Methods and compositions for manufacturing polynucleotides

Novel single-subunit RNA polymerases address the challenges of RNA manufacturing by improving nucleotide incorporation and reducing aberrant transcripts, enabling efficient production of high-quality RNA for therapeutic and diagnostic use.

AU2020283757B2Pending Publication Date: 2026-07-16PRIMROSE BIO INC

Patent Information

Authority / Receiving Office
AU · AU
Patent Type
Applications
Current Assignee / Owner
PRIMROSE BIO INC
Filing Date
2020-05-23
Publication Date
2026-07-16

AI Technical Summary

Technical Problem

Current RNA polymerases are inadequate for large-scale manufacturing of RNA-based vaccines and therapeutics due to low specific activity, inefficient incorporation of modified nucleotides, high aberrant transcript production, and high levels of double-stranded RNA, which limits the production of high-quality, uniform RNA.

Method used

Development of novel single-subunit RNA polymerases that can efficiently incorporate non-natural nucleotides, reduce aberrant transcripts, and minimize double-stranded RNA production, thereby enhancing RNA yield and fidelity.

Benefits of technology

These polymerases enable cost-effective, high-yield production of high-quality RNA suitable for pharmaceutical, diagnostic, and therapeutic applications, overcoming the limitations of existing RNA manufacturing processes.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 00000001_0000
    Figure 00000001_0000
  • Figure 00000001_0001
    Figure 00000001_0001
  • Figure 00000001_0002
    Figure 00000001_0002
Patent Text Reader

Abstract

The present disclosure provides compositions and methods for polynucleotide synthesis in vitro, specifically the use of single-subunit RNA polymerases for synthesis and manufacturing of RNA.
Need to check novelty before this filing date? Find Prior Art

Description

INCORPORATION OF SEQUENCE LISTING

[0001] The content of the electronically submitted sequence listing in ASCII text file (2020-05-23_PG0016_Sequence_Listing_ST25.txt) filed with the application is hereby incorporated by reference in its entirety. BACKGROUND

[0002] Explorations of RNA as a molecule of clinical and biotechnological utility have increased dramatically in the past decade. For human therapeutic uses, RNA is being developed and used as a carrier of protein-coding information and gene regulatory activity to affect many aspects of human physiology (Rossbach 2010, Burnett 2011, Kole 2012, Sahin 2014, Sergeeva 2016).

[0003] In agriculture, the development of spray technology for siRNAs as novel pesticides has led to an explosion of potential crop applications (Regalado 2015).

[0004] Despite this promise, commercial development of RNA-based vaccines and therapeutics, as well as RNAs used in agriculture, has been slowed by the difficulty of manufacturing large quantities of commercially suitably material of uniform sequence and length.

[0005] Progress in the development of RNA-based vaccines, RNA therapeutics and RNA products for therapeutic and agricultural applications has created an unmet demand for inexpensive and efficient RNA manufacturing methods capable of generating large quantities (g to ktons) of pure, molecularly uniform RNA. Furthermore, many applications are using chemical modifications that serve to increase RNA stability and efficacy. Because RNA is inherently unstable, RNA intended for human uses are chemically modified to stabilize the molecule and extend its shelflife and half-life in the human body (Majlessi 1998, Layzer 2004, Kraynack 2005, Jackson 2006, Wilson 2006, Ge 2010). The simplest way to achieve this is to incorporate non-native nucleotides, for example those blocked at their 2’ position, into RNA during manufacture.

[0006] The commonly used T7 RNA polymerase and its known variants (Padilla 2002, Chelliserrykattil 2004, Siegmund 2012, Ibach 2013, Meyer 2015) fall far short of the requirements for such a manufacturing process, necessitating the development of novel RNA polymerases that incorporate non-natural nucleotides into RNA efficiently and with high fidelity. Through variations in its structure and / or different delivery mechanisms, RNAs can be designed to affect both systemic and tissue-specific processes, further broadening its utility.

[0007] Specific RNA sequences are efficiently generated by in vitro transcription (IVT) from DNA templates using bacteriophage single-subunit RNA polymerases (RNApols). In principle, such reactions can be developed into large-scale manufacturing processes. However, currently available RNApols have several limitations which reduce their suitability for RNA manufacturing: 1) relatively low specific activity which requires long reaction times or high enzyme doses; 2) low efficiencies of incorporating modified nucleotides 3) low RNA quality due to a high percentage of aberrant transcripts (i.e. mutated or truncated), resulting in reduced protein yields and potential off-target effects, and 4) High levels of double-stranded RNA, which is highly immunogenic (Mu 2018, Gholamalipour 2018). The manufacturing challenges associated with therapeutic mRNAs represent a significant hurdle for the clinical development and commercialization of a large number of potentially active RNA vaccines and therapeutics. In attempts to solve this problem, the widely used bacteriophage T7 RNA polymerase (T7 RNApol) has been mutated to improve its incorporation of non-natural nucleotides. Yet even the best available T7 RNApol variants (Padilla 2002, Chelliserrykattil 2004, Siegmund 2012, Ibach 2013, Meyer 2015) show deficiencies in all four of the above-listed performance indicators, and these enzymes fall far short of the requirements of a manufacturing process for clinical material.

