binding exhibited by the antibody or antigen binding fragment without incubation in 50% human plasma.

[0139] In some embodiments the antibody or antigen-binding fragment thereof exhibits CCR9+lymphocyte depletion. The present inventors have, for example, observed antibody-dependent cellular cytotoxicity (ADCC) utilizing antibodies of the invention.

[0140] In some embodiments the antibody or antigen-binding fragment thereof has a terminal half life (T1 / 2 beta) (hours) of from about 50 to about 400. In some embodiments the antibody or antigen-binding fragment thereof has a T1 / 2 beta (hours) of from about 90 to about 400. In some embodiments the antibody or antigen-binding fragment thereof has a T1 / 2 beta (hours) of from about 100 to about 300. The antibody or antigen-binding fragment thereof may have a T1 / 2 beta (hours) of from about 90 to about 200. The antibody or antigen-binding fragment thereof may have a T1 / 2 beta (hours) of from about 90 to about 150, optionally of from about 90 to about 120. As the skilled person will appreciate, T1 / 2 beta (hours) refers to the time required for plasma concentration of a drug to decrease by 50%. Various methods are known in the art to calculate T1 / 2 beta (hours). Advantageously, the present inventors have found that antibodies of the present invention have an increased terminal half-life compared to other anti-CCR9 antibodies such as SRB1.

[0141] Fc region

[0142] In some embodiments, the antibody or antigen-binding fragment thereof in the conjugate of the present invention comprises an Fc domain (Fc region). In some embodiments, the Fc region is derived from human origin and preferably all other parts of the human constant region. As used herein, the term "human-derived Fc region" means an Fc region that is an Fc region of a human antibody of the IgGI, lgG2, lgG3 or lgG4 subclass, preferably an Fc domain from the human IgGI subclass.

[0143] In this application, "Fc region" is used to define the C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region, which includes native sequence Fc regions and variant Fc regions. In some embodiments, an Fc region is composed of CH2 and CH3 regions from one polypeptide, and CH2 and CH3 regions from another polypeptide. The CH2 and CH3 regions from the two polypeptides together form the Fc region. In some embodiments, the human IgG heavy chain Fc region extends from Cys226 or from Pro230 to the carboxy terminus of the heavy chain. However, antibodies produced by the host cell may undergo post-translational cleavage of one or more (especially one or two) amino acids from the C-terminus of the heavy chain. Thus, an antibody produced by a host cell by expression of a specific nucleic acid molecule encoding a full-length heavy chain may comprise a full-length heavy chain, or the antibody may comprise a cleaved variant of a full-length heavy chain. This may be the case when the last two C-terminal amino acids of the heavy chain are glycine (G446) and lysine (K447, numbered according to the Kabat EU index). Therefore, the C-terminal lysine (Lys447) or the C-terminal glycine (Gly446) and lysine (Lys447) of the Fc region may or may not be present. In some embodiments, a heavy chain including an Fc region (subunit) as specified herein is comprised in an antibody according to the present application.

[0144] Unless otherwise indicated herein, the numbering of amino acid residues in the Fc region or constant region is numbered according to the EU numbering system (also known as the EU index), as in Kabat et al., 1991 . As used herein, a "subunit" of an Fc domain refers to one of the two polypeptides that form the dimeric Fc domain, namely the polypeptide comprising the C-terminal constant region of the immunoglobulin heavy chain that is capable of stabilizing self-association. For example, subunits of the IgG Fc domain include the lgGCH2 constant domain and the IgG CH3 constant domain.

[0145] In some embodiments, the antibody or antigen-binding fragment thereof according to the present invention comprises an Fc region comprising modification in one or more of the CH2 and CH3 regions promoting association of the Fc region. Recombinant co-expression of constituent polypeptides of an antibody or antigen-binding fragment thereof and subsequent association leads to several possible combinations. To improve the yield of the desired combinations of polypeptides in antibody or antigenbinding fragment thereof in recombinant production, it is advantageous to introduce in the Fc regions modification(s) promoting association of the desired combination of heavy chain polypeptides. Modifications may promote e.g. hydrophobic and / or electrostatic interaction between CH2 and / or CH3 regions of different polypeptide chains. Suitable modifications are described e.g. in Ha et al., 2016, which is hereby incorporated by reference in its entirety.

[0146] In some embodiments the antibody or antigen-binding fragment thereof of the present invention comprises an Fc region comprising paired substitutions in the CH3 regions of the Fc region according to one of the following formats, as shown in Table 1 of Ha et al., 2016: KiH, KiHs-s, HA-TF, ZW1 , 7.8.60, DD- KK, EW-RVT, EW-RVTs-s, SEED or A107.

[0147] In some embodiments, the Fc region comprises the “knob-into-hole” or “KiH” modification, e.g. as described e.g. in US 7,695,936 and Carter, 2001. In such embodiments, one of the CH3 regions of the Fc region comprises a “knob” modification, and the other CH3 region comprises a “hole” modification. The “knob” and “hole” modifications are positioned within the respective CH3 regions so that the “knob” can be positioned in the “hole” in order to promote heterodimerisation (and inhibit homodimerisation) of the polypeptides and / or stabilise heterodimers. Knobs are constructed by substituting amino acids having small chains with those having larger side chains (e.g. tyrosine or tryptophan). Holes are created by substituting amino acids having large side chains with those having smaller side chains (e.g. alanine or threonine).

[0148] In some embodiments, one of the CH3 regions of the Fc region of the antibody or antigen-binding fragment thereof of the present invention comprises the substitution (numbering of positions / substitutions in the Fc, CH2 and CH3 regions herein is according to the EU numbering system as described in Kabat et al., 1991) T366W, and the other CH3 region of the Fc region comprises the substitution Y407V. In some embodiments, one of the CH3 regions of the Fc region of the antibody or antigen-binding fragment thereof comprises the substitution T366W, and the other CH3 region of the Fc region comprises the substitutions T366S and L368A. In some embodiments, one of the CH3 regions of the Fc region of the antibody or antigen-binding fragment thereof comprises the substitution T366W, and the other CH3 region of the Fc region comprises the substitutions Y407V, T366S and L368A.

[0149] In some embodiments, the Fc region comprises the “DD-KK” modification as described e.g. in WO 2014 / 131694 A1. In some embodiments, one of the CH3 regions comprises the substitutions K392D and K409D, and the other CH3 region of the Fc region comprises the substitutions E356K and D399K. The modifications promote electrostatic interaction between the CH3 regions.

[0150] In some embodiments, the antibody or antigen-binding fragment thereof of the present invention comprises an Fc region modified as described in Labrijn et al., 2013, referred to as ‘Duobody’ format. In some embodiments one of the CH3 regions comprises the substitution K409R, and the other CH3 region of the Fc region comprises the substitution K405L.

[0151] In some embodiments, the antibody or antigen-binding fragment thereof of the present invention comprises an Fc region comprising the “EEE-RRR” modification as described in Strop et al., 2012. In some embodiments one of the CH3 regions comprises the substitutions D221 E, P228E and L368E, and the other CH3 region of the Fc region comprises the substitutions D221R, P228R and K409R.

[0152] In some embodiments, the antibody or antigen-binding fragment thereof comprises an Fc region comprising the “EW-RVT” modification described in Choi et al., 2013. In some embodiments one of the CH3 regions comprises the substitutions K360E and K409W, and the other CH3 region of the Fc region comprises the substitutions Q347R, D399V and F405T.

[0153] In some embodiments, one of the CH3 regions comprises the substitution S354C, and the other CH3 region of the Fc region comprises the substitution Y349C. Introduction of these cysteine residues results in formation of a disulphide bridge between the two CH3 regions of the Fc region, further stabilizing the heterodimer (Carter, 2001). In some embodiments, the Fc region comprises the “KiHs-s” modification. In some embodiments one of the CH3 regions comprises the substitutions T366W and S354C, and the other CH3 region of the Fc region comprises the substitutions T366S, L368A, Y407V and Y349C.

[0154] In some embodiments, the antibody or antigen-binding fragment thereof of the present invention comprises an Fc region comprising the “SEED” modification as described in Davis et al., 2010, in which p-strand segments of human IgG 1 CH3 and IgA CH3 are exchanged.

[0155] In some embodiments, one of the CH3 regions comprises the substitutions S364H and F405A, and the other CH3 region of the Fc region comprises the substitutions Y349T and T394F (see e.g. Moore et al., 2011.

[0156] In some embodiments, one of the CH3 regions comprises the substitutions T350V, L351Y, F405A and Y407V, and the other CH3 region of the Fc region comprises the substitutions T350V, T366L, K392L and T394W (see e.g. Von Kreudenstein et al., MAbs (2013) 5(5):646-54).

[0157] In some embodiments, one of the CH3 regions comprises the substitutions K360D, D399M and Y407A, and the other CH3 region of the Fc region comprises the substitutions E345R, Q347R, T366V and K409V (see e.g. Leaver-Fay et al., 2016).

[0158] In some embodiments, one of the CH3 regions comprises the substitutions K370E and K409W, and the other CH3 region of the Fc region comprises the substitutions E357N, D399V and F405T (see e.g. Choi et al., PLoS One (2015) 10(12):e0145349).

[0159] In some embodiments, the antibody or antigen-binding fragment thereof of the present disclosure comprises an Fc region with reduced effector function. That is, the Fc region may be ‘silenced’ or comprise ‘silencing mutations’.

[0160] In some embodiments, the antibody or antigen-binding fragment thereof of the present disclosure comprises an Fc region which does not bind to an Fc y receptor. In some embodiments, the antibody or antigen-binding fragment thereof comprises an Fc region which does not bind to one or more of FcyRI, FcyRlla, FcyRllb, FcyRllc, FcyRllla and FcyRlllb. In some embodiments, the antibody or antigen-binding fragment thereof comprises an Fc region which does not bind to one or both of FcyRI and FcyRllla.

[0161] The ability of an Fc region, or an antibody or antigen-binding fragment thereof comprising an Fc region, to bind to a reference protein (e.g. an Fc receptor) can be analysed according to methods well known in the art, such as ELISA, immunoblot, immunoprecipitation, Surface Plasmon Resonance (SPR; see e.g.

[0162] Hearty et al., 2012) or Bio-Layer Interferometry (BLI; see e.g. Lad et al., 2015).

[0163] As used herein, an Fc region “which does not bind to” a reference protein may display substantially no binding to the reference protein, e.g. as determined by ELISA, immunoblot (e.g. western blot), immunoprecipitation, SPR or BLI). “Substantially no binding” may be a level of interaction that is not significantly greater than the level of interaction determined for proteins that do not bind to one another in a given assay. “Substantially no binding” may be a level of interaction which is < 5 times, e.g. < 4 times, < 3 times, < 2.5 times, < 2 times or < 1.5 times the level of interaction determined for proteins that do not bind to one another, in a given assay.

[0164] In some embodiments, the antibody or antigen-binding fragment thereof comprises an Fc region which binds to FcRn.

[0165] In some embodiments, the antibody or antigen-binding fragment thereof comprises an Fc region which binds to FcRn, and which does not bind to one or more of FcyRI, FcyRlla, FcyRllb, FcyRllc, FcyRllla and FcyRlllb. In some embodiments, the antibody or antigen-binding fragment thereof comprises an Fc region which binds to FcRn, and which does not bind to one or both of FcyRI and FcyRllla.

[0166] In some embodiments, the antibody or antigen-binding fragment thereof of the present disclosure comprises an Fc region which does not induce ADCC. In some embodiments, the antibody or antigenbinding fragment thereof of the present disclosure comprises an Fc region which does not induce ADCP. In some embodiments, the antibody or antigen-binding fragment thereof of the present disclosure comprises an Fc region which does not induce CDC. In some embodiments, the antibody or antigenbinding fragment thereof of the present disclosure comprises an Fc region which does not induce ADCC, ADCP or CDC.

[0167] As used herein, an Fc region / antibody or antigen-binding fragment thereof which does not induce ( / .e. is not able to induce) ADCC / ADCP / CDC elicits substantially no ADCC / ADCP / CDC activity, e.g. as determined by analysis in an appropriate assay for the relevant activity. “Substantially no ADCC / ADCP / CDC activity” refers to a level of ADCC / ADCP / CDC that is not significantly greater than ADCC / ADCP / CDC determined for an appropriate negative control molecule in a given assay (e.g. an antibody or antigen-binding fragment thereof lacking an Fc region, or an antibody or antigen-binding fragment thereof comprising a ‘silent’ Fc region (e.g. as described in Hale et al. 2024, which is incorporated by reference)). “Substantially no activity” may be a level of the relevant activity which is < 5 times, e.g. < 4 times, < 3 times, < 2.5 times, < 2 times or < 1.5 times the level of activity determined for an appropriate negative control molecule in a given assay.

[0168] In other embodiments, the antibody or antigen-binding fragment thereof according to the present invention comprises an Fc region which induces (i.e. increases) ADCC. In some embodiments, the antibody or antigen-binding fragment according to the present invention comprises a mutation in the Fc region which induces (i.e. increases) ADCC. In some embodiments, the antibody or antigen-binding fragment according to the present invention comprises mutations in the Fc region as disclosed in Lazar et al., 2006, which is hereby incorporated by reference. In some embodiments, the antibody or antigenbinding fragment according to the present invention comprises the double mutation S239D / I332E in the Fc region (EU numbering according to Kabat et al., 1991). As used herein, an antibody or antibody-binding fragment thereof which induces ADCC elicits ADCC activity may be significantly greater than ADCC determined for an appropriate negative control molecule in a given assay (e.g. an antibody or antigen-binding fragment thereof lacking an Fc region, or an antibody or antigen-binding fragment thereof comprising a ‘silent’ Fc region (e.g. as described in Hale et al. 2024)) e.g. as determined by analysis in an appropriate assay for ADCC activity.

[0169] The ability of an Fc region, or an antibody or antigen-binding fragment thereof comprising an Fc region, to induce ADCC can be analysed e.g. according to the method described in Yamashita et al., 2016 (hereby incorporated by reference in its entirety), or by51Cr release assay as described e.g. in Jedema et al., 2004 (hereby incorporated by reference in its entirety). The ability of an Fc region, or an antibody or antigen-binding fragment thereof comprising an Fc region, to induce ADCP can be analysed e.g. according to the method described in Kamen et al., 2017 (hereby incorporated by reference in its entirety). The ability of an Fc region, or an antibody or antigen-binding fragment thereof comprising an Fc region, to induce CDC can be analysed e.g. using a C1q binding assay, e.g. as described in Schlothauer et al., 2016 (incorporated by reference hereinabove).

[0170] In some embodiments, the antibody or antigen-binding fragment thereof according to the present invention comprises Fc-silencing mutations. Appropriate Fc-silencing mutations are well known to the skilled person, and are described, for example, in Hale et al. 2024, which is hereby incorporated by reference. In some embodiments, the antigen-binding molecule according to the present invention comprises the Fc-silencing mutations described in Armour et al. 1999, which is hereby incorporated by reference. In some embodiments, the antigen-binding molecule of the present invention comprises the following mutations (wherein the residues are numbered relative to the corresponding positions in wildtype human lgG1 Fc e.g. as shown in SEQ ID NO: 17) E233P, L234V, L235A, G236A, A327G, A330S, P331S.

[0171] In some embodiments, the antibody or antigen-binding fragment thereof of the present disclosure lacks an Fc region.

[0172] In some embodiments, the antibody or antigen-binding fragment thereof of the present invention is conjugated or fused to a further compound, such as a therapeutic agent, a toxin or the like. Such an antibody-compound conjugate may otherwise be referred to as an immunoconjugate or fusion protein.

[0173] Preferably, the antibody or antigen-binding fragment thereof of the present invention is comprised in an antibody-drug conjugate (ADC). ADCs are therapeutic agents which comprise an antibody, in this instance an antibody or antigen-binding fragment of the invention, conjugated or fused to a therapeutic agent, which may otherwise be referred to herein as a drug. The drug is typically a cytotoxic or chemotherapy agent. The ADC may comprise the formula A-L-C, wherein A comprises the antibody or antigen-binding fragment thereof, L comprises a ligand and C comprises the drug, preferably a cytotoxic or chemotherapy agent. In some embodiments, the antibody or antigen-binding fragment thereof (A) comprises a CDR-L1 comprising the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3), a CDR-L3 comprising the amino acid sequence SQTTHVPWT (SEQ ID NO: 7); and a CDR-H1 comprising the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12), a CDR-H2 comprising the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14) and a CDR-H3 comprising the amino acid sequence FYSPY (SEQ ID NO: 16).

[0174] In some embodiments, the antibody or antigen-binding fragment thereof (A) comprises a variable light chain comprising or consisting of SEQ ID NO: 1 and a variable heavy chain comprising or consisting of SEQ ID NO: 18.