[0008] A robust solution to the problem of manufacturing large quantities of therapeutic grade RNA requires casting a wider net for RNApols with the desired catalytic activity. The present disclosure describes novel single-subunit RNApols that have desirable properties for RNA manufacturing in vitro. SUMMARY

[0009] We describe 37 new single-subunit RNA polymerases and their promoters that can be used to manufacture RNA in vitro. These enzymes are suited for RNA synthesis and RNA manufacturing by virtue of specific qualities related to RNA length, RNA size distribution, RNA yield, RNA quality, RNA sequence fidelity, absence of double-stranded RNA. These polymerases are also capable of incorporating non-natural nucleotides into RNA. Therefore the single-subunit RNA polymerases disclosed herein are useful for manufacturing pharmaceuticals, medicaments, therapeutics, vaccines, diagnostics and cosmetics as they produce high quality RNA. The single-subunit RNA polymerases disclosed herein also allow more efficient RNA manufacturing at a cost that is significantly reduced, even compared to optimized T7 polymerase manufacturing processes. 2020283757   04 Mar 2026 [0009a]      In one aspect provided herein is a method of performing in vitro transcription comprising the steps of (a) combining (i) a polypeptide having at least 95% amino acid sequence identity to an RNA polymerase (RNApol) molecule comprising the amino acid sequence of SEQ ID NO:23, (ii) a double-stranded DNA template comprising a promoter comprising the nucleotide sequence of SEQ ID NO:105, operatively linked to a polynucleotide encoding a protein or polypeptide; and (iii) one or more nucleotide triphosphates; (b) incubating the combination of (a) at a temperature from 10 °C to 80 °C; and (c) producing a transcript or a population of transcripts. [0009b]      In another aspect provided herein is an isolated polypeptide having at least 95% to 100% amino acid sequence identity to SEQ ID NO:23 for use in the manufacture of a medicament, vaccine, or diagnostic agent. [0009c]       In another aspect provided herein is an isolated nucleic acid molecule comprising: (a) a heterologous regulatory sequence capable of causing transcription and / or translation of a nucleotide sequence encoding a polypeptide having at least 95% to 100% amino acid sequence identity to SEQ ID NO: 23; or (b) a nucleic acid which is a complement of the nucleotide sequence according to (a). [0009d]      In a further aspect provided herein is an isolated polypeptide having at least 95% to 100% amino acid sequence identity to SEQ ID NO:23. BRIEF DESCRIPTION OF THE DRAWINGS

[0010] Figure 1 : RNAs produced in vitro and electrophoresed on agarose gels.

[0011] Figure 1A: 3gl each of RNAs produced in 20 gl in vitro transcription reactions. Lane identities from left: M: RNA marker; 1: RNA transcribed with RNA polymerase (RNApol) from Yersinia phage phiR8-01; 2: 1.8kb DNA template; 3: RNA transcribed with RNApol from Aeromonas phage phiAS7; 4: RNA transcribed with RNApol from Caulobacter phage Percy; 5: 1.8kb DNA template; 6: RNA transcribed with RNApol from Burkholderia phage Bp-AMP4; 7, 8: RNA transcribed with RNApol from Pseudomonas phage Andromeda; 9: RNA transcribed 2020283757   04 Mar 2026 with RNApol from Proteus phage vB_PmiP_Pm5460; 10: RNA transcribed with RNApol from Delftia phage IME-DE1; 11: RNA transcribed with RNApol from Vibrio phage N4; 12: RNA 2020283757   11 Nov 2025 transcribed with RNApol from Morganella phage vB_MmoP_MP2; M: RNA marker; 13: RNA transcribed with RNApol from Xanthomonas phage f30-Xaj; 14: RNA transcribed with RNApol from Escherichia phage T7. The RNA marker is a single-stranded RNA ladder sold by New England Biolabs (Ipswich, MA, USA) containing the following RNA sizes in nucleotides: 500, 1000, 2000, 3000, 5000, 7000, 9000. The migration of the RNAs produced by the RNA polymerases is consistent with a ~1.8kb size of the RNA, corresponding to the ~1.8kb size of the template DNA.