[0175] Exemplary payloads or conjugates for the ADC may include topoisomerase I inhibitors such as camptothecin derivatives (analogs, intermediates, metabolites or conjugates such as SN38, exatecan or deruxtecan, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, maytansine or an analog or derivative thereof, mitoxantrone, mithramycin, actinomycin D, 1- ehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin; calicheamicin or analogs or derivatives thereof; antimetabolites (such as methotrexate, 6- mercaptopurine, 6-thioguanine, cytarabine, fludarabin, 5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabine, cladribine), alkylating agents (such as mechlorethamine, thioepa, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, dacarbazine (DTIC), procarbazine, mitomycin C, cisplatin and other platinum derivatives, such as carboplatin; as well as duocarmycin A, duocarmycin SA, CC-1065 (a .k.a. rachelmycin), or analogs or derivatives of CC- 1065), antibiotics (such as dactinomycin (formerly actinomycin), bleomycin, daunorubicin (formerly daunomycin), doxorubicin, idarubicin, mithramycin, mitomycin, mitoxantrone, plicamycin, anthramycin (AMC)), anti-mitotic agents (e.g., tubulin-inhibitors) such as monomethyl auristatin E, monomethyl auristatin F, or other analogs or derivatives of dolastatin 10; diphtheria toxin and related molecules (such as diphtheria A chain and active fragments thereof and hybrid molecules); ricin toxin (such as ricin A or a deglycosylated ricin A chain toxin), cholera toxin, a Shiga-like toxin (SLT-I, SLT-II, SLT-IIV), LT toxin, C3 toxin, Shiga toxin, pertussis toxin, tetanus toxin, soybean Bowman-Birk protease inhibitor, Pseudomonas exotoxin, alorin, saporin, modeccin, gelanin, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolacca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, and enomycin toxins. Other suitable conjugated molecules include antimicrobial / lytic peptides such as CLIP, Magainin 2, mellitin, Cecropin, and P18; ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, diphtherin toxin, and Pseudomonas endotoxin. See, for example, Pastan et al., Cell 47, 641 (1986) and Goldenberg, Calif. A Cancer Journal for Clinicians 44, 43 (1994).

[0176] Suitable therapeutic agents for forming immunoconjugates of the present invention include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, maytansine or an analog or derivative thereof, mitoxantrone, mithramycin, actinomycin D, 1-ehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin; calicheamicin or analogs or derivatives thereof; antimetabolites (such as methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, fludarabin, 5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabine, cladribine), alkylating agents (such as mechlorethamine, thioepa, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, dacarbazine (DTIC), procarbazine, mitomycin C, cisplatin and other platinum derivatives, such as carboplatin; as well as duocarmycin A, duocarmycin SA, CC-1065 (a .k.a. rachelmycin), or analogs or derivatives of CC- 1065), antibiotics (such as dactinomycin (formerly actinomycin), bleomycin, daunorubicin (formerly daunomycin), doxorubicin, idarubicin, mithramycin, mitomycin, mitoxantrone, plicamycin, anthramycin (AMC)), antimitotic agents (e.g., tubulin-inhibitors) such as monomethyl auristatin E, monomethyl auristatin F, or other analogs or derivatives of dolastatin 10; diphtheria toxin and related molecules (such as diphtheria A chain and active fragments thereof and hybrid molecules); ricin toxin (such as ricin A or a deglycosylated ricin A chain toxin), cholera toxin, a Shiga-like toxin (SLT-I, SLT-II, SLT-IIV), LT toxin, C3 toxin, Shiga toxin, pertussis toxin, tetanus toxin, soybean Bowman-Birk protease inhibitor, Pseudomonas exotoxin, alorin, saporin, modeccin, gelanin, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolacca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, and enomycin toxins. Other suitable conjugated molecules include antimicrobial / lytic peptides such as CLIP, Magainin 2, mellitin, Cecropin, and P18; ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, diphtherin toxin, and Pseudomonas endotoxin. See, for example, Pastan et al., Cell 47, 641 (1986) and Goldenberg, Calif. A Cancer Journal for Clinicians 44, 43 (1994).

[0177] In some embodiments, the antibody or antigen-binding fragment thereof is conjugated to a therapeutic agent selected from the group consisting of a cytotoxin, a radionuclide, an immunosuppressant, a chemotherapeutic drug and a cytokine.

[0178] In some embodiments, C comprises a topoisomerase I inhibitor or a tubulin inhibitor. In some embodiments, the topoisomerase I inhibitor comprises a camptothecin derivative. Exemplary camptothecin derivatives include, but are not necessary limited to topetecan, irinotecan, exatecan, deruxtecan and 7-ethyl-10-hydroxycaptothecin (SN38). The tubulin inhibitor may comprise monomethyl auristatin E, monomethyl auristatin F or other analogs or derivatives of dolastatin 10. In some embodiments, C comprises deruxtecan, monomethyl auristatin E, monomethyl auristatin F, SN38, exatecan, or analogs or derivatives thereof. In some embodiments, C comprises deruxtecan, monomethyl auristatin E, or analogs or derivatives thereof. In some embodiments, C comprises deruxtecan or monomethyl auristatin E. In some embodiments, C comprises deruxtecan (Dxd). In some embodiments, C comprises monomethyl auristatin E (MMAE). The ligand (L) (which may otherwise be referred to as a linker), which links the antibody or antigen binding fragment (A) to the drug (C) may comprise any standard linker known in the art. Various linkers are known in the art and suitable for use in ADCs.

[0179] In some embodiments, L comprises a protease cleavable linker.

[0180] In some embodiments, L comprises a spacer. In some embodiments, the spacer has a chain length of 2 to 30 atoms. In some embodiments, the spacer comprises or consists of an alkylene or oxyalkylene group. In some embodiments, the spacer comprises between one and six ethylene glycol units, e.g. a triethylene glycol.

[0181] In some embodiments, L comprises a valine-citrulline unit or an mc-GGFG linker. These are standard linkers in the field which are commercially available.

[0182] In some embodiments, the ADC has an IC50 value of from about 1 nM to about 60nM. For example, the ADC may have an IC50 value of from about 1 nM to about 50nM, optionally of from about 1 nM to about 40nM.

[0183] In some embodiments, the ADC has a drug-antibody ratio (DAR) of from 3 to about 8. In some embodiments, the ADC has a DAR of about 4. In other embodiments, the ADC has a DAR of about 8.

[0184] In some embodiments, the ADC has an EC50 of less than 1 nM. In some embodiments, the ADC has an EC50 of from about 0.3nM to about 1nM. In some embodiments, the ADC has an EC50 of less than 0.6nM.

[0185] In some embodiments, the ADC is the ADC described herein as SRB301 or SRB312. In some embodiments, the ADC is the ADC described herein as SRB301 . In some embodiments, the ADC is the ADC described herein as SRB312.

[0186] Also provided by the present invention is an anti-CCR9 antibody or antigen binding fragment thereof comprising a variable light chain comprising SEQ ID NO:39, wherein SEQ ID NO: 39 comprises a CDR- L1 comprising the amino acid sequence RSSQSLXHSNGXTFLH (SEQ ID NO: 2), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHXPWT (SEQ ID NO: 4), wherein X can be any amino acid.

[0187] In some embodiments, the CDR-L1 comprises the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5) and the CDR-L3 comprises the amino acid sequence SQTTHVPWT (SEQ ID NO: 7)

[0188] The antibody or antigen binding fragment thereof may be as defined above in relation to the first aspect. In particular, the CDR-Hs and the variable heavy chain may be as defined above in relation to the first aspect.

[0189] The present invention also provides an anti-CCR9 antibody or antigen binding fragment thereof comprising a variable light chain comprising SEQ ID NO: 40, wherein SEQ ID NO: 40 comprises a CDR- L1 comprising the amino acid sequence RSSQSLXHSNGXTFLH (SEQ ID NO: 2), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHXPWT (SEQ ID NO: 4), wherein X can be any amino acid.

[0190] In some embodiments, the CDR-L1 comprises the amino acid sequence RSSQSLLHSNGNTFLH (SEQ ID NO: 6) and the CDR-L3 comprises the amino acid sequence SQTTHLPWT (SEQ ID NO: 8).

[0191] The antibody or antigen binding fragment thereof may be as defined above in relation to the first aspect. In particular, the CDR-Hs and the variable heavy chain may be as defined above in relation to the first aspect.

[0192] According to a further aspect of the invention, there is provided an anti-CCR9 antibody or antigen binding fragment thereof, wherein the anti-CCR9 antibody or antigen binding fragment thereof binds to a discontinuous epitope comprising amino acids at positions 11 , 12, 13, 15 and 16 of the of the N-terminal extracellular domain of CCR9 isoform A. Positions 11 , 12, 13, 15 and 16 of the N-terminal extracellular domain of CCR9 isoform A may otherwise be referred to as P11 , N12, M13, D15 and D16. The anti- CCR9 antibody or antigen fragment thereof may be as defined above in relation to the first aspect of the invention.

[0193] For example, in some embodiments, the epitope comprises amino acids at positions 10, 11, 12, 13, 15 and 16 of the N-terminal extracellular domain of CCR9 isoform A.

[0194] In some embodiments, the epitope comprises amino acids at positions 10, 11 , 12, 13, 15, 16 and 17 of the N-terminal extracellular domain of CCR9 isoform A.

[0195] In some embodiments, the epitope does not comprise position 14, which may otherwise be referred to as A14, of the N-terminal extracellular domain of CCR9 isoform A.

[0196] According to a further aspect, there is provided a polynucleotide comprising a nucleotide sequence encoding the anti-CCR9 antibody or antigen binding fragment thereof as defined in accordance with any of the above aspects of the invention.

[0197] A polynucleotide, such as a nucleic acid, is a polymer comprising a plurality of nucleotides. The nucleotides can be naturally occurring or artificial.

[0198] A nucleotide typically contains a nucleobase, a sugar and at least one linking group, such as a phosphate, 2’0-methyl, 2’ methoxy-ethyl, phosphoramidate, methylphosphonate or phosphorothioate group. The nucleobase is typically heterocyclic. Nucleobases include, but are not limited to, purines and pyrimidines and more specifically adenine (A), guanine (G), thymine (T), uracil (U) and cytosine (C). The sugar is typically a pentose sugar. Nucleotide sugars include, but are not limited to, ribose and deoxyribose. The sugar and the nucleobase together form a nucleoside. Preferred nucleosides include, but are not limited to, adenosine, guanosine, 5-methyluridine, uridine, cytidine, deoxyadenosine, deoxyguanosine, thymidine, deoxyuridine and deoxycytidine. The nucleosides may be adenosine, guanosine, uridine and cytidine. The nucleotides are typically ribonucleotides or deoxyribonucleotides. The nucleotides may be deoxyribonucleotides. The nucleotides typically contain a monophosphate, diphosphate or triphosphate. Phosphates may be attached on the 5’ or 3’ side of a nucleotide.

[0199] Nucleotides include, but are not limited to, adenosine monophosphate (AMP), adenosine diphosphate (ADP), adenosine triphosphate (ATP), guanosine monophosphate (GMP), guanosine diphosphate (GDP), guanosine triphosphate (GTP), thymidine monophosphate (TMP), thymidine diphosphate (TDP), thymidine triphosphate (TTP), uridine monophosphate (UMP), uridine diphosphate (UDP), uridine triphosphate (UTP), cytidine monophosphate (CMP), cytidine diphosphate (CDP), cytidine triphosphate (CTP), 5-methylcytidine monophosphate, 5-methylcytidine diphosphate, 5-methylcytidine triphosphate, 5- hydroxymethylcytidine monophosphate, 5-hydroxymethylcytidine diphosphate, 5-hydroxymethylcytidine triphosphate, cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyadenosine monophosphate (dAMP), deoxyadenosine diphosphate (dADP), deoxyadenosine triphosphate (dATP), deoxyguanosine monophosphate (dGMP), deoxyguanosine diphosphate (dGDP), deoxyguanosine triphosphate (dGTP), deoxythymidine monophosphate (dTMP), deoxythymidine diphosphate (dTDP), deoxythymidine triphosphate (dTTP), deoxyuridine monophosphate (dUMP), deoxyuridine diphosphate (dUDP), deoxyuridine triphosphate (dUTP), deoxycytidine monophosphate (dCMP), deoxycytidine diphosphate (dCDP) and deoxycytidine triphosphate (dCTP), 5-methyl-2’- deoxycytidine monophosphate, 5-methyl-2’-deoxycytidine diphosphate, 5-methyl-2’-deoxycytidine triphosphate, 5-hydroxymethyl-2’-deoxycytidine monophosphate, 5-hydroxymethyl-2’-deoxycytidine diphosphate and 5-hydroxymethyl-2’-deoxycytidine triphosphate. The nucleotides may be selected from AMP, UMP, GMP, CMP, dAMP, dTMP, dGMP or dCMP. In some embodiments, the nucleotides are selected from dAMP, dTMP, dGMP or dCMP.

[0200] The nucleotides may contain additional modifications. In particular, suitable modified nucleotides include, but are not limited to, 2’amino pyrimidines (such as 2’-amino cytidine and 2’-amino uridine), 2’-hyrdroxyl purines (such as , 2’-fluoro pyrimidines (such as 2’-fluorocytidine and 2’fluoro uridine), hydroxyl pyrimidines (such as 5’-a-P-borano uridine), 2’-O-methyl nucleotides (such as 2’-O-methyl adenosine, 2’- O-methyl guanosine, 2’-O-methyl cytidine and 2’-O-methyl uridine), 4’-thio pyrimidines (such as 4’-thio uridine and 4’-thio cytidine) and nucleotides have modifications of the nucleobase (such as 5-pentynyl-2’- deoxy uridine, 5-(3-aminopropyl)-uridine and 1 ,6-diaminohexyl-N-5-carbamoylmethyl uridine).

[0201] One or more nucleotides in the polynucleotide may be modified, for instance with a label or a tag. The label may be any suitable label which allows the nucleotides to be detected. Suitable labels include, but are not limited to, fluorescent molecules, radioisotopes, e.g. 1251, 35S, enzymes, antibodies, antigens, other polynucleotides and ligands such as biotin.

[0202] The polynucleotide may comprise deoxyribonucleic acid (DNA) or ribonucleic acid (RNA).

[0203] Unless otherwise indicated, a particular polynucleotide sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with a different base, mixed-base and / or deoxyinosine residues (Batzer et al., 1991 , Nucleic Acid Res. 19:5081 ; Ohtsuka et al., 1985, J. Biol. Chem. 260:2605-2608; and Rossolini et al., 1994, Mol. Cell. Probes 8:91-98).

[0204] Substitutions may be used for the practices of codon optimisation and codon wobble, both of which are known to those skilled in the art. Thus, it will be appreciated that codon-optimised and codon-wobbled polynucleotides are also envisaged. In some embodiments, the polynucleotide is codon-optimised for human expression.

[0205] The polynucleotide can be produced by de novo solid-phase DNA synthesis or by PCR mutagenesis of an existing sequence. Direct chemical synthesis of polynucleotides can be accomplished by methods known in the art, such as the phosphotriester method of Narang et al., 1979, Meth. Enzymol. 68:90; the phosphodiester method of Brown et al., 1979, Meth. Enzymol. 68:109; the diethylphosphoramidite method of Beaucage et al., 1981 , Tetra. Lett., 22:1859; and the solid support method of U.S. Pat. No. 4,458,066. Introducing mutations to a polynucleotide sequence by PCR can be performed as described in, e.g., PCR Technology: Principles and Applications for DNA Amplification, H. A. Erlich (Ed.), Freeman Press, NY, N.Y., 1992; PCR Protocols: A Guide to Methods and Applications, Innis et al. (Ed.), Academic Press, San Diego, Calif, 1990; Mattila et al., 1991 , Nucleic Acids Res. 19:967; and Eckert et al., 1991 , PCR Methods and Applications 1 :17.

[0206] Vectors

[0207] The invention also provides a vector comprising the polynucleotide of the above aspect.

[0208] The vector may be an expression vector. The vector may be viral or non-viral.

[0209] Non-viral vectors and systems include plasmids, episomal vectors, typically with an expression cassette for expressing a protein or RNA, and human artificial chromosomes (see, e.g., Harrington et al., 1997, Nat Genet. 15:345). For example, non-viral vectors useful for expression of the antibody or antigenbinding fragment thereof of the invention in mammalian (e.g., human) cells include pThioHis A, B and C, pcDNA3.1 / His, pEBVHis A, B and C, (Invitrogen, San Diego, Calif.), MPS V vectors, and numerous other vectors known in the art for expressing other proteins. Useful viral vectors include vectors based on retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, vectors based on SV40, papilloma virus, HBP Epstein Barr virus, vaccinia virus vectors and Semliki Forest virus (SFV). See, Brent et al., supra; Smith, 1995, Annu. Rev. Microbiol. 49:807; and Rosenfeld et al., 1992, Cell 68: 143.

[0210] In some embodiments, the vector is a retroviral or lentiviral vector. Optionally, the vector is an SFG retroviral vector. In some embodiments the vector is a lentiviral vector. Lentiviral vectors include selfinactivating lentiviral vectors (so-called SIN vectors).

[0211] The choice of vector depends on the intended host cells in which the vector is to be expressed.

[0212] Expression vectors for mammalian host cells may include expression control sequences, such as an origin of replication, a promoter, and an enhancer (see, e.g., Queen, et al., 1986, Immunol. Rev. 89:49- 68), and processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences. These expression vectors usually contain promoters derived from mammalian genes or from mammalian viruses. Suitable promoters may be constitutive, cell type-specific, stage-specific, and / or modulatable or regulatable. Useful promoters include, but are not limited to, the metallothionein promoter, the constitutive adenovirus major late promoter, the dexamethasone-inducible MMTV promoter, the SV40 promoter, the MRP poll II promoter, the constitutive MPS V promoter, the tetracycline-inducible CMV promoter (such as the human immediate-early CMV promoter), the constitutive CMV promoter, the EF1 alpha promoter, the phosphoglycerate kinase (PGK) promoter and promoter-enhancer combinations known in the art.

[0213] Cultures of transformed organisms can be expanded under non-inducing conditions without biasing the population for coding sequences whose expression products are better tolerated by the host cells. In addition to promoters, other regulatory elements may also be required or desired for efficient expression of the antibody or antigen binding fragment thereof of the invention. These elements may include an ATG initiation codon and adjacent ribosome binding site or other sequences. In addition, the efficiency of expression may be enhanced by the inclusion of enhancers appropriate to the cell system in use (see, e.g., Scharf et al., 1994, Results Probl. Cell Differ. 20:125; and Bittner et al., 1987, Meth. Enzymol., 153:516). For example, the SV40 enhancer or CMV enhancer may be used to increase expression in mammalian host cells.

[0214] Cells

[0215] The present invention also provides a cell comprising the anti-CCR9 antibody or antigen binding fragment thereof, the polynucleotide or the vector as defined in any of the aspects above.

[0216] The cell may be prokaryotic or eukaryotic.

[0217] Cells suitable include, but are not necessarily limited to, mammalian, plant, insect, fungal and bacterial cells. Bacterial cells include, without limitation, cells from Gram positive bacteria such as species of the genus Bacillus, Streptomyces and Staphylococcus and Gram-negative bacterial cells such as cells of the genus Escherichia and Pseudomonas. Fungal cells preferably include yeast cells such as Saccharomyces, Pichia pastoris and Hansenula polymorpha. Insect cells include, but are not necessarily limited to Drosophila cells and Sf9 cells. Plant cells include, among others, cells of crop plants such as cereals, medicinal, ornamental or bulbs. Mammalian cells suitable for the present invention include epithelial cell lines, osteosarcoma cell lines, neuroblastoma cell lines, epithelial carcinomas, glial cells, hepatic cell lines, CHO (Chinese Hamster Ovary) cells, COS cells, BHK cells, HeLa cells, 911 cells, AT1080 cells, A549 cells, 293 and 293T cells, PER.C6 cells, NTERA-2 human ECCs cells, D3 cells of the mESCs line, human embryonic stem cells such as HS293, hMSCs and BGV01 , SHEF1, SHEF2 and HS181, NIH3T3 cells, REH and MCF-7 cells.

[0218] The cell may comprise a hybridoma cell. The term “hybridoma”, as used herein, refers to a hybrid cell line formed by fusing a specific antibody-producing B cell with a myeloma (B cell cancer) cell that is selected for its ability to grow in tissue culture and for an absence of antibody chain synthesis. The antibodies produced by the hybridoma are usually of a single specificity and are therefore monoclonal antibodies (in contrast to polyclonal antibodies). The production of monoclonal antibodies was invented by Cesar Milstein and Georges J. F. Kohler in 1975 (Kohler and Milstein, 1975, Nature 256:495- 7).

[0219] In some embodiments, the cell is an immune cell, such as a T or B cell. In some embodiments, the cell is a T cell. In some embodiments, the cell is a CAR cell. In some embodiments, the cell is a CAR T-cell. Preferably, the CAR comprises the CDR regions of the anti CCR9 antibody or antigen binding fragment thereof of the invention. For example, the CAR may comprise a variable light chain comprising SEQ ID NO:1 or a variant thereof having at least 95% sequence identity to SEQ ID NO:1, wherein the variable light chain comprises a CDR-L1 comprising the amino acid sequence RSSQSLXHSNGXTFLH (SEQ ID NO: 2), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHXPWT (SEQ ID NO: 4), wherein X can be any amino acid. In some embodiments the CAR further comprises a CDR-H1 comprising the amino acid sequence GFTFSXYWMX (SEQ ID NO: 9), a CDR-H2 comprising the amino acid sequence EIRSKSXNYATHYXESXXG (SEQ ID NO: 10) and a CDR-H3 comprising the amino acid sequence XYSPY (SEQ ID NO: 11), wherein X can be any amino acid.

[0220] Pharmaceutical compositions

[0221] According to a further aspect, the present invention provides a pharmaceutical composition comprising the anti-CCR9 antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the cell or the vector as defined in any of the above aspects and a pharmaceutically or physiologically acceptable diluent and / or carrier.

[0222] The carrier and / or diluent is generally selected to be suitable for the intended mode of administration and can include agents for modifying, maintaining, or preserving, for example, the pH, osmolarity, viscosity, clarity, colour, isotonicity, odour, sterility, stability, rate of dissolution or release, adsorption, or penetration of the composition. Typically, these carriers and / or diluents include aqueous or alcoholic / aqueous solutions, emulsions, or suspensions, including saline and / or buffered media.

[0223] Suitable further agents for inclusion in the pharmaceutical compositions may include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine, or lysine), antimicrobials, antioxidants (such as ascorbic acid, sodium sulphite, or sodium hydrogen-sulphite), buffers (such as borate, bicarbonate, Tris-HCI, citrates, phosphates, or other organic acids), bulking agents (such as mannitol or glycine), chelating agents (such as ethylenediamine tetraacetic acid (EDTA)), complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin, or hydroxypropyl-beta-cyclodextrin), fillers, monosaccharides, disaccharides, and other carbohydrates (such as glucose, mannose, or dextrins), proteins (such as free serum albumin, gelatin, or immunoglobulins), colouring, flavouring and diluting agents, emulsifying agents, hydrophilic polymers (such as polyvinylpyrrolidone), low molecular weight polypeptides, salt-forming counterions (such as sodium), preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methyl para ben, propylparaben, chlorhexidine, sorbic acid, or hydrogen peroxide), solvents (such as glycerin, propylene glycol, or polyethylene glycol), sugar alcohols (such as mannitol or sorbitol), suspending agents, surfactants or wetting agents (such as pluronics; PEG; sorbitan esters; polysorbates such as Polysorbate 20 or Polysorbate 80; Triton; tromethamine; lecithin; cholesterol or tyloxapal), stability enhancing agents (such as sucrose or sorbitol), tonicity enhancing agents (such as alkali metal halides, such as sodium or potassium chloride, or mannitol sorbitol), delivery vehicles, excipients and / or pharmaceutical adjuvants.

[0224] The carrier and / or diluent may be a parenteral, optionally intravenous vehicle. Suitable parenteral vehicles may include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride and lactated Ringer's. Suitable physiologically-acceptable thickeners such as carboxymethylcellulose, polyvinylpyrrolidone, gelatin and alginates may be included. Intravenous vehicles include fluid and nutrient replenishers and electrolyte replenishers, such as those based on Ringer's dextrose. In some cases, one might include agents to adjust tonicity of the composition, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in a pharmaceutical composition. For example, in many cases it is desirable that the composition is substantially isotonic. Preservatives and other additives, such as antimicrobials, antioxidants, chelating agents, and inert gases, may also be present. The precise formulation will depend on the route of administration. Additional relevant principles, methods and components for pharmaceutical formulations are well known (see, e.g., Allen, Loyd V. Ed, (2012) Remington's Pharmaceutical Sciences, 22nd Edition).

[0225] A pharmaceutical composition of the present invention can be administered by one or more routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled person, the route and / or mode of administration will vary depending upon the desired results. Routes of administration for pharmaceutical compositions of the invention may include intravenous, intramuscular, intradermal, intraperitoneal, intrapleural, subcutaneous, intratumoural, spinal, or other parenteral routes of administration, for example by injection or infusion. The phrase "parenteral administration" as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural, intratumoural, intrapleural and intra-sternal injection and infusion. In some embodiments, the pharmaceutical composition is administered intratumourally. In other embodiments, administration is intrapleural or intraperitoneal. When parenteral administration is contemplated, the pharmaceutical compositions are usually in the form of a sterile, pyrogen-free, parenterally acceptable composition. A particularly suitable vehicle for parenteral injection is a sterile, isotonic solution, properly preserved. The pharmaceutical composition can be in the form of a lyophilizate, such as a lyophilized cake.

[0226] Alternatively, the pharmaceutical composition of the invention can be administered by a nonparenteral route, such as a topical, epidermal, or mucosal route of administration, for example, intranasally, orally, or sublingually. In some embodiments, the pharmaceutical composition is for subcutaneous administration. Typically, the pharmaceutical compositions for subcutaneous administration contain suitable stabilizers (e.g., amino acids, such as methionine, and or saccharides such as sucrose), buffering agents and tonicifying agents. Alternatively, the pharmaceutical composition may be for intravenous administration.

[0227] Kits

[0228] According to a further aspect, there is provided a kit comprising the anti-CCR9 antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition as defined according to any of the above aspects.

[0229] The kit may further comprise instructions for use. In some embodiments, the antibody or antigen binding fragment thereof is provided in an aqueous solution, optionally buffered solution. In some embodiments, the antibody or antigen binding fragment thereof is provided at a temperature of 4°C or less. For example the antibody or antigen binding fragment may be provided at a temperature of -20°C or less.

[0230] Methods of producing the antibody or antigen binding fragment thereof

[0231] Also provided by the present invention is a method for producing the antibody or antigen binding fragment of the invention. The method comprises culturing a cell as defined in the above aspect under conditions permitting expression of said antibody or antigen binding fragment thereof.

[0232] The method may comprise: a) Introducing a polynucleotide or vector as defined in the above aspects into a cell as defined in the above aspect; and b) Culturing the cell under conditions permitting expression of said antibody or antigen binding fragment thereof.

[0233] The cell may be as defined above. For example, the cell may be prokaryotic or eukaryotic. The cell may be a mammalian cell. For example, the cell may be a HEK-293 cell or a CHO cell. The cell may be an immune cell, for example a T-cell, such as a CAR T-cell.

[0234] Introduction of a polynucleotide or vector into the cell may otherwise be referred to as genetic engineering of the cell. The genetic engineering of cells can be carried out according to standard cloning and expression techniques, which are known in the art (e.g., as described in Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989). The vector of the invention may be introduced into the cell using such techniques.

[0235] For example, introduction may comprise transducing or transfecting the polynucleotide or vector into the cell. The conditions for optimising the culture of said cell will depend on the cell used. If desired, the method for producing the antibody or antigen binding fragment thereof of the invention further includes the isolation and purification of said antibody or antigen binding fragment. For example, purification may comprise using protein A affinity chromatography.

[0236] In some embodiments the method is a method for producing the antibody drug conjugate of the invention. The method may further comprise conjugating, fusing or linking a drug as described herein to the antibody or antigen binding fragment thereof. Various suitable conjugates and linkers, as well as methods of conjugating, fusing and linking, are known to the skilled person and are commercially available.

[0237] Methods of diagnosis

[0238] According to a further aspect, the present invention provides a method of diagnosing a disease associated with elevated CCR9 expression in a subject, the method comprising: a) contacting the antibody or antigen binding fragment thereof of the invention with a sample comprising cells from the subject; b) detecting and / or quantifying CCR9 expression in the subject sample; c) comparing the level of CCR9 expression detected in the subject sample with the level of CCR9 expression detected in a control sample; d) correlating the comparison obtained in step c) with the presence of a disease associated with elevated CCR9 expression.

[0239] In some embodiments, the subject is diagnosed with the disease when the comparison in step c) indicates an increased level of CCR9 expression in the subject sample compared to the level of CCR9 expression in the control sample. In some embodiments, the increased level of CCR9 expression may be at least 1.5x the level of CCR9 expression in the control sample. In some embodiments, the increased level of CCR9 expression may be at least 2x, optionally at least 3x, further optionally at least 5x the level of CCR9 expression in the control sample. In some embodiments, the increased level of CCR9 expression may comprise an increase of at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 150%, at least 200% or more in respect to the control sample.

[0240] The antibody or antigen binding fragment thereof may be as defined herein.

[0241] The disease may comprise an inflammatory disease such as cancer, liver fibrosis, acute liver inflammation or an autoimmune disease. Exemplary autoimmune diseases may include, but not necessarily be limited to inflammatory bowel disease (IBD), Crohn’s Disease, colitis, ulcerative colitis, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), psoriasis, Systemic Lupus Erythematosus (SLE), Systemic Sclerosis (SSc) and ankylosing spondylitis. For example, the disease may comprise cancer, liver fibrosis, acute liver inflammation, inflammatory bowel disease (I BD), Crohn’s Disease, colitis, ulcerative colitis, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), psoriasis, Systemic Lupus Erythematosus (SLE), Systemic Sclerosis (SSc) or ankylosing spondylitis.

[0242] The disease may be selected from the group consisting of cancer, Crohn’s Disease, inflammatory bowel disease, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), Systemic Lupus Erythematosus (SLE), Systemic Sclerosis (SSc), colitis, ulcerative colitis, liver fibrosis and acute liver inflammation.

[0243] The disease may be selected from the group consisting of cancer, Crohn’s disease, inflammatory bowel disease, colitis, ulcerative colitis, liver fibrosis and acute liver inflammation. In some embodiments, the disease comprises cancer, inflammatory bowel disease, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), Systemic Lupus Erythematosus (SLE) or Systemic Sclerosis (SSc). In some embodiments, the disease comprises cancer, inflammatory bowel disease, Rheumatoid Arthritis (RA) or Psoriatic Arthritis (PsA). In some embodiments, the disease is cancer or inflammatory bowel disease.

[0244] In some embodiments, the disease is cancer. In some embodiments, the disease is inflammatory bowel disease.

[0245] The cancer may be selected from ovarian cancer, prostate cancer, breast cancer, melanoma, T-cell acute lymphoblastic leukaemia (T-ALL), pancreatic cancer, colorectal cancer, lung cancer, circulating cells from a solid tumour (CTCs), T-cell lineage lymphomas and acute myeloid leukaemia (AML).

[0246] The breast cancer may comprise metastatic breast cancer. The lung cancer may comprise non small-cell lung carcinoma (NSCLC), for example squamous lung cancer or lung adenocarcinoma.

[0247] The subject may be a mammal. Optionally, the subject is a human, horse, dog or cat. In some embodiments, the subject is human.

[0248] The term “sample”, as used herein, includes different types of biological fluids, sections of tissues of the affected organs, etc. Illustrative, non-limiting examples of said samples include different types of biological fluids, such as peritoneal fluid, pleural fluid, synovial fluid, urine, saliva, blood, semen, serum, etc. These biological fluid samples can be obtained by any conventional method known by persons having ordinary skill in the art. Alternatively, the sample can also be a section of an affected organ tissue sample, for example from the lymphoid gland, breast, prostate, skin, small bowel, large, bowel, pancreas, ovary, lung, bladder, kidney, etc., which can be obtained by any conventional method, for example by means of biopsy, cystoscopy, surgical resection, etc., as well as frozen sections taken for histologic purposes.

[0249] In some embodiments, the sample is a tumour sample.

[0250] The antibody or antigen binding fragment thereof can be labelled or not labelled. The term “detectable label” or “labelling agent”, as used herein, refers to a molecular label which allows the detection, localization and / or identification of the molecule to which it is attached, using suitable procedures and equipment for detection, for example by spectroscopic, photochemical, biochemical, immunochemical or chemical means.

[0251] Labelling agents that are suitable for labelling the antibody or antigen binding fragment thereof include radionuclides, enzymes, fluorophores, chemiluminescent reagents, enzyme substrates or cofactors, enzyme inhibitors, particles, dyes and derivatives, and the like. As the person skilled in the art will understand, antibodies that are not labelled need to be detected with an additional reagent, for example, a secondary antibody that is labelled, which will be labelled. This is particularly useful in order to increase the sensibility of the detection method, since it allows the signal to be amplified.

[0252] There is a wide range of conventional assays that can be used in the present invention which use an antibody of the invention that is not labelled (primary antibody) and an antibody of the invention that is labelled (secondary antibody); these techniques include Western blot or immunoblot, ELISA (Enzyme- Linked Immunosorbent Assay), RIA (Radioimmunoassay), competitive EIA (Competitive Enzyme Immunoassay), DAS- ELISA (Double Antibody Sandwich-ELISA), immunocytochemical and immunohistochemical techniques, flow cytometry or multiplex detection techniques based on using protein microspheres, biochips or microarrays which include the antibody of the invention. Other ways of detecting and quantifying CCR9 using the antibody of the invention may include affinity chromatography techniques, ligand binding assays or lectin binding assays.

[0253] The term “control sample” or “reference sample”, as used herein, refers to a sample that comprises undetectable levels of CCR9 expression, or comprises a level of CCR9 expression considered to be a normal physiological level. In some embodiments, the control sample is from a healthy subject, although it may also be obtained from other subjects, including subjects who do not have a clinical history of a disease or condition associated with elevated CCR9 expression, the same subject but from a tissue or part thereof which is under a normal physiological condition or healthy. In some embodiments, the control sample is a sample from an individual who does not have a clinical history of a disease or condition associated with elevated CCR9 expression.

[0254] In embodiments where the subject is diagnosed with the disease, the method may further comprise step e) comprising a method of treating the disease in the subject. The method of treating the disease may be as defined according to the aspect below.

[0255] Methods of treatment or prevention

[0256] Also provided is a method of treating or preventing a disease in a subject, wherein the method comprises administering to the subject the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention.