[0012] Figure 1B: 3pl each of RNAs produced in 20 pl in vitro transcription reactions. Lane identities from left: M: RNA marker; 1: 1.8kb DNA template; 2: 1.8kb DNA template; 3: RNA transcribed with RNApol from Pantoea phage LIMElight; 4: RNA transcribed with RNApol from Salmonella virus SP6; 5: RNA transcribed with RNApol from Escherichia phage ECBP5; 6: RNA transcribed with RNApol from Kluyvera phage Kvp1; 7: RNA transcribed with RNApol from Klebsiella phage KP32; 8: RNA transcribed with RNApol from Stenotrophomonas phage IME15; 9: RNA transcribed with RNApol from Escherichia phage T7. The RNA marker is a single-stranded RNA ladder sold by New England Biolabs (Ipswich, MA, USA) containing the following RNA sizes in nucleotides: 500, 1000, 2000, 3000, 5000, 7000, 9000. The migration of the RNAs produced by the RNA polymerases is consistent with a ~1.8kb size of the RNA, corresponding to the ~1.8kb size of the template DNA. DETAILED DESCRIPTION

[0013] The following abbreviations and definitions will be used for the interpretation of the specification and the claims.

[0014] As used herein, the terms "comprises," "comprising," "includes," "including," "has," "having," "contains" or "containing," or any other variation thereof, are intended to cover a non-exclusive inclusion. For example, a composition, a mixture, process, method, article, or apparatus that comprises a list of elements is not necessarily limited to only those elements but may include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus. Further, unless expressly stated to the contrary, "or" refers to an inclusive or and not to an exclusive or. For example, a condition A or B is satisfied by any one of the following: A is true (or present) and B is false (or not present), A is false (or not present) and B is true (or present), and both A and B are true (or present). [0014a]       Any discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is not to be taken as an admission that any or all of these matters form part of the prior art base or were common general knowledge in the field 2020283757   11 Nov 2025 relevant to the present disclosure as it existed before the priority date of each of the appended claims.

[0015] Complementary nucleotide sequence: As used herein, a complementary nucleotide sequence is a sequence in a polynucleotide chain in which all of the bases are able to form base pairs with a sequence of bases in another polynucleotide chain.

[0016] Control elements: The term 'control elements' refers to nucleotide sequences located upstream (5' non-coding sequences), within, or downstream (3' non-coding sequences) of a coding sequence and which influence the transcription, RNA processing or stability, or translation of the associated coding sequence. Regulatory sequences include but are not limited to promoters, translation leader sequences, introns, polyadenylation recognition sequences, RNA processing site, effector binding site and stem-loop structure.

[0017] Degenerate Sequence: In this application degenerate sequences are defined as populations of sequences where specific sequence positions differ between different molecules or clones in the population. The sequence differences may be a single nucleotide or multiple nucleotides of any number, examples being 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900 or 1000 nucleotides, or any number in between. Sequence differences in a degenerate sequence may involve the presence of 2, 3 or 4 different nucleotides in that position within the population of sequences, molecules or clones. Examples of degenerate nucleotides in a specific position of a sequence are: A or C; A or G; A or T; C or G; C or T; G or T; A, C or G; A, C or T; A, G or T; C, G or T; A, C, G or T.

[0018] Expression: The term "expression", as used herein, refers to the transcription and stable accumulation of sense (mRNA) or antisense RNA derived from the nucleic acid disclosed, as well as the accumulation of polypeptide as a product of translation of mRNA.

[0019] Full-length Open Reading Frame: As used herein, a full-length open reading frame refers to an open reading frame encoding a full-length protein which extends from its natural initiation codon to its natural final amino-acid coding codon, as expressed in a cell or organism. In cases where a particular open reading frame sequence gives rise to multiple distinct full-length proteins expressed within a cell or an organism, each open reading frame within this sequence, encoding one of the multiple distinct proteins, are considered full-length. In different aspects of the disclosure, a full-length open reading frame is either continuous or interrupted by introns.

[0020] Gene: The term "gene" refers to a nucleic acid fragment that is capable of being expressed as a specific protein, optionally including regulatory sequences preceding (5' noncoding sequences) and following (3' non-coding sequences) the coding sequence. "Native gene" refers to a gene as found in nature in its natural host organism. "Natural gene" refers to a gene complete with its natural control sequences such as a promoter and terminator. "Chimeric gene" refers to any gene that comprises regulatory and coding sequences that are not found together in nature. Accordingly, a chimeric gene may comprise regulatory sequences and coding sequences that are derived from different sources, or regulatory sequences and coding sequences derived from the same source, but arranged in a manner different than that found in nature. Similarly, a "foreign" gene refers to a gene not normally found in the host organism, but that is introduced into the host organism by gene transfer. Foreign genes include native genes inserted into a nonnative organism, or chimeric genes. A "transgene" is a gene that has been introduced into the genome by a transformation procedure.