[0257] The disease may comprise an inflammatory disease such as cancer, liver fibrosis, acute liver inflammation or an autoimmune disease. Exemplary autoimmune diseases may include, but not necessarily be limited to inflammatory bowel disease (IBD), Crohn’s Disease, colitis, ulcerative colitis, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), psoriasis, Systemic Lupus Erythematosus (SLE), Systemic Sclerosis (SSc) and ankylosing spondylitis.

[0258] For example, the disease may comprise cancer, liver fibrosis, acute liver inflammation, inflammatory bowel disease (I BD), Crohn’s Disease, colitis, ulcerative colitis, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), psoriasis, Systemic Lupus Erythematosus (SLE), Systemic Sclerosis (SSc) or ankylosing spondylitis.

[0259] The disease may be selected from the group consisting of cancer, Crohn’s Disease, inflammatory bowel disease, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), Systemic Lupus Erythematosus (SLE), Systemic Sclerosis (SSc), colitis, ulcerative colitis, liver fibrosis and acute liver inflammation.

[0260] The disease may be selected from the group consisting of cancer, Crohn’s disease, inflammatory bowel disease, colitis, ulcerative colitis, liver fibrosis and acute liver inflammation. In some embodiments, the disease comprises cancer, inflammatory bowel disease, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), Systemic Lupus Erythematosus (SLE) or Systemic Sclerosis (SSc). In some embodiments, the disease comprises cancer, inflammatory bowel disease, Rheumatoid Arthritis (RA) or Psoriatic Arthritis (PsA). In some embodiments, the disease is cancer or inflammatory bowel disease.

[0261] In some embodiments, the disease is cancer. In some embodiments, the disease is inflammatory bowel disease.

[0262] The cancer may be selected from ovarian cancer, prostate cancer, breast cancer, melanoma, T-cell acute lymphoblastic leukaemia (T-ALL), pancreatic cancer, colorectal cancer, lung cancer, circulating cells from a solid tumour (CTCs), T-cell lineage lymphomas and acute myeloid leukaemia (AML).

[0263] The breast cancer may comprise metastatic breast cancer. The lung cancer may comprise non small-cell lung carcinoma (NSCLC), for example squamous lung cancer or lung adenocarcinoma.

[0264] The method typically comprises administering a therapeutically effective amount or a prophylactically effective amount of the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention. A therapeutically effective amount is an amount which ameliorates one or more symptoms, such as all the symptoms, of the disease and / or abolishes one or more symptoms, such as all the symptoms, of the disease. The therapeutically effective amount preferably cures the disease. A prophylactically effective amount is an amount which prevents the onset of the disease and / or prevents the onset of one or more symptoms, such as all the symptoms, of the disease. The prophylactically effective amount preferably prevents the subject from developing the disease. Suitable amounts are discussed in more detail below.

[0265] The antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention may be administered to a subject that displays symptoms of disease. The antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention may be administered to a subject that is asymptomatic, i.e. does not display symptoms of disease. The antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention may be administered when the subject’s disease status is unknown or the subject is expected not to have a disease. The antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention may be administered to a subject that is predisposed, such as genetically predisposed, to developing the disease.

[0266] The subject may be a mammal. Optionally, the subject is a human, horse, dog or cat. In some embodiments, the subject is human.

[0267] In some embodiments the subject is a mammal (preferably a human) who has been diagnosed as having, or as being at risk of developing, a cancer. In some embodiments, the subject has been or is being treated with anti-cancer therapy (e.g. with an anti-cancer drug treatment, surgical treatment and / or radiotherapy). In some embodiments, the cancer of the subject may have relapsed, spread and / or developed resistance to a first-line therapy.

[0268] In some embodiments the cancer of the subject is advanced, metastatic and / or refractory cancer.

[0269] The subject may have been pre-treated with a chemotherapeutic agent.

[0270] In embodiments where the subject is a mammal who has been diagnosed as having, or as being at risk of developing a cancer, the administration of the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention to the subject may result in a decrease in tumour size of about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or even about 100%, when compared to an untreated tumour.

[0271] Any suitable form of administration may be used for the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention. For example, the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention may be administered subcutaneously, intranasally, orally, topically, intraperitoneally or intravenously. In some embodiments, the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell, or the pharmaceutical composition of the invention may be intraperitoneally administered.

[0272] In a further aspect, the present invention provides the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in any of the therapeutic methods described above. Thus, also provided is the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in the treatment or prevention of a disease. The disease may be selected from cancer, Crohn’s disease, inflammatory bowel disease, colitis, ulcerative colitis, liver fibrosis and acute liver inflammation. In particular, the invention provides the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in the treatment or prevention of cancer. The cancer may be as defined for the method of treatment aspect.

[0273] Also provided is the use of the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for the manufacture of a medicament for the treatment or prevention of a disease. The disease may be as defined above in relation to the method of treatment or medical use aspects. Optionally, the disease is cancer. Further provided is use of the antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for the treatment or prevention of a disease. The disease may be as defined above in relation to the method of treatment of medical use aspects. For example, the disease may comprise cancer.

[0274] The features disclosed in the foregoing description, or in the following claims, or in the accompanying drawings, expressed in their specific forms or in terms of a means for performing the disclosed function, or a method or process for obtaining the disclosed results, as appropriate, may, separately, or in any combination of such features, be utilised for realising the invention in diverse forms thereof.

[0275] While the invention has been described in conjunction with the exemplary embodiments described above, many equivalent modifications and variations will be apparent to those skilled in the art when given this disclosure. Accordingly, the exemplary embodiments of the invention set forth above are considered to be illustrative and not limiting. Various changes to the described embodiments may be made without departing from the spirit and scope of the invention.

[0276] For the avoidance of any doubt, any theoretical explanations provided herein are provided for the purposes of improving the understanding of a reader. The inventors do not wish to be bound by any of these theoretical explanations.

[0277] Any section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.

[0278] Throughout this specification, including the claims which follow, unless the context requires otherwise, the word “comprise” and “include”, and variations such as “comprises”, “comprising”, and “including” will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps.

[0279] It must be noted that, as used in the specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Ranges may be expressed herein as from “about” one particular value, and / or to “about” another particular value. When such a range is expressed, another embodiment includes from the one particular value and / or to the other particular value. Similarly, when values are expressed as approximations, by the use of the antecedent “about,” it will be understood that the particular value forms another embodiment. The term “about” in relation to a numerical value is optional and means for example + / - 10%. All documents mentioned in this text are incorporated herein by reference.

[0280] Examples

[0281] For standard molecular biology techniques, see Sambrook, J., Russel, D.W. Molecular Cloning, A Laboratory Manual. 3 ed. 2001 , Cold Spring Harbor, New York: Cold Spring Harbor Laboratory Press.

[0282] In the examples below, the following antibodies and ADCs are discussed. Reference may be to the full antibody name, or alternatively, to the nomenclature shown in the right column, where an alternative term is provided.

[0283] Table 1: Table of antibodies, antibody-drug conjugates (ADCs) and nomenclature used

[0284] Example 1

[0285] Production and quality control of humanized anti-CCR9 antibodies

[0286] Two pools of murine antibody candidates targeting CCR9 were generated using CCR9 N-terminal peptide immunization by intraperitoneal injection.

[0287] The spleen was excised and spleen cells were fused with P3U1 cell line. Culture supernatants were screened by ELISA and then flow cytometry to select hybridomas that were producing anti-CCR9 mAbs.

[0288] Murine anti-CCR9 antibodies were screened for affinity to CCR9. The top binding antibodies (IAb01 , IAbO2, C9Mab-16 and C9Mab-19) were selected for humanization and subsequent characterization. Humanized variants of the four selected antibodies were generated by CDR grafting, including one variant for IAb01 (hulAbOl) and two variants for each of the other antibodies (hulAbO2, huC9Mab-16, huC9Mab-19). One humanized VH domain was combined with two different humanized VL domains (VL1 , VL2) based on two different human VL germline genes (Fig. 1).

[0289] For clones 16 and 19 one VH segment (IGHV3-73*01 ) was used but 2 different VL segments (either IGKV2-30*01 or IGKV2-29*01 and IGKV1-30*01) giving the humanized sequences VL1 and VL2, respectively. Of note, GKV2-30*01 and GKV2-29*01 have a very negative z-score for humanness, while IGKV1-30*01) has a very high positive z-score, i.e. is defined as very human and thus favorable. Of note IGKV1-30*01 is less homologous to the parental antibodies 16 and 19 as IGKV2-30*01 or IGKV2- 29*01. All sequences were further analysed for canonical structure before and after CDR grafting and 2 mutations were introduced into the N-terminal region (FR1) of IGKV1-30*01 derived sequences to obtain the same canonicals as in the parental sequences. huC9Mab-16 VL2 comprises a variable light chain comprising SEQ ID NO:1. SEQ ID NO: 1 comprises a CDR-L1 comprising the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHVPWT (SEQ ID NO: 7). huC9Mab-16 VL2 also comprises a variable heavy chain (SEQ ID NO: 18) comprising a CDR-H1 comprising the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12), a CDR-H2 comprising the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14) and a CDR-H3 comprising the amino acid sequence FYSPY (SEQ ID NO: 16). huC9Mab-19 VL2 comprises a variable light chain comprising SEQ ID NO: 20. SEQ ID NO: 20 comprises a CDR-L1 comprises amino acid sequence RSSQSLLHSNGNTFLH (SEQ ID NO: 6), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3), and a CDR-L3 comprising the amino acid sequence SQTTHLPWT (SEQ ID NO: 8). huC9Mab-19 VL2 also comprises a variable heavy chain (SEQ ID NO: 19) comprising a CDR-H1 comprising the amino acid sequence GFTFSNYWMD (SEQ ID NO: 13), a CDR-H2 comprising the amino acid sequence EIRSKSNNYATHYAESMKG (SEQ ID NO: 15) and a CDR-H3 comprising the amino acid sequence YYSPY (SEQ ID NO: 17).

[0290] A direct comparison of the sequences of the variable domains of the anti-CCR9 antibodies demonstrated differences in the CDR regions between the different antibodies. The anti-CCR9 antibody SRB1 or SRB10 (92R, as disclosed in WO 2015 / 075269) has been included in all the different experiments as a positive control (Fig. 1). SRB1 comprises a CDR-L1 comprising the amino acid sequence RSSQSLVHSNGNTYLN (SEQ ID NO: 37), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQSTHFPRT (SEQ ID NO: 38).

[0291] The humanized anti-CCR9 antibodies were successfully produced using HEK293-6E cells for transfection and using Protein A affinity chromatography for purification. The humanized anti-CCR9 antibodies were analyzed by SDS-PAGE using reducing or non-reducing conditions (Fig. 2). SDS-PAGE under reducing conditions revealed two bands at approximately 55 kDa and in the range of 26 kDa to 24 kDa for the anti- CCR9 antibodies representing the heavy and light chain of the antibodies, respectively. Under nonreducing conditions, one major peak was detected above 170 kDa for all humanized anti-CCR9 antibodies representing the intact molecule containing two heavy chains and two light chains. Thus, SDS- PAGE demonstrated purity and correct composition of all the IgG antibodies.

[0292] In addition, all humanized anti-CCR9 antibodies were also subjected to analytical size-exclusion chromatography using HPLC (Fig. 3). Integrity of all humanized anti-CCR9 antibodies was confirmed by a major peak using SEC-HPLC analysis.

[0293] Example 2

[0294] Binding analysis of the humanized antibodies

[0295] Binding of the humanized anti-CCR9 antibodies was analyzed by ELISA using a biotinylated peptide corresponding to the human CCR9 extracellular N-terminal region (TPTDFTSPIPNMADDYGSESTSS, SEQ ID NO: 22). SEQ ID NO: 22 comprises amino acids 2-24 of the human CCR9 extracellular N- terminal region, and so comprises SEQ ID NO: 21 (amino acids 2-22 of the human CCR9 extracellular N- terminal region).

[0296] ELISA plates were coated with the biotinylated peptide overnight at 4°C. ELISA plates were blocked and washed, and serial dilution of the antibodies were added to the wells and incubated for 1 hour at room temperature. Antibody detection was performed with anti-human Fc antibody, measuring absorption at 450 nm (Fig. 4). ECso values of different anti-CCR9 antibodies to the N-terminal peptide are listed in Table 2.

[0297] Table 2: EC5o values of humanized anti-CCR9 antibodies determined by ELISA binding to CCR9 N- terminal peptide 1 (TPTDFTSPIPNMADDYGSESTSS, SEQ ID NO: 22). Mean ± SD, n=2.

[0298] The top binding antibodies (huC9Mab-16 and huC9Mab-19), were selected for subsequent characterization. Indeed, both huC9Mab-16 VL2 and huC9Mab-19 VL2 and VL1 show strong binding properties to the human CCR9 extracellular N-terminal region. huC9Mab-16 VL2 showed a superior binding to the other anti-CCR9 antibodies, with a significantly lower EC50.

[0299] Cell-binding analysis of the humanized antibodies using MOLT-4 cells

[0300] Binding of the humanized anti-CCR9 antibodies was analyzed by flow cytometry using CCR9-expressing MOLT-4 cells. MOLT-4 is a T lymphoblast cell line commonly used in immunological research. Serial dilutions (1 :4 titrated) of the different anti-CCR9 antibodies were incubated with MOLT-4 cells for 1 hour at 4°C. Bound antibodies were detected with a PE-labeled anti-human Fc antibody (Jackson ImmunoResearch 109-115-098; 1 :500) and cells were analyzed using a Miltenyi MACS-Quant (Fig. 5).

[0301] Concentration-dependent binding of anti-CCR9 antibodies to MOLT-4 cells was observed. huC9Mab-16- VL2 exhibited particularly strong binding capacities (potency). ECso values of the different anti-CCR9 antibodies to MOLT-4 cells are listed in Table 3.

[0302] Table 3: ECso values of humanized anti-CCR9 antibodies determined by flow cytometry using MOLT-4 cells. Mean ± SD, n=3.

[0303] HuC9Mab-16-VL2 showed slightly better maximal binding compared to SRB1 (Fig. 5). Furthermore, these results indicate that humanized antibodies comprising VL2 domains are superior to those comprising VL1 domains.

[0304] Cell-binding analysis of the humanized antibodies using HEK293-CCR9 cells

[0305] Binding of the humanized anti-CCR9 antibodies was analyzed by flow cytometry using huCCR9- expressing HEK293 cells. Serial dilutions (1 :4 titrated) of the different anti-CCR9 antibodies were incubated with HEK293-CCR9 cells for 1 hour at 4°C. Bound antibodies were detected with a PE-labeled anti-human Fc antibody (Jackson ImmunoResearch 109-115-098; 1 :500) and cells were analyzed using a Miltenyi MACS-Quant (Fig. 6).

[0306] Concentration-dependent binding of all anti-CCR9 antibodies to HEK293-CCR9 cells was observed. HuC9Mab-16-VL2 showed strong binding and maximal binding superior to the other anti-CCR9 molecules (Fig. 6). ECso values of the different anti-CCR9 antibodies to HEK293-CCR9 cells are listed in Table 4.

[0307] Table 4: EC50 values of humanized anti-CCR9 antibodies determined by flow cytometry using HEK293-CCR9 cells. Mean ± SD, n=3.

[0308] Example 3

[0309] Analysis of CCR9-ligand CCL25

[0310] Competition between the humanized antibodies and the constitutive ligand of CCR9 (CCL25) was analyzed using MOLT-4 cells (Fig. 7). Cells were pre-incubated with 100 nM of humanized anti-CCR9 antibodies for 1 hour at 4°C. After three washing steps with PBA, 400 nM CCL25 was added. Bound antibodies were detected with PE-labeled anti-human Fc antibody (Jackson ImmunoResearch 109-115- 098; 1 :500), while bound CCL25-moFc was detected with FITC-labeled anti-mouse Fc antibody (Dako F0479; 1 :200). Cells were analyzed using a Miltenyi MACS-Quant.

[0311] All anti-CCR9 antibodies bound to MOLT-4 cells (Fig. 7). None of the anti-CCR9 antibodies reduced binding of CCL25 to CCR9-expressing MOLT-4 cells (Fig. 7). Thus, the humanized anti-CCR9 antibodies do not interfere with ligand binding to CCR9.

[0312] Example 4

[0313] Epitope characterization

[0314] Human CCR9 extracellular peptides (shown in Table 5) were dissolved in PBS and diluted to a concentration of 1 mg / mL. However, N-terminal 2, ECL1 and ECL3 could not be dissolved either in PBS containing DMSO or modifying the pH of the buffer.

[0315] Table 5: Human CCR9 extracellular peptides.

[0316] Peptide inhibition using 100 pg / mL of peptide

[0317] Competition with peptides representing different regions of the N-terminal domain (N-terminal 1-6 from Table 5) of CCR9 was performed for initial epitope characterization. 1 pg / mL of antibody was pre- incubated with 100 pg / mL of each peptide for 1 hour at room temperature. As a control, 1 pg / mL of the antibody was incubated without peptide. After 1 hour, the pre-incubation was transferred to MOLT-4 cells and incubated for 1 hour at 4°C. Afterwards, the cells were washed with PBA. Bound antibodies were detected with a PE-labeled anti-human Fc antibody (Jackson ImmunoResearch 109-115-098; 1 :500) and cells were analyzed using a Miltenyi MACS-Quant. The binding of the anti-CCR9 antibodies was impeded by peptide N-terminal 1 and N-terminal 6 (Fig. 8). Both N-terminal peptides comprise the epitope (PNMADD (SEQ ID NO: 23)) of SRB1. N-terminal 3, 4, and 5 did not show any impact on the binding property of the humanized anti-CCR9 antibodies. Thus, all antibodies are targeting an epitope in N-terminal 6. Epitope mapping of C9Mab-16 and C9Mab-19 with alanine-substituted hCCR9 peptides To further characterize the binding epitope of C9Mab-16 and C9Mab-19, epitope mapping was performed using a 2 x Ala-scan method: 18 hCCR9 peptides, substituting two amino acid sequences with two alanine or glycine residues (Table 6).

[0318] After direct mutation of the N-terminal amino acid sequence of CCR9, C9Mab-16 does not exhibit reactions with P11A-N12A, N12A-M13A, M13A-A14G, D15A-D16A, and D16A-Y17A (Fig. 9A), and shows lower reactivity with I10A-P11A This indicates that Pro11 , Asn12, Met13, Asp15 and Asp16 are included in the critical epitope of C9Mab-16, whilst Ile10 plays an important role on antibody binding.

[0319] On the other hand, C9Mab-19 does not react with P11A-N12A, N12A-M13A, M13A-A14G, D15A-D16A, and D16A-Y17A (Fig. 9B), and showed lower reactivity with l10A-P11A and Y17A-G18A, indicating that Pro11 , Asn12, Met13, Asp 15, Asp16 are included in the critical epitope of C9Mab-19, while Ile10 and

[0320] Tyr17 are also involved in antibody binding.

[0321] Altogether, these results highlight the differences on the epitope showed by C9Mab-16 and C9Mab-19 as compared to 92R (murine version of SRB1) and C9Mab-1 (Takei et al. 2021 , Somovilla-Crespo et al. 2018). The Ala14 residue has been considered as a key amino acid for the binding of prior art including SRB1 and C9Mab1 whilst here we demonstrate that the Ala14 residue does not participate in the antibody binding of C9Mab-16 nor of C9Mab-19. Furthermore, lle10 seems to be involved in the epitope of C9Mab-16 and C9Mab-19 but does not appear to play a role in the epitope of SRB1.

[0322] Peptides Sequences

[0323] WT TDFTSPIPNMADDYGSEST (SEQ ID NO: 51 )

[0324] T4A-D5A AAFTSPIPNMADDYGSEST (SEQ ID NO: 52)

[0325] D5A-F6A TAATSPIPNMADDYGSEST (SEQ ID NO: 53)

[0326] F6A-T7A TDAASPIPNMADDYGSEST (SEQ ID NO: 54)

[0327] T7A-S8A TDFAAPIPNMADDYGSEST (SEQ ID NO: 55)

[0328] S8A-P9A TDFTAAIPNMADDYGSEST (SEQ ID NO: 56)

[0329] P9A-I10A TDFTSAAPNMADDYGSEST ( SEQ ID NO: 57)

[0330] I10A-P11A TDFTSPAANMADDYGSEST (SEQ ID NO: 58)

[0331] P11A-N12A TDFTSPIAAMADDYGSEST (SEQ ID NO: 59)

[0332] N12A-M13A TDFTSPIPAAADDYGSEST (SEQ ID NO: 60)

[0333] M13A-A14G TDFTSPIPNAGDDYGSEST (SEQ ID NO: 61)

[0334] A14G-D15A TDFTSPIPNMGADYGSEST (SEQ ID NO: 62)

[0335] D15A-D16A TDFTSPIPNMAAAYGSEST (SEQ ID NO: 63)

[0336] D16A-Y17A TDFTSPIPNMADAAGSEST (SEQ ID NO: 64)

[0337] Y17A-G18A TDFTSPIPNMADDAASEST (SEQ ID NO: 65)

[0338] G18A-S19A TDFTSPIPNMADDYAAEST (SEQ ID NO: 66)

[0339] S19A-E20A TDFTSPIPNMADDYGAAST (SEQ ID NO: 67)

[0340] E20A-S21A TDFTSPIPNMADDYGSAAT (SEQ ID NO: 68) S21A-T22A TDFTSPIPNMADDYGSEAA (SEQ ID NO: 69)

[0341] Table 6. The 2xalanine-substituted hCCR9 peptides.

[0342] Example 5

[0343] Internalization of humanized anti-CCR9 antibodies pHrodo-labeling of humanized anti-CCR9 antibodies

[0344] Humanized anti-CCR9 antibodies were labeled with fluorophore (pHrodo, Sigma P36600). 300 pg of antibody was dialyzed against 0.1 M NaHCOs (pH 8.4) at 4°C overnight. The following day, the antibodies were incubated with a 20-fold excess of pHrodo fluorophore for 1 hour at room temperature in the dark. Finally, free fluorophore was removed via dialysis against 1x PBS overnight. Proteins were analyzed via SDS-PAGE and using flow cytometry. The labeling process is known to have a certain impact on the binding capacity of antibodies. Therefore, after labeling the antibodies, the binding activity of every single batch of antibodies was confirmed by flow cytometry using CCR9-expressing MOLT-4 cells. This was achieved by incubating serial dilutions (1 :4 titrated) of the pHrodo-labeled anti-CCR9 antibodies with MOLT-4 cells for 1 hour at 4°C. Bound antibodies were detected with a PE-labeled anti-human Fc antibody (Jackson ImmunoResearch 109-115-098; 1 :500) and cells were analyzed using a Miltenyi MACS-Quant. Concentration-dependent binding of the anti-CCR9 antibodies to MOLT-4 cells was observed in all the experiments.

[0345] Internalization of pHrodo-labeled anti-CCR9 antibodies

[0346] The internalization of pHrodo-labeled antibodies into MOLT-4 cells was analyzed via flow cytometry, as pHrodo only shows fluorescence in acidic milieu, e.g., in the lysosome for internalized antibodies. MOLT- 4 cells were seeded (20,000 cells per well) and cultivated overnight at 37 °C. The following day, 100 nM pHrodo-labeled antibody was added and incubated either at 4°C or 37°C. After 5 minutes, 60 minutes, 6 hours, 24 hours, 48 hours, and 72 hours of incubation, cells were analyzed via flow cytometry using a Miltenyi MACS-Quant. In addition, a non-binding antibody was included in this assay (RBD-specific antibody CB6).

[0347] Binding of the pHrodo-labeled antibodies was analyzed by flow cytometry using CCR9-expressing MOLT- 4 cells. In this experiment, serial dilutions (1 :4 titrated) of the pHrodo-labeled anti-CCR9 antibodies were incubated with cells for 1 hour at 4°C. Bound antibodies were detected with a PE-labeled anti-human Fc antibody (Jackson ImmunoResearch 109-115-098; 1 :500) and cells were analyzed using a Miltenyi MACS-Quant (Fig. 10). Concentration-dependent binding of the anti-CCR9 antibodies to MOLT-4 cells was observed. Binding of pHrodo-labeled antibodies was reduced about 1- to 4-fold. Nevertheless, SRB1 still showed the strongest binding to MOLT-4 cells followed by huC9Mab16-VL2.

[0348] Table 7: EC5o values of pHrodo-labeled anti-CCR9 antibodies determined by flow cytometry using MOLT-4 cells. n=1.

[0349] The internalization of pHrodo-labeled antibodies into MOLT-4 cells was analyzed via flow cytometry. All anti-CCR9 antibodies showed effective and specific internalization, compared to CB6, which is the receptor binding domain of the human anti-SARS-CoV-2 spike protein, employed as a control of unspecific internalization which does not bind CCR9.

[0350] SRB1 exhibited the strongest internalization at 10 nM (Fig. 11). HuC9Mab16-VL2 showed similar internalization to SRB1 but better internalization than huC9Mab19-VL2.

[0351] The internalization of pHrodo-labeled antibodies into MOLT-4 cells was also analyzed regarding the times at which the internalization proportion is maximal. Normalization of the results showed that the peak of internalization is reached at 24 hours for all three antibodies (SRB1 , huC9Mab-16-VL2 and huC9Mab-19- VL2), and kinetic behaviour is similar for all molecules.

[0352] Example 6

[0353] Stability assay under thermal stress

[0354] Freeze-thaw analysis

[0355] Samples of anti-CCR9 antibodies were frozen at -80°C for up to one day and thawed on ice. A part of the sample was used for HPLC-SEC analysis (Waters 2695 Separations Module), while the rest was frozen again at -80°C. The process was repeated for 4 times without performing in between HPLC-SEC analysis. Only after 4 days, the thawed antibodies were analyzed using SEC-HPLC.

[0356] SRB1 , - huC9Mab16-VL1 , and huC9Mab19-VL2 displayed one major peak proving stability during freeze- thaw-cycles (Fig. 12). HuC9Mab16-VL2 obtained a high molecular weight of 5.6%, which might be attributed to formation of multimers. However, the corresponding control was missing for the timepoint before the first freeze-thaw-cycle was started. Thus, the aggregate may have already been present in the protein solution. HuC9Mab19-VL1 showed a low molecular weight of 30.81%, which might represent degradation products.

[0357] High temperature analysis The anti-CCR9 antibodies were diluted to 1 mg / mL and incubated at 23°C and 40°C for 4 days. As a control, diluted antibodies were also kept at 4°C for 4 days. The stability of these antibodies was analyzed via flow cytometry analysis using CCR9-expressing MOLT-4 cells. Serial dilutions (1:10 titrated) of the anti-CCR9 antibodies at 4°C, 23°C and 40°C were incubated with MOLT-4 cells for 1 hour at 4°C. Bound antibodies were detected with a PE-labeled anti-human Fc antibody (Jackson ImmunoResearch 109-115- 098; 1 :500) and cells were analyzed using a Miltenyi MACS-Quant.

[0358] Binding of SRB1 to MOLT-4 cells was not affected upon incubation at higher temperatures (Fig. 13). Similarly, huC9Mab16-VL1, huC9Mab16-VL2, huC9Mab19-VL1, and huC9Mab19-VL2 showed no variations in binding under elevated temperatures.

[0359] Table 8: EC5o values of humanized anti-CCR9 antibodies after being incubated at 23°C and 40°C for 4 days. Antibodies kept at 4°C were used as a control.

[0360] Dynamic light scattering (DLS)

[0361] The melting (aggregation) point of antibodies was determined by measuring the thermal denaturation using dynamic light scattering (DLS) with ZetaSizer Nano ZS (Malvern). 1 mg / mL antibody was diluted in 1x PBS to a total volume of 1 mL. Dynamic laser light scattering (mean count rate) was measured while the temperature was increased in 1°C intervals from 35°C to 80°C with 2 minutes equilibration time for each temperature step. The aggregation point of the antibodies was defined as the temperature at which the mean count rate was increased.

[0362] The melting point of SRB1 was determined at 64°C (Fig. 14). HuC9Mab16-VL1 , huC9Mab16-VL2, huC9Mab19-VL1 , and huC9Mab19-VL2 achieved similar aggregation points between 61 °C and 67°C. Example 7

[0363] Stability assay under pH stress

[0364] The pH stability of the anti-CCR9 antibodies was analyzed at pH 5 and pH 8.5. The antibodies were dialyzed overnight in 100 mM sodium acetate (with 150 mM NaCI) at pH 5 and in 100 mM Tris-HCI (with 150 mM NaCI) at pH 8.5. The following day, the concentration of the antibodies was measured, and the antibodies were incubated for 7 days at 40°C. After 7 days, binding of the antibody samples was analyzed via flow cytometry analysis using CCR9-expressing MOLT-4 cells. No centrifugation step was applied. Serial dilutions (1 :10 titrated) of the anti-CCR9 antibodies at pH 5 or pH 8.5 were incubated with MOLT-4 cells for 1 hour at 4°C. Bound antibodies were detected with a PE-labeled anti-human Fc antibody (Jackson ImmunoResearch 109-115-098; 1 :500) and cells were analyzed using a Miltenyi MACS-Quant.

[0365] Binding of the VL1 versions of the anti-CCR9 antibodies was affected at pH 5 as well as at pH 8.5 (Fig. 15). Notably, the efficacy of these antibodies was reduced. SRB1 showed similar binding at pH 8.5 as its control, while pH 5 resulted in reduced potency. In contrast, huC9Mab16-VL2 and huC9Mab19-VL2 remained unaffected by the altered pH, and did not show reduced binding at either pH 5 or pH8.

[0366] Example 8

[0367] In vitro serum stability

[0368] Anti-CCR9 antibodies were diluted to a final concentration of 100 nM in 50% human plasma. The samples were either directly stored at -20°C (day 0) or incubated at 37°C for 1 day, 3 days, and 7 days prior to storage at -20°C. Then, stability in human plasma was determined via flow cytometry analysis using CCR9-expressing MOLT-4 cells. Serial dilutions (1 :10 titrated) of the serum-exposed anti-CCR9 antibodies were incubated with MOLT-4 cells for 1 hour at 4°C. Bound antibodies were detected with a PE-labeled anti-human Fc antibody (Jackson ImmunoResearch 109-115-098; 1 :500) and cells were analyzed using a Miltenyi MACS-Quant.

[0369] SRB1 did not show any differences between the incubation periods, suggesting stability of SRB1 upon human serum incubation (Fig. 16). Similarly, huC9Mab16-VL2 displayed similar binding behavior between the incubation periods with human serum. The potency seemed to be reduced after more than 1 day of incubation for huC9Mab19-VL2. Also, the efficacy of huC9Mab16-VL1 was already decreased after 1 day of incubation with human serum. After 3 days of incubation with human serum, the efficacy of huC9Mab19-VL1 was impeded. Thus, SRB1 , and huC9Mab16-VL2 seem to be stable over 7 days of human serum incubation.

[0370] Example 9

[0371] ADCC analysis MOLT-4 cells were used for the ADCC analysis of the anti-CCR9 antibodies. The MOLT-4 cells were firstly stained with CFSE (CellTrace™ CFSE Cell Proliferation Kit; Thermo Fischer) and then 2 x 104cells were seeded to grow overnight. In addition, PBMCs from two donors (HN#1 (Fig. 17A), HN#2 (Fig. 17B)) were thawed and cultivated overnight. The following day, the PBMCs were stained with different antibodies to determine the proportion of NK cells. Cells were incubated with anti-huCD3-PE, anti- huCD56-APC and the isotype controls anti-mouselgG1-APC and anti-mouselgG2-PE. Fluorescence signals were detected using the MACSQuant® Analyzer and the proportion of NK cells was determined (HN#1 : 12%; HN#2: 3.6%).

[0372] The CFSE-stained MOLT-4 cells were incubated for 15 min with a titration (1 :10) of the anti-CCR9 antibodies. Then, PBMCs were added on top to reach a concentration of 2 x 104NK cells per well (equals target-to-effector ratio 1 :1 ). Control samples included wells with the highest concentration of antibodies but no PBMCs, wells with PBMCs only and wells including neither antibodies nor PBMCs. After incubating the plates for 24 hours, the cells were washed and resuspended in PBA containing PI. After 10 min of incubation in the dark, the viability of the CFSE-labeled MOLT-4 cells was determined by flow cytometry. For representation of data as specific lysis, all values were normalized to the control wells containing CFSE-stained MOLT-4 and PBMCs.

[0373] All anti-CCR9 antibodies mediated specific lysis of MOLT4 cells in a concentration-dependent manner (Fig. 17). HuC9Mab19-VL2 showed highest cytotoxicity at 10 nM followed by SRB1 , huC9Mab16-VL2 and huC9Mab19-VL1. SRB1 and huC9Mab16-VL2 reached the best cytotoxicity at lower concentrations.

[0374] Table 9: EC50 values of humanized anti-CCR9 antibodies representing the cytotoxicity determined by flow cytometry using CFSE-stained MOLT-4 cells as well as two different PBMC batches.

[0375] Example 10

[0376] Pharmacokinetic study of the anti-CCR9 antibodies Mice were given an intravenous injection of 1 mg / kg or 10 mg / kg of huC9Mab16-VL2, huC9Mab19-VL2 or SRB1 (six mice per group were employed). After 3 minutes, 1 hour, 6 hours, 24 hours, 72 hours and 168 hours blood samples were taken from the tail vein.

[0377] Samples were incubated on ice, clotted blood was centrifuged, and serum samples were stored at 4°C. IgG serum concentration was analyzed by ELISA using a biotinylated peptide corresponding to the human CCR9 extracellular N-terminal region (TPTDFTSPIPNMADDYGSESTSS, SEQ ID NO: 22).

[0378] Antibody detection was performed with an anti-human Fc antibody. Terminal half-life (t1 / 2beta), clearance (Cl), area under the curve (AUC) and steady-state volume of distribution (Vss) were determined (Table 10). The pharmacokinetic parameters were calculated with the Excel-Add-ln PKSolver version 2.0 (Zhang et al., 2010) using the setting intravenous bolus injection (2 compartments).