[0021] In-Frame: The term "in-frame" in this application, and particularly in the phrase "in-frame fusion polynucleotide," refers to the reading frame of codons in an upstream or 5' polynucleotide or ORF as being the same as the reading frame of codons in a polynucleotide or ORF placed downstream or 3' of the upstream polynucleotide or ORF that is fused with the upstream or 5' polynucleotide or ORF. Such in-frame fusion polynucleotides encode a fusion protein or fusion peptide encoded by both the 5' polynucleotide and the 3' polynucleotide. In vitro transcription reaction: An “in vitro transcription reaction” as used herein is a reaction designed to produce RNA by transcribing a DNA template in vitro. In vitro transcription reactions contain one or more DNA template molecules encoding the RNAs to be transcribed, one or more completely or partially purified single-subunit RNA polymerases, a minimum of four nucleotide triphosphates as substrates for the single-subunit RNA polymerase(s), buffers, divalent cations and salts as necessary for the reaction.

[0022] Iterate / Iterative: In this application, to iterate means to apply a method or procedure repeatedly to a material or sample. Typically, the processed, altered or modified material or sample produced from each round of processing, alteration or modification is then used as the starting material for the next round of processing, alteration or modification. Iterative selection refers to a selection process that iterates or repeats the selection two or more times, using the survivors of one round of selection as starting material for the subsequent rounds.

[0023] Linker sequence refers to a polynucleotide sequence or polypeptide sequence separating two polynucleotides or polypeptides in a fusion polynucleotide or fusion polypeptide. For example, a fusion polynucleotide contains two or more ORFs that are separated by a linker sequence, which encodes a peptide which separates the two parts of the polypeptide that results from expression and translation of the fusion polynucleotide. A linker can also separate an epitope tag from a protein or enzyme. Linker sequences can have diverse length or sequence composition.

[0024] Non-homologous: The term "non-homologous" in this application is defined as having sequence identity at the nucleotide level of less than 50%.

[0025] Nucleotide triphosphates: “Nucleotide triphosphates” in this application is defined as any of the ribonucleotide triphosphates ATP, CTP, GTP and UTP used in RNA synthesis, or any modified analogs, derivatives or variants thereof.

[0026] Open Reading Frame (ORF): An ORF is defined as any sequence of nucleotides in a nucleic acid that encodes a protein or peptide as a string of codons in a specific reading frame. Within this specific reading frame, an ORF can contain any codon specifying an amino acid, but does not contain a stop codon. The ORFs in the starting collection need not start or end with any particular amino acid. In different aspects of the disclosure, an ORF is either continuous or is interrupted by one or more introns.

[0027] Operably linked: The term "operably linked" refers to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is affected by the other. For example, a promoter is operably linked with a coding sequence when it is capable of effecting the expression of that coding sequence (i.e., that the coding sequence is under the transcriptional control of the promoter). Coding sequences can be operably linked to regulatory sequences in sense or antisense orientation.

[0028] Peptide bond: A "peptide bond" is a covalent bond between a first amino acid and a second amino acid in which the alpha-amino group of the first amino acid is bonded to the alpha-carboxyl group of the second amino acid.

[0029] Percentage of sequence identity: The term "percent sequence identity" refers to the degree of identity between any given query sequence, e.g. SEQ ID NO: 102, and a subject sequence. A subject sequence typically has a length that is from about 80 percent to 200 percent of the length of the query sequence, e.g., 80, 82, 85, 87, 89, 90, 93, 95, 97, 99, 100, 105, 110, 115, or 120, 130, 140, 150, 160, 170, 180, 190 or 200 percent of the length of the query sequence. A percent identity for any subject nucleic acid or polypeptide relative to a query nucleic acid or polypeptide is determined as follows. A query sequence (e.g. a nucleic acid or amino acid sequence) is aligned to one or more subject nucleic acid or amino acid sequences using the computer program ClustalW (version 1.83, default parameters), which allows alignments of nucleic acid or protein sequences to be carried out across their entire length (global alignment, Chenna 2003).