[0379] All three antibodies showed a dose-dependent pharmacokinetic profile (Fig. 18). For 1 mg / kg, huC9Mab19-VL2 appeared to retain the highest antibody concentration, while SRB1 and huC9Mab16- VL2 showed a similar behavior (Fig. 18A). At 10 mg / kg, SRB1 showed the fastest elimination in comparison to huC9Mab16-VL2 and huC9Mab19-VL2 (Fig. 18B and Table 10).

[0380] Table 10: Pharmacokinetic parameters of huC9Mab16-VL2, huC9Mab19-VL2 and SRB1.

[0381] Example 11

[0382] Affinity measurement of anti-CCR9 antibodies

[0383] Affinity measurements of antibodies huC9Mab16-VL2, huC9Mab19-VL2 and SRB1 were performed by Octet technology. The antibodies were immobilized on the sensors by Protein A. A complex of the biotinylated peptide (N-terminal peptide of the extracellular domain of CCR9) was serially diluted and monomeric streptavidin was added to the sensor. Measurements were taken and analysis was performed (data not shown).

[0384] Kinetic constants were calculated for huC9Mab16-VL2 and huC9Mab19-VL2 (Table 12). The magnitude of response was lower for huC9Mab19-VL2, as was the KD. A very fast on / off-rate was observed for SRB1 , which could not be accurately modelled.

[0385] Table 12. Kinetic parameters of huC9Mab16-VL2, huC9Mab19-VL2 and SRB1.

[0386] Example 12

[0387] Anti-CCR9 antibodies for use in treatment of inflammatory bowel disease (IBD)

[0388] CCR9 plays a central role in inflammatory bowel disease (IBD) by controlling the selective migration of lymphocytes into the intestinal tract. Given their mechanism of action, huC9Mab16-VL2 and SRB1 anti- CCR9 antibodies were tested for their ADCC activity in depleting CCR9+T cells.

[0389] This activity was tested both in blood samples (Figs. 19 and 20) and intestinal explants from human IBD patients (Fig. 21). Intestinal explants obtained during endoscopy were cultured in RPMI medium and incubated with SRB1 , huC9Mab16-VL2 or isotype at 10 pg / ml for 24 hours for 16 hours. After this incubation, cells were stained and analyzed by flow cytometry to determine the presence of CD4+CCR9+T cells.

[0390] Processing of the blood samples included erythrocyte lysis and leukocyte isolation. Cells were cultured in RPMI medium and treated with SRB1 , huC9Mab16-VL2 or isotype at 10 pg / ml for 24 hours. After this incubation, cells were stained and analyzed by flow cytometry to characterize the different T cell populations: CD3, CD4 and CCR9 markers were employed.

[0391] Both huC9Mab-16 VL2 and SRB1 showed activity depleting CCR9+CD4+cells in patients’ samples without affecting the total count of immune cells. huC9Mab-16 VL2 was especially efficacious. Therefore, these antibodies have potential for the treatment of IBD.

[0392] Example 13 Therapeutic potential of CCR9 in Rheumatoid (RA) and Psoriatic Arthritis (PsA)

[0393] Trafficking of CD4+ T cells and their inflammatory mediators into joints contributes to the initiation, propagation, and maintenance of synovial inflammation. Due to the clear role of CCR9 in the migration process of lymphocytes, experiments were conducted to evaluate if T cells in blood and synovial fluid of patients with rheumatoid arthritis (RA) and psoriatic arthritis (PsA) had increased expression of CCR9 and could be a potential target for the treatment with the anti-CCR9 antibody huC9Mab16-VL2. In the study, we also included blood samples from patients with other inflammatory diseases like Systemic Lupus Erythematosus (SLE) and Systemic Sclerosis (SSc).

[0394] Leukocytes were isolated from blood of patients with RA, PsA, SLE and SSc; the same process was also carried out with synovial fluid samples from PsA patients. Then cells were fixed and analyzed by flow cytometry to determine the presence of CCR9+cells.

[0395] As shown in Fig. 22, effector CD4+T cells have a higher percentage of CCR9 expression in blood from patients with RA and PsA compared to control patients. Central memory CD4+T cells also showed some overexpression of CCR9 compared to control samples. In SLE and SSc samples there is also a higher CCR9 MFI value compared to control levels.

[0396] Cytometry analysis of isolated leucocytes from synovial fluid also showed overexpression of CCR9 in effector and central memory CD4+ T cells in PsA patients compared to osteoarthritis control samples (Fig. 23).

[0397] These results highlight the possible role of CCR9 in the pathogenesis of both RA and PsA and its potential role as a therapeutic target for these inflammatory indications.

[0398] Example 14

[0399] Anti-CCR9 ADC development: MMAE conjugate huC9Mab16-VL2 was transiently produced in CHO K1 cells. Cells were transfected with a plasmid containing the corresponding sequence, and the product of transfection was purified by affinity chromatography and size exclusion chromatography (SEC). The antibody was analyzed by SDS-PAGE and SEC-HPCL which confirmed a 100% purity and a final yield of 543 mg / L.

[0400] The purified antibody was subsequently subjected to a conjugation process in order to generate the corresponding antibody-drug conjugate (ADC) with Monomethyl auristatin E (MMAE) with a valinecitrulline linker (Fig. 24). Small scale conjugations were performed in order to optimize the reaction conditions and conjugation efficiency. Finally, a final conjugation was performed using 2.3 equivalents of TCEP as reducing agent at 22°C for 16 hours. The reduced antibody (huC9Mab16-VL2) was incubated with 8 equivalents of vc-MMAE at 22°C for 1 h. Then the crude conjugation was buffer exchanged into 20 mM H istidine / H istidine-HCI with 8% sucrose, pH 5.5. The generated ADC was subjected to a quality control including SEC-HPLC and hydrophobic interaction chromatography (HIC) for DAR (drug-antibody ratio) analysis. huC9Mab16-VL2-MMAE showed a 100% monomer in the SEC-HPLC analysis, having less than 0.20% of free drug and a DAR of 3.71.

[0401] In addition, the ADC was subjected to a stability study including 5 cycles of freeze / thaw and a thermal study at 40°C for up to 2 weeks of incubation. SEC purity and DAR were analyzed. Freeze / thaw stress did not result in any significant change in concentration, DAR or purity for the ADC. Thermal stress at 40°C did not result in a significant change in concentrations but caused a slight decrease in DAR and purity (Table 13).

[0402] Table 13. Stability and thermal study of huC9Mab16-VL2-MMAE.

[0403] Example 15

[0404] Anti-CCR9 ADC development: Deruxtecan (DXd) conjugate huC9Mab16-VL2 was transiently produced in CHO K1 cells. Cells were transfected with a plasmid containing the corresponding sequence, and the product of transfection was purified by affinity chromatography and size exclusion chromatography (SEC). Similarly to the first ADC development, antibody was analyzed by SDS-PAGE and SEC-HPCL showing more than 99% purity and a final yield of 480 mg / L.

[0405] The purified antibody was subsequently subjected to a conjugation process in order to generate the corresponding antibody-drug conjugate (ADC) with deruxtecan (DXd) (Fig. 25). Small scale conjugations were performed in order to optimize the reaction conditions and conjugation efficiency. Finally, a final conjugation was performed using 8 equivalents of TCEP as reducing agent at 22°C for 16 hours. Then the reduced antibody (huC9Mab16-VL2) was incubated with 12 equivalents of deruxtecan at 22°C for 1h. Then the crude conjugation was buffer exchanged into 20 mM H istidine / H istidine-H Cl with 8% sucrose, pH 5.5. The generated ADC was subjected to a quality control including SEC-HPLC and Hydrophobic interaction chromatography (HIC) for DAR (drug-antibody ratio) analysis. huC9Mab16-VL2-DXd showed more than 99% monomer formation in the SEC-HPLC analysis, having less than 0.20% of free drug and a DAR of 8.

[0406] In addition, the ADC was subjected to a stability study including 5 cycles of freeze / thaw and a thermal study at 40°C for up to 2 weeks of incubation. SEC purity and DAR were analyzed. Freeze / thaw stress did not result in any significant change in concentrations, DAR or purity for the ADC. In addition, thermal stress at 40°C did not result in a significant change in concentrations or DAR for the ADC (Table 14).

[0407] Table 14. Stability and thermal study of huC9Mab16-DXd and SRB1-DXd. ADCs were subjected to 5 freeze / thaw cycles and up to 2 weeks incubation at 40°C. Purity, DAR and concentration were evaluated.

[0408] Example 16

[0409] Characterization of ADCs

[0410] The anti-CCR9 ADCs developed in Examples 14 and 15 (huC9Mab16-VL2-DXd (SRB312) and huC9Mab16-VL2-MMAE (SRB301)) were characterized in terms of their binding, internalization and cytotoxicity.

[0411] In vitro binding of the anti-CCR9 ADCs and their parental antibody (huC9Mab16-VL2, named as SRB3) was analyzed by flow cytometry using CCR9-expressing MOLT-4 cells. Bound ADCs were detected with a PE-labeled anti-human Fc antibody and analyzed (Fig. 26).

[0412] Concentration-dependent binding of all molecules to MOLT-4 cells was observed. ECso values of the different anti-CCR9 ADCs to the cell line are listed in Table 15. ADCs showed similar cell binding behaviour towards MOLT-4 cells as the parental antibody huC9Mab16-VL2 (SRB3) (Table 15).

[0413] Table 15. EC50 values of anti-CCR9 ADCs.

[0414] Cytotoxicity of the generated ADCs was studied in MOLT-4 cells in a MTT assay. Cells were seeded and incubated with titrated ADCs. MTT was added to the cells and incubated, lysis buffer was included and incubated, and formazan formation was determined by measuring the absorption at 595 nm with reference wavelength 655 nm in the plate reader (Fig. 27). IC50 of the ADCs was in the nanomolar range (Table 16).

[0415] Table 16. IC50 values of anti-CCR9 ADCs.

[0416] Next, the cytotoxicity of the generated ADCs (both SRB312 and SRB301 ) was compared to the parental antibody (SRB3), the corresponding linker-payload (DXd or vc-MMAE) alone, and a mixture of the parental antibody and the linker-payload (mixed as separate components, rather than forming an ADC). The cytotoxicity was studied in MOLT-4 cells in a MTT assay. Cells were seeded and incubated with titrated ADCs, antibody and linker-payloads. Antibodies were prepared at a starting concentration of 400 nM, while payload-linkers were prepared at a starting concentration of 1200 nM. For the mixture of antibodies + linker-payloads, linker-payloads were titrated (1 :4) and mixed with SRB3 at a fixed final concentration of 400 nM. Titrated antibodies or linker-payloads were added to the cells and incubated for 72 h at 37°C. Then, the MTT assay was performed to evaluate cell viability as previously described (Fig. 28A and B).

[0417] The IC50 of both ADCs was in the nanomolar range, as previously studied (Table 16). In addition, the potency of both SRB312 and SRB301 was superior to the payload-linker alone and to the mixture of SRB3 and the payload-linker (Table 17).

[0418] Table 17. Comparison of IC50 values of SRB312, SRB3, DXd, SRB301 and vc-MMAE.

[0419] Example 17

[0420] In vivo efficacy of anti-CCR9 ADCs

[0421] The anti-CCR9 ADCs SRB312 and SRB301 were next characterized in terms of their antitumour activity in a patient-derived xenograft (PDX) model of ovarian cancer in immunocompromised mice (Athymic Nude NU(Ncr)-Foxnl nu).

[0422] A total of 4 groups of 8 mice each (Table 18) were included in the study design: a control group treated with the vehicle, one with the clinical standard of care (carboplatin + paclitaxel), SRB301 and SRB312. All treatment compounds were administered intravenously. Doses and timing for each treatment are also included in Table 18. “Q7 Dx4” means one every seventh day four times.

[0423] Table 18. Treatment groups of the PDX model.

[0424] The tumour selected was a serous ovarian cancer tumour expressing CCR9. Animals were implanted with the tumour. Once the average tumour volume reached 150 mm3, mice were randomized across the four treatment groups based on tumour volume and treatment started.

[0425] Tumour volume was monitored 2 times per week. On day 55 after the first dose, the control group showed a tumour volume mean of 1062 ± 115 mm3, SRB301 838 ± 293 mm3, SRB312 162 ± 43 mm3, and the standard of care group 200± 50 mm3(Fig. 29A). SRB312 showed antitumour efficacy, with a significant difference in tumour growth in relation to the vehicle group (p<0.001) (Fig. 29A) and a tumour growth inhibition rate (%TGI) of 100. The tumour volumes of individual animals are shown in Fig. 30.

[0426] Body weight was also monitored 2 times per week, up to day 55 (Fig. 29B). Treatment with anti-CCR9 ADCs did not have any significant impact on the body weight of the mice.

[0427] Example 18

[0428] Comparison of anti-CCR9 antibodies to those of WO 2022 / 195028

[0429] It was decided to compare the anti-CCR9 antibodies of the present application (specifically huC9Mab16- VL2, otherwise referred to as SRB3 and huC9Mab19-VL2) to antibodies disclosed in WO 2022 / 195028. In particular, SRB3 and huC9Mab19-VL2 were compared to the antibodies AB243LO326 and AB102105 from WO 2022 / 195028. AB243LO326 competes with binding between CCR9 and CCL25, whereas AB102105 does not. AB243LO326 has a variable heavy chain comprising SEQ ID NO:87, and a variable light chain comprising SEQ ID NO: 88. AB102105 has a variable heavy chain comprising SEQ ID NO: 89 and a variable light chain comprising SEQ ID NO: 90.

[0430] The fragment antigen-binding region (Fab region) of huC9Mab16-VL2, huC9Mab19-VL2, AB102105 (Fab AZ105) and AB243LO326 (Fab AZ326) were successfully produced using HEK293-6E cells and purified using CH1-Capture Select. After purification, antibodies were analyzed by SDS-PAGE using reducing or non-reducing conditions and by size-exclusion chromatography.

[0431] Binding of the Fab molecules huC9Mab16-VL2, huC9Mab19-VL2, AZ105 and AZ326 was analyzed by flow cytometry using CCR9-expressing MOLT-4 cells. In this experiment, serial dilutions of the different anti-CCR9 molecules were incubated with cells for 1 hour at 4°C. Bound Fab molecules were detected with a PE-labeled anti-human Fc antibody and binding was analyzed. All Fabs bound to MOLT-4 cells in a concentration-dependent manner (Fig. 31). EC50 values for the antibodies are shown in Table 19.

[0432] Table 19. EC50 values of anti-CCR9 Fab molecules determined by flow cytometry using MOLT-4 cells.

[0433] Finally, a comparison of the CDR sequences of SRB3 with those of AB243LO0326 and AB1020105 from WO 2022 / 195028, as well as SRB1 and SRB10, was carried out (Fig. 32). Numbering and CDR definitions were according to Kabat. All CDRs except for CDRL2 of SRB3 differ from those of AB243LO0326 and AB1020105. The CDRH sequences of SRB3, in particular, differ substantially from the CDRH sequences of AB243LO0326 and AB1020105..

[0434] SRB10-VH comprises SEQ ID NO: 71. SRB10-VL comprises SEQ ID NO:77. SRB1-VH comprises SEQ ID NO: 70. SRB1-VL comprises SEQ ID NO: 76. SRB3-VH comprises SEQ ID NO: 18. SRB3-VL comprises SEQ ID NO: 1. AZ-326-VH comprises SEQ ID NO: 87. AZ-326-VL comprises SEQ ID NO: 88. AZ-105-VH comprises SEQ ID NO: 89. AZ-105-VL comprises SEQ ID NO: 90.

[0435] References

[0436] A number of publications are cited above in order to more fully describe and disclose the invention and the state of the art to which the invention pertains. Full citations for these references are provided below. The entirety of each of these references is incorporated herein.

[0437] Abhinandan KR, Martin AC. Analyzing the "degree of humanness" of antibody sequences. J Mol Biol. 2007 Jun 8;369(3):852-62. doi: 10.1016 / j.jmb.2007.02.100. Epub 2007 Mar 14. PMID: 17442342.

[0438] Armour, K. L., Clark, M. R., Hadley, A. G., Williamson, L. M., Eur. Recombinant human IgG molecules lacking Fcgamma receptor I binding and monocyte triggering activities. J. Immunol. (1999) 29(8):2613-24. PMID: 10458776.

[0439] Bachelerie, F., A. Ben-Baruch, A. M. Burkhardt, C. Combadiere, J. M. Farber, G. J. Graham, R. Horuk, A. H. Sparre-Ulrich, M. Locati, A. D. Luster, A. Mantovani, K. Matsushima, P. M. Murphy, R. Nibbs, H.

[0440] Nomiyama, C. A. Power, A. E. Proudfoot, M. M. Rosenkilde, A. Rot, S. Sozzani, M. Thelen, O. Yoshie and A. Zlotnik (2014). "International Union of Basic and Clinical Pharmacology, [corrected]. LXXXIX. Update on the extended family of chemokine receptors and introducing a new nomenclature for atypical chemokine receptors." Pharmacol Rev 66(1): 1-79.

[0441] Carramolino, L., A. Zaballos, L. Kremer, R. Villares, P. Martin, C. Ardavin, A. C. Martinez and G. Marquez (2001). "Expression of CCR9 beta-chemokine receptor is modulated in thymocyte differentiation and is selectively maintained in CD8(+) T cells from secondary lymphoid organs." Blood 97(4): 850-857.

[0442] Carter P. (2001) Bispecific human IgG by design. J Immunol Methods. 248(1-2):7-15. Choi, HJ., Kim, YJ., Lee, S. Kim, YS., A heterodimeric Fc-based bispecific antibody simultaneously targeting VEGFR-2 and Met exhibits potent antitumor activity. Mol Cancer Ther (2013) 12(12):2748-59. PMID: 24132142.

[0443] Davis, J. H., Aperlo, C., Li, Y., Kurosawa, E., Lan, Y., Lo, KM., Huston, J. S., SEEDbodies: fusion proteins based on strand-exchange engineered domain (SEED) CH3 heterodimers in an Fc analogue platform for asymmetric binders or immunofusions and bispecific antibodies. Protein Eng Des Sei (2010) 23(4):195- 202. PMID: 20299542.

[0444] DeVries, M. E., A. A. Kelvin, L. Xu, L. Ran, J. Robinson and D. J. Kelvin (2006). "Defining the origins and evolution of the chemokine / chemokine receptor system." J Immunol 176(1): 401-415.

[0445] Ha, JH., Kim, JE., Kim, YS. Immunoglobulin Fc Heterodimer Platform Technology: From design to Applications in Therapeutic Antibodies and Proteins. Front. Immunol (2016) 7:394. PMID: 27766096.

[0446] Hale, G., De Vos, J., Davy, A. D., Sandra, K., Wilkinson, I. Systemiatic analysis of Fc mutations designed to reduce binding to Fc-gamma receptors. mAbs (2024), 16(1):2402701. PMID: 39279104.

[0447] Hearty, S., Leonard, P., O’Kennedy, R. Measuring antibody-antigen binding kinetics using surface plasmon resonance. Methods Mol Biol (2012) 907:411-442. PMID: 22907366.

[0448] Hu, Y., L. Zhang, R. Wu, R. Han, Y. Jia, Z. Jiang, M. Cheng, J. Gan, X. Tao and Q. Zhang (2011). "Specific killing of CCR9 high-expressing acute T lymphocytic leukemia cells by CCL25 fused with PE38 toxin." Leuk Res 35(9): 1254-1260.

[0449] Jedema I., van der Werff., N. M., Barge, R. M. Y., Willemze, R., Falkenburg, J. H. F. New CSFE-based assay to determine susceptibility to lysis by cytotoxic T cells of leukemic precursor cells within a heterogenous target cell population. Blood (2004) 103: 2677-82.

[0450] Johnson-Holiday, C., R. Singh, E. Johnson, S. Singh, C. R. Stockard, W. E. Grizzle and J. W. Lillard, Jr. (2011). "CCL25 mediates migration, invasion and matrix metalloproteinase expression by breast cancer cells in a CCR9-dependent fashion." Int J Oncol 38(5): 1279-1285.

[0451] Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed., Described in Public Health Service, National Institutes of Health, Bethesda, MD, 1991.

[0452] Kamen, L., Muneni, S., Langsdorf, C., Kho, E., Ordonia, B., Thakurta, T., Zheng, K., Song, A., Chung, S. A novel method for determining antibody-dependent cellular phagocytosis. J Immunol (2019) 468:55-60. PMID: 30880262.

[0453] Kunkel, E. J., J. J. Campbell, G. Haraldsen, J. Pan, J. Boisvert, A. I. Roberts, E. C. Ebert, M. A. Vierra, S. B. Goodman, M. C. Genovese, A. J. Wardlaw, H. B. Greenberg, C. M. Parker, E. C. Butcher, D. P.

[0454] Andrew and W. W. Agace (2000). "Lymphocyte CC chemokine receptor 9 and epithelial thymus- expressed chemokine (TECK) expression distinguish the small intestinal immune compartment: Epithelial expression of tissue-specific chemokines as an organizing principle in regional immunity." J Exp Med 192(5): 761-768. Labrijn AF, Meesters JI, de Goeij BE, van den Bremer ET, Neijssen J, van Kampen MD, Strumane K, Verploegen S, Kundu A, Gramer MJ, van Berkel PH, van de Winkel JG, Schuurman J, Parren PW. Efficient generation of stable bispecific IgG 1 by controlled Fab-arm exchange. Proc Natl Acad Sci U S A. 2013 Mar 26;110(13):5145-50. doi: 10.1073 / pnas.1220145110. Epub 2013 Mar 11. PMID: 23479652.

[0455] Lad L, Clancy S, Kovalenko M, Liu C, Hui T, Smith V, Pagratis N. High-throughput kinetic screening of hybridomas to identify high-affinity antibodies using bio-layer interferometry. J Biomol Screen. 2015 Apr;20(4):498-507. doi: 10.1177 / 1087057114560123. Epub 2014 Nov 25. PMID: 25425568.

[0456] Lazar, G et al., (2006) Engineered antibody Fc variants with enhanced effector function, Proc. Natl. Acad. Sci. U.S.A. 103 (11) 4005-4010, https: / / doi.org / 10.1073 / pnas.0508123103.

[0457] Lazennec, G. and A. Richmond (2010). "Chemokines and chemokine receptors: new insights into cancer- related inflammation." Trends Mol Med 16(3): 133-144.

[0458] Leaver-Fay A, Froning KJ, Atwell S, Aldaz H, Pustilnik A, Lu F, et al. Computationally designed bispecific antibodies using negative state repertoires. Structure (2016) 24(4):641-51. doi: 10.1016 / j.str.2O16.02.013

[0459] Mirandola, L., M. Chiriva-lnternati, D. Montagna, F. Locatelli, M. Zecca, M. Ranzani, A. Basile, M. Locati, E. Cobos, W. M. Kast, R. Asselta, E. M. Paraboschi, P. Comi and R. Chiaramonte (2012). "Notchl regulates chemotaxis and proliferation by controlling the CC-chemokine receptors 5 and 9 in T cell acute lymphoblastic leukaemia." J Pathol 226(5): 713-722.

[0460] Moore GL, Bautista C, Pong E, Nguyen DH, Jacinto J, Eivazi A, Muchhal US, Karki S, Chu SY, Lazar GA. A novel bispecific antibody format enables simultaneous bivalent and monovalent co-engagement of distinct target antigens. MAbs. 2011 Nov-Dec;3(6):546-57. doi: 10.4161 / mabs.3.6.18123. Epub 2011 Nov 1. PMID: 22123055.

[0461] Mukaida, N. and T. Baba (2012). "Chemokines in tumor development and progression." Exp Cell Res 318(2): 95-102.

[0462] Pathak, M; Lal, G. 2020. The Regulatory Function of CCR9(+) Dendritic Cells in Inflammation and Autoimmunity. Front. Immunol. 11. 1-8.

[0463] Qiuping, Z., et al., Selectively increased expression and functions of chemokine receptor CCR9 on CD4+ T cells from patients with T-cell lineage acute lymphocytic leukemia. Cancer Res, 2003. 63(19): p. 6469- 77.

[0464] Raman, D., T. Sobolik-Delmaire and A. Richmond (2011). "Chemokines in health and disease." Exp Cell Res 317(5): 575-589.

[0465] Sarvaiya, P. J., D. Guo, I. Ulasov, P. Gabikian and M. S. Lesniak (2013). "Chemokines in tumor progression and metastasis." Oncotarget 4(12): 2171-2185.

[0466] Sharma, P. K., R. Singh, K. R. Novakovic, J. W. Eaton, W. E. Grizzle and S. Singh (2010). "CCR9 mediates PI3K / AKT-dependent antiapoptotic signals in prostate cancer cells and inhibition of CCR9- CCL25 interaction enhances the cytotoxic effects of etoposide." Int J Cancer 127(9): 2020-2030. Schlothauer T, Herter S, Koller CF, Grau-Richards S, Steinhart V, Spick C, Kubbies M, Klein C, Umana P, Mbssner E. Novel human lgG1 and lgG4 Fc-engineered antibodies with completely abolished immune effector functions. Protein Eng Des Sei. 2016 Oct;29(10):457-466. doi: 10.1093 / protein / gzw040. Epub 2016 Aug 29. PMID: 27578889.

[0467] Strop P, Ho WH, Boustany LM, Abdiche YN, Lindquist KC, Farias SE, Rickert M, Appah CT, Pascua E, Radcliffe T, Sutton J, Chaparro-Riggers J, Chen W, Casas MG, Chin SM, Wong OK, Liu SH, Vergara G, Shelton D, Rajpal A, Pons J. Generating bispecific human lgG1 and lgG2 antibodies from any antibody pair. J Mol Biol. 2012 Jul 13;420(3):204-19. doi: 10.1016 / j.jmb.2012.04.020. Epub 2012 Apr 25. PMID: 22543237.

[0468] Takei, J., et al., Epitope Mapping of an Anti-Human CCR9 Monoclonal Antibody (C9Mab-1) Using Enzyme-Linked Immunosorbent Assay. Monoclon Antib Immunodiagn Immunother, 2021. 40(6): p. 239- 242.

[0469] Somovilla-Crespo, B., et al., 92R Monoclonal Antibody Inhibits Human CCR9(+) Leukemia Cells Growth in NSG Mice Xenografts. Front Immunol, 2018. 9: p. 77.

[0470] Trivedi, P. J., & Adams, D. H. (2018). Chemokines and Chemokine Receptors as Therapeutic Targets in Inflammatory Bowel Disease; Pitfalls and Promise. Journal of Crohn's & colitis, 72(suppl_2), S641-S652. https: / / doi.org / 10.1093 / ecco-jcc / jjx145

[0471] Tu, Z., R. Xiao, J. Xiong, K. M. Tembo, X. Deng, M. Xiong, P. Liu, M. Wang and Q. Zhang (2016). "CCR9 in cancer: oncogenic role and therapeutic targeting." J Hematol Oncol 9: 10.

[0472] Weitzenfeld, P. and A. Ben-Baruch (2014). "The chemokine system, and its CCR5 and CXCR4 receptors, as potential targets for personalized therapy in cancer." Cancer Lett 352(1): 36-53.

[0473] Wendland, M., N. Czeloth, N. Mach, B. Malissen, E. Kremmer, O. Pabst and R. Forster (2007). "CCR9 is a homing receptor for plasmacytoid dendritic cells to the small intestine." Proc Natl Acad Sci U S A 104(15): 6347-6352.

[0474] Wu, W., et al., Strong expression of chemokine receptor CCR9 in diffuse large B-cell lymphoma and follicular lymphoma strongly correlates with gastrointestinal involvement. Hum Pathol, 2014. 45(7): p. 1451-8.

[0475] Wu, X., Sun, M., Yang, Z„ Lu, C., Wang, Q„ Wang, H., Deng, C., Liu, Y„ & Yang, Y. (2021). The Roles of CCR9 / CCL25 in Inflammation and Inflammation-Associated Diseases. Frontiers in cell and developmental biology, 9, 686548.

[0476] Wurbel, M. A., B. Malissen and J. J. Campbell (2006). "Complex regulation of CCR9 at multiple discrete stages of T cell development." Eur J Immunol 36(1): 73-81.

[0477] Yamashita, M., Kitano, S., Aikawa, H. et al. A novel method for evaluating antibody-dependent cell- mediated cytotoxicity by flowcytometry using cryopreserved human peripheral blood mononuclear cells. Sci Rep 6, 19772 (2016). https: / / doi.org / 10.1038 / srep19772 Youn, B. S., C. H. Kim, F. O. Smith and H. E. Broxmeyer (1999). "TECK, an efficacious chemoattractant for human thymocytes, uses GPR-9-6 / CCR9 as a specific receptor." Blood 94(7): 2533-2536.

[0478] Zaballos, A., J. Gutierrez, R. Varona, C. Ardavin and G. Marquez (1999). "Cutting edge: identification of the orphan chemokine receptor GPR-9-6 as CCR9, the receptor for the chemokine TECK." J Immunol 162(10): 5671-5675.

[0479] Zabel, B. A., W. W. Agace, J. J. Campbell, H. M. Heath, D. Parent, A. I. Roberts, E. C. Ebert, N. Kassam, S. Qin, M. Zovko, G. J. LaRosa, L. L. Yang, D. Soler, E. C. Butcher, P. D. Ponath, C. M. Parker and D. P. Andrew (1999). "Human G protein-coupled receptor GPR-9-6 / CC chemokine receptor 9 is selectively expressed on intestinal homing T lymphocytes, mucosal lymphocytes, and thymocytes and is required for thymus-expressed chemokine-mediated chemotaxis." J Exp Med 190(9): 1241-1256.

[0480] Zhang, Y., Huo, M., Zhou, J and Xie, S (2010). “PKSolver: An add-in program for pharmacokinetic and pharmacodynamic data analysis in Microsoft Excel” Comput Methods Programs Biomed. 99(3):306-314.

[0481] Zlotnik, A. and O. Yoshie (2000). "Chemokines: a new classification system and their role in immunity." Immunity 12(2): 121-127.

[0482] SEQUENCES

[0483] SEQ ID NO: 1 - Variable Light Chain (16)

[0484] DVVMTQSPSSLSASVGDRVTITCRSSQSLVHSNGITFLHWYQQKPGKAPKLLIYKVSNRFSGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCSQTTHVPWTFGGGTKVEIK*

[0485] SEQ ID NO: 2 - CDR-L1

[0486] RSSQSLXHSNGXTFLH

[0487] SEQ ID NO: 3 - CDR-L2

[0488] KVSNRFS

[0489] SEQ ID NO: 4 - CDR-L3

[0490] SQTTHXPWT

[0491] SEQ ID NO: 5 - CDR-L1

[0492] RSSQSLVHSNGITFLH SEQ ID NO: 6 - CDR-L1

[0493] RSSQSLLHSNGNTFLH

[0494] SEQ ID NO: 7 - CDR-L3

[0495] SQTTHVPWT

[0496] SEQ ID NO: 8 - CDR-L3

[0497] SQTTHLPWT

[0498] SEQ ID NO: 9 - CDR-H1

[0499] GFTFSXYWMX

[0500] SEQ ID NO: 10 - CDR-H2

[0501] EIRSKSXNYATHYXESXXG

[0502] SEQ ID NO: 11 - CDR-H3

[0503] XYSPY

[0504] SEQ ID NO: 12 - CDR-H1

[0505] GFTFSDYWMN

[0506] SEQ ID NO: 13 - CDR-H1

[0507] GFTFSNYWMD

[0508] SEQ ID NO: 14 - CDR-H2

[0509] EIRSKSKNYATHYEESVRG

[0510] SEQ ID NO: 15 - CDR-H2

[0511] EIRSKSNNYATHYAESMKG

[0512] SEQ ID NO: 16 - CDR-H3

[0513] FYSPY SEQ ID NO: 17- CDR-H3

[0514] YYSPY

[0515] SEQ ID NO: 18 - Variable heavy chain (16)

[0516] EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYWMNWVRQAPGKGLEWVGEIRSKSKNYATHYEESVR

[0517] GRFTISRDDSKNTLYLQMNSLKTEDTAVYYCMFFYSPYWGQGTLVTVSS*

[0518] SEQ ID NO: 19 - Variable heavy chain (19)

[0519] EVQLVESGGGLVKPGGSLRLSCAASGFTFSNYWMDWVRQAPGKGLEWVGEIRSKSNNYATHYAESMK

[0520] GRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAFYYSPYWGQGTLVTVSS*

[0521] SEQ ID NO: 20 - Variable light chain (19)

[0522] DVVMTQSPSSLSASVGDRVTITCRSSQSLLHSNGNTFLHWYQQKPGKAPKLLIYKVSNRFSGVPSRFSG

[0523] SGSGTDFTLTISSLQPEDFATYYCSQTTHLPWTFGGGTKVEIK*

[0524] SEQ ID NO: 21 - amino acids 2-22 of N-terminal extracellular domain of CCR9 isoform A

[0525] TPTDFTSPIPNMADDYGSEST

[0526] TPTDFTSPIPNMADDYGSESTSS

[0527] SEQ ID NO: 23

[0528] PNMADD

[0529] SEQ ID NO: 24

[0530] TSPIPNMADDYGS

[0531] SEQ ID NO: 25

[0532] ASPIPNMADDYGS SEQ ID NO: 26

[0533] TSAIPNMADDYGS

[0534] SEQ ID NO: 27

[0535] TSPAPNMADDYGS

[0536] SEQ ID NO: 28

[0537] TSPIANMADDYGS

[0538] SEQ ID NO: 29

[0539] TSPIPAMADDYGS

[0540] SEQ ID NO: 30

[0541] TSPIPNAADDYGS

[0542] SEQ ID NO: 31

[0543] TSPIPNMGDDYGS

[0544] SEQ ID NO: 32

[0545] TSPIPNMAADYGS

[0546] SEQ ID NO: 33

[0547] TSPIPNMADAYGS

[0548] SEQ ID NO: 34

[0549] TSPIPNMADDAGS

[0550] SEQ ID NO: 35

[0551] TSPIPNMADDYAS

[0552] SEQ ID NO: 36

[0553] TSPIPNMADDYGA SEQ ID NO: 37

[0554] RSSQSLVHSNGNTYLN

[0555] SEQ ID NO: 38

[0556] SQSTHFPRT

[0557] SEQ ID NO: 39

[0558] DVVMTQSPSSLSASVGDRVTITC RSSQSLXHSNGXTFLH WYQQKPGKAPKLLIY KVSNRFS

[0559] GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC SQTTHXPWT FGGGTKVEIK*