[0030] ClustalW calculates the best match between a query and one or more subject sequences, and aligns them so that identities, similarities and differences can be determined. Gaps of one or more residues can be inserted into a query sequence, a subject sequence, or both, to maximize sequence alignments. For fast pairwise alignment of nucleic acid sequences, the following default parameters are used: word size: 2; window size: 4; scoring method: percentage; number of top diagonals: 4; and gap penalty: 5. For multiple alignment of nucleic acid sequences, the following parameters are used: gap opening penalty: 10.0; gap extension penalty: 5.0; and weight transitions: yes. For fast pairwise alignment of protein sequences, the following parameters are used: word size: 1; window size: 5; scoring method: percentage; number of top diagonals: 5; gap penalty: 3. For multiple alignment of protein sequences, the following parameters are used: weight matrix: blosum; gap opening penalty: 10.0; gap extension penalty: 0.05; hydrophilic gaps: on; hydrophilic residues: Gly, Pro, Ser, Asn, Asp, Gin, Glu, Arg, and Lys; residue-specific gap penalties: on. The ClustalW output is a sequence alignment that reflects the relationship between sequences. ClustalW can be run, for example, at the Baylor College of Medicine Search Launcher website and at the European Bioinformatics Institute website on the World Wide Web (ebi.ac.uk / clustalw).

[0031] To determine a percent identity of a subject or nucleic acid or amino acid sequence to a query sequence, the sequences are aligned using Clustal W, the number of identical matches in the alignment is divided by the query length, and the result is multiplied by 100. It is noted that the percent identity value can be rounded to the nearest tenth. For example, 78.11, 78.12, 78.13, and 78.14 are rounded down to 78.1, while 78.15, 78.16, 78.17, 78.18, and 78.19 are rounded up to 78.2.

[0032] Plasmid: The terms "plasmid" and "vector" refer to genetic elements used for carrying genes which are not a natural part of a cell or an organism. Vectors can either integrate into the genome or can be maintained extrachromosomally as linear or circular DNA fragments. Such elements include but are not limited to autonomously replicating sequences; genome integrating sequences; origins of replication; bacteriophage or nucleotide sequences, linear or circular, of a single- or double-stranded DNA or RNA, derived from any source, in which a number of nucleotide sequences have been joined or recombined into a unique construction which is useful for introducing polynucleotide sequences into a cell or an organism.

[0033] Polypeptide or protein: The terms “polypeptide” or “protein” denote a polymer composed of a plurality of amino acid monomers joined by peptide bonds. The polymer comprises 10 or more monomers, including 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000 or any length in between. A preferred polypeptide or protein of the disclosure is a single-subunit RNA polymerase.

[0034] Promoter: The term "promoter" refers to a DNA sequence capable of controlling the expression of a coding sequence or functional RNA. In general, a coding sequence is located 3' to a promoter sequence. In different aspects, promoters are derived in their entirety from a native gene, or are composed of different elements derived from different promoters found in nature, or even comprise synthetic DNA segments. It is understood by those skilled in the art that different promoters direct the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental or physiological conditions. Promoters which cause a gene to be expressed in most cell types at most times are commonly referred to as "constitutive promoters". It is further recognized that since in most cases the exact boundaries of regulatory sequences have not been completely defined, DNA fragments of different lengths may have identical promoter activity.

[0035] Single-subunit RNA polymerase: A “single-subunit RNA polymerase”, as used herein, is an enzyme with DNA-dependent RNA polymerase activity capable of synthesizing RNA from a DNA template in vitro in a pure form, without the presence or addition of any other proteins or peptides into the reaction.

[0036] Transformed: The term "transformed" means genetic modification by introduction of a polynucleotide sequence.

[0037] Transformation: As used herein the term "transformation" refers to the transfer of a nucleic acid fragment into a host organism, resulting in genetically stable inheritance. Host organisms containing the transformed nucleic acid fragments are referred to as "transgenic" or "recombinant" or "transformed" organisms.

[0038] Transformed Organism: A transformed organism is an organism that has been genetically altered by introduction of a polynucleotide sequence into the organism's genome.

[0039] The term unfavorable conditions as used herein implies any part of the growth condition, physical or chemical, that results in slower growth than under normal growth conditions, or that reduces the viability of cells compared to normal growth conditions.

[0040] We describe novel single-subunit RNA polymerases that are suitable for RNA manufacturing in vitro. These enzymes are related, by sequence and / or structure, to the T7 RNA polymerase that is widely used for RNA synthesis in vitro, in particular in the manufacture of RNA for use in pharmaceuticals, diagnostics, vaccines, medicaments, therapeutics, and cosmetics. However, by virtue of their varying level of sequence similarity to T7 RNA polymerase, these enzymes have very different properties.

[0041] For example, the