[0560] DVVMTQSPSSLSASVGDRVTITC RSSQSLXHSNGXTFLH

[0561] WYQQKPGKAPKLLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC SQTTHXPWT

[0562] FGGGTKVEIK*

[0563] SEQ ID NO: 41

[0564] SSMEDYVNFNFTDFYSEKNN

[0565] SEQ ID NO: 42

[0566] SSMEDYVNFN

[0567] SEQ ID NO: 43

[0568] FTDFYSEKNN

[0569] SEQ ID NO: 44

[0570] EKNNVRQFAS

[0571] SEQ ID NO: 45

[0572] SPIPNMADDYG

[0573] SEQ ID NO: 46

[0574] DQWKFQTF SEQ ID NO: 47

[0575] QIKEESGIAISTMVYPSDEST

[0576] SEQ ID NO: 48 QIKEESGIAI

[0577] SEQ ID NO: 49

[0578] TMVYPSDEST SEQ ID NO: 50

[0579] AMFISN

[0580] SEQ ID Nos 51 to 69

[0581] TDFTSPIPNMADDYGSEST (SEQ ID NO: 51)

[0582] AAFTSPIPNMADDYGSEST (SEQ ID NO: 52)

[0583] TAATSPIPNMADDYGSEST (SEQ ID NO: 53)

[0584] TDAASPIPNMADDYGSEST (SEQ ID NO: 54)

[0585] TDFAAPIPNMADDYGSEST (SEQ ID NO: 55)

[0586] TDFTAAIPNMADDYGSEST (SEQ ID NO: 56)

[0587] TDFTSAAPNMADDYGSEST ( SEQ ID NO: 57)

[0588] TDFTSPAANMADDYGSEST (SEQ ID NO: 58)

[0589] TDFTSPIAAMADDYGSEST (SEQ ID NO: 59)

[0590] TDFTSPIPAAADDYGSEST (SEQ ID NO: 60)

[0591] TDFTSPIPNAGDDYGSEST (SEQ ID NO: 61)

[0592] TDFTSPIPNMGADYGSEST (SEQ ID NO: 62)

[0593] TDFTSPIPNMAAAYGSEST (SEQ ID NO: 63)

[0594] TDFTSPIPNMADAAGSEST (SEQ ID NO: 64)

[0595] TDFTSPIPNMADDAASEST (SEQ ID NO: 65)

[0596] TDFTSPIPNMADDYAAEST (SEQ ID NO: 66)

[0597] TDFTSPIPNMADDYGAAST (SEQ ID NO: 67)

[0598] TDFTSPIPNMADDYGSAAT (SEQ ID NO: 68)

[0599] TDFTSPIPNMADDYGSEAA (SEQ ID NO: 69) SEQ ID NO: 70 (SRB1-VH Figure 1 and Figure 32)

[0600] EVQLVESGGGLVKPGGSLRLSCAAS GFTFSKFWMN WVRQAPGKGLEWVG

[0601] EIRLKSNNYATHYAESVKG RFTISRDDSKNTLYLQMNSLKTEDTAVYYCTS DGWFAY WGQGTLVTVSS

[0602] SEQ ID NO: 71 (SRB10-VH Figure 1 and Figure 32)

[0603] EVKLEESGGGLVQPGGSMKLSCVAS GFTFNKFWMN WVRQSPEKGLEWVA

[0604] EIRLKSNNYATHYAESVKG RFTISRDDSKSSVYLQMNNLRAEDTGIYYCAS DGWFAY WGQGTLVTVSS

[0605] SEQ ID NO: 72 (IAbO1-VH Figure 1)

[0606] EVKVEESGGGLVQPGGSMKLSCWS GLTFSNFWMT WVRQSPEKGLEWVA

[0607] EIRLKSNNYATHYAESVKG RFTISRDDSRSSVFLQMNNLRAEDTGIYYCTT DGWFAF WGQGTLVTVSA

[0608] SEQ ID NO: 73 (IAbO2-VH Figure 1)

[0609] EVKVEESGGGLVQPGGSMKLSCAAS GFIFSNFWMN WVRQSPEKGLEWIA

[0610] EIRLKSNNYATHYAESVKG RFTISRDDSKSSVYLQMNNLRAEDTGIYYCAT DGWFAF WGQGTLVTVSA

[0611] SEQ ID NO: 74 (C9M16-VH Figure 1)

[0612] EVKLEESGGGLVLPGGSMKLSCVAS GFTFSDYWMN WVRQSPEKGLEWVA

[0613] EIRSKSKNYATHYEESVRG RCTISRDDSKSSVYLQMNNLRAEDTGIYFCMF FYS-PY WGQGTLVTVSA

[0614] SEQ ID NO: 75 (C9M19-VH Figure 1)

[0615] EVKLEESGGGLVQPGGSMKLSCVAS GFTFSNYWMD WVRQSPEKGLEWVA

[0616] EIRSKSNNYATHYAESMKG RFTISRDDSKSSVYLQMINLRTEDTGIYYCAF YYS-PY WGQGTLVTVSA

[0617] SEQ ID NO: 76 (SRB1-VL Figure 1)

[0618] DVQMTQSPSSLSASVGDRVTITC RSSQSLVHSNGNTYLN WYQQKPGKAPKLLIY KVSNRFS GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC SQSTHFPRT FGGGTKVEIKR

[0619] SEQ ID NO: 77 (SRB10-VL Figure 1)

[0620] DWMTQTPLSLPVSLGDQASISC RSSQSLVHSNGNTYLN WCLQRPGQSPKSLIY KVSNRFS

[0621] GVPDRFSGSGSGTDFTLKISRVEAEDLGVYFC SQSTHFPRT FGGGTKLEIKR SEQ ID NO: 78 (IAbO1-VL Figure 1)

[0622] QIVLTQSPTIMSASPGEKVTITC SASSSVSY - MH WFQQKPGTSPKLWIY STSNLAS

[0623] GVPARFSGSGSGTSYSLTISRMEAEDAATYYC QQRSSYPFT FGSGTKLEIKR

[0624] SEQ ID NO: 79 (IAbO2-VL Figure 1)

[0625] DWMTQTPLSLPVSLGDQASISC RSSQSLVHSNGNTYLQ WHLQKPGQSPKFLIY KVSNRFS

[0626] GVPDRFSGSGSGTDFTLKISRVEAEDLGVYFC SQSTHVPRT FGGGTKLEIKR

[0627] SEQ ID NO: 80 (C9M16-VL Figure 1)

[0628] DWMTQTPLSLPVSLGDQASISC RSSQSLVHSNGITFLH WYLQKPGQSPKLLIY KVSNRFS

[0629] GVPDRFSGSGSGTDFTLKISRVEAEDLGVYFC SQTTHVPWT FGGGTKLEIKR

[0630] SEQ ID NO: 81 (C9M19-VI Figure 1)

[0631] DWMTQTPLSLPVSLGDQASISC RSSQSLLHSNGNTFLH WYLQKPGQSPKLLIY KVSNRFS

[0632] GVPDRFSGSGSGTDFTLKVSRVEAEDLGVYFC SQTTHLPWT FGGGTKLEIKR

[0633] SEQ ID NO: 82

[0634] XFXYSPY

[0635] SEQ ID NO: 83

[0636] MFXYSPY

[0637] SEQ ID NO: 84

[0638] AFXYSPY

[0639] SEQ ID NO: 85

[0640] MFFYSPY

[0641] SEQ ID NO: 86

[0642] AFYYSPY SEQ ID NO: 87 (AZ-326-VH from Figure 32)

[0643] QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWIG

[0644] VIYPGNSDTRYNQKFKG RVTITRDTSASTAYMELSSLRSEDTAVYYCTRDYYSNYVYYYAMDY WGQGTTVTVSS

[0645] SEQ ID NO: 88 (AZ-326-VL from Figure 32)

[0646] DIVMTQTPLSLPVTPGEPASISC RSSQSLVHPNRNTYLHWYLQKPGQSPQLLIYKVSNRFS

[0647] GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHVPWTFGQGTKLEIK

[0648] SEQ ID NO: 89 (AZ-105-VH from Figure 32)

[0649] EVKLEESGGGLVQPGGSMKLSCVASGFTFN KYWMN WVRQSPEKGLEWVV

[0650] QIKLKSDNYATHYAESVKG RFAISRDDSKSSVYLQMNNLRAEDTGIYYCTL RPFTY WGQGTLVTVSA

[0651] SEQ ID NO: 90 (AZ-105-VL from Figure 32)

[0652] DVLMTQNPLSLPVSLGDQASISC RSSQSIIHSNGNTYLE WYLQKPGQSPKLLIY KVSNRFS

[0653] GVPDRFSGSGSGTDFTLKISRVEAEDLGVYYC FQGSHVPWT FGGGTKLEIK

Claims

Claims:1 . An anti-CCR9 antibody or antigen binding fragment thereof, comprising a variable light chain comprising SEQ ID NO:1 or a variant thereof having at least 95% sequence identity to SEQ ID NO:1 , wherein the variable light chain comprises a CDR-L1 comprising the amino acid sequence RSSQSLXHSNGXTFLH (SEQ ID NO: 2), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3) and a CDR-L3 comprising the amino acid sequence SQTTHXPWT (SEQ ID NO: 4), wherein X can be any amino acid.

2. The anti-CCR9 antibody or antigen binding fragment thereof of claim 1 , wherein the CDR-L1 comprises the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5) or the amino acid sequence RSSQSLLHSNGNTFLH (SEQ ID NO: 6).

3. The anti-CCR9 antibody or antigen binding fragment thereof of claim 1 or claim 2, wherein the CDR-L3 comprises the amino acid sequence SQTTHVPWT (SEQ ID NO: 7) or the amino acid sequence SQTTHLPWT (SEQ ID NO: 8).

4. The anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof comprises a CDR-H1 comprising the amino acid sequence GFTFSXYWMX (SEQ ID NO: 9), a CDR-H2 comprising the amino acid sequence EIRSKSXNYATHYXESXXG (SEQ ID NO: 10) and a CDR-H3 comprising the amino acid sequence XYSPY (SEQ ID NO: 11 ), wherein X can be any amino acid.

5. The anti-CCR9 antibody or antigen binding fragment thereof of claim 4, wherein the CDR-H1 comprises the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12) or the amino acid sequence GFTFSNYWMD (SEQ ID NO: 13).

6. The anti-CCR9 antibody or antigen binding fragment thereof of claim 4 or claim 5, wherein the CDR-H2 comprises the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14) or the amino acid sequence EIRSKSNNYATHYAESMKG (SEQ ID NO: 15).

7. The anti-CCR9 antibody or antigen binding fragment thereof of any one of claims 4 to 6, wherein the CDR-H3 comprises the amino acid sequence FYSPY (SEQ ID NO: 16) or the amino acid sequence YYSPY (SEQ ID NO: 17).

8. The anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof comprises a variable heavy chain comprising SEQ ID NO: 18 or a variant thereof having at least 95% sequence identity to SEQ ID NO: 18.

9. The anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof comprises a variable heavy chain comprising SEQ ID NO: 18 or SEQ ID NO: 19.

10. The anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the variable light chain comprises SEQ ID NO: 1 or SEQ ID NO: 20.11 . The anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof comprises: a. A variable light chain comprising SEQ ID NO:1 , wherein the variable light chain comprises a CDR-L1 comprising the amino acid sequence RSSQSLVHSNGITFLH (SEQ ID NO: 5), a CDR-L2 comprising the amino acid sequence KVSNRFS (SEQ ID NO: 3), and a CDR-L3 comprising the amino acid sequence SQTTHVPWT (SEQ ID NO: 7); and b. A variable heavy chain comprising a CDR-H1 comprising the amino acid sequence GFTFSDYWMN (SEQ ID NO: 12), a CDR-H2 comprising the amino acid sequence EIRSKSKNYATHYEESVRG (SEQ ID NO: 14) and a CDR-H3 comprising the amino acid sequence FYSPY (SEQ ID NO: 16).

12. The anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof binds to an epitope comprising amino acids at positions 11 , 12, 13, 15 and 16 of the N-terminal extracellular domain of CCR9 isoform A.

13. The anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the anti-CCR9 antibody or antigen binding fragment thereof comprises an IgG anti- CCR9 antibody.

14. The anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof exhibits a binding affinity dissociation constant KD for human CCR9 of about 1 x 106M or less.

15. The anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims, wherein the antibody or antigen binding fragment thereof exhibits a binding affinity dissociation constant KD for human CCR9 of from about 1 x 10-8M to about 1 x 10-10M.

16. An antibody drug conjugate (ADC) comprising the anti-CCR9 antibody or antigen binding fragment thereof of any one of the preceding claims conjugated to a drug, optionally a cytotoxic or chemotherapy drug.

17. The ADC of claim 16, wherein the ADC comprises the formula A-L-C, wherein A comprises the anti-CCR9 antibody or antigen-binding fragment thereof, L comprises a linker and C comprises the drug.

18. The ADC of claim 17, wherein C comprises a topoisomerase I inhibitor or a tubulin inhibitor.

19. The ADC of claim 18, wherein C comprises deruxtecan, monomethyl auristatin E, monomethyl auristatin F, SN38, exatecan, or analogs or derivatives thereof.

20. The ADC of any one of claims 17 to 19, wherein L comprises a protease cleavable linker.

21. The ADC of claim 20, wherein L comprises a valine-citrulline unit or an mc-GGFG linker.

22. The ADC of any one of claims 17 to 21 , wherein L-D has the structure:

23. The ADC of any one of claims 17 to 21 , wherein L-D has the structure:

24. A polynucleotide comprising a nucleotide sequence encoding the anti-CCR9 antibody or antigen binding fragment thereof of any one of claims 1 to 15.

25. A vector comprising the polynucleotide of claim 24.

26. A cell comprising the anti-CCR9 antibody or antigen binding fragment thereof of any one of claims 1 to 15, the polynucleotide of claim 24 or the vector of claim 25.

27. A pharmaceutical composition comprising the anti-CCR9 antibody or antigen binding fragment thereof of any one of claims 1 to 15, the ADC of any one of claims 16 to 23, the polynucleotide of claim 24, the vector of claim 25 or the cell of claim 26 and a pharmaceutically or physiologically acceptable diluent and / or carrier.

28. A kit comprising the anti-CCR9 antibody or antigen binding fragment thereof of any one of claims 1 to 15, the ADC of any one of claims 16 to 23, the polynucleotide of claim 24, the vector of claim 25, the cell of claim 26 or the pharmaceutical composition of claim 27.

29. A method of diagnosing a disease associated with elevated CCR9 expression in a subject, the method comprising: a) contacting the antibody or antigen binding fragment thereof of any one of claims 1 to 15 with a sample comprising cells from the subject; b) detecting and / or quantifying CCR9 expression in the subject sample; c) comparing the level of CCR9 expression detected in the subject sample with the level of CCR9 expression detected in a control sample; d) correlating the comparison obtained in step c) with the presence of a disease associated with elevated CCR9 expression.

30. The anti-CCR9 antibody or antigen binding fragment thereof of any one of claims 1 to 15, the ADC of any one of claims 16 to 23, the polynucleotide of claim 24, the vector of claim 25, the cell of claim 26 or the pharmaceutical composition of claim 27 for use in the treatment or prevention of a disease.

31. The method of claim 29 or the anti-CCR9 antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition for use of claim 30, wherein the disease is an inflammatory disease.

32. The method of claim 29 or claim 31 or the anti-CCR9 antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition for use of claim 30 or claim 31 , wherein the disease comprises cancer, liver fibrosis, acute liver inflammation, inflammatory bowel disease (I BD), Crohn’s Disease, colitis, ulcerative colitis, Rheumatoid Arthritis (RA), Psoriatic Arthritis (PsA), psoriasis, Systemic Lupus Erythematosus (SLE), Systemic Sclerosis (SSc) or ankylosing spondylitis.

33. The method of claim 29, claim 31 or claim 32 or the anti-CCR9 antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition for use of any one of claims 30 to 32, wherein the disease is selected from cancer, Crohn’s disease, colitis, ulcerative colitis, inflammatory bowel disease, liver fibrosis and acute liver inflammation, optionally wherein the disease is cancer or inflammatory bowel disease, further optionally wherein the disease is inflammatory bowel disease.

34. The method of any one of claims 29 and 31-33 or the anti-CCR9 antibody or antigen binding fragment thereof, the ADC, the polynucleotide, the vector, the cell or the pharmaceutical composition for use of any of claims 30 to 33, where the disease is cancer.

35. The method of claim 33 or 34 or the anti-CCR9 antibody or antigen binding fragment thereof, the ADC, the polynucleotide, vector, cell or pharmaceutical composition for use of claim 33 or 34, wherein the cancer is selected from ovarian cancer, prostate cancer, breast cancer, melanoma, T-cell acute lymphoblastic leukaemia (T-ALL), pancreatic cancer, colorectal cancer, lung cancer, circulating cells from a solid tumour (CTCs), T-cell lineage lymphomas, acute myeloid leukaemia (AML) and lung cancer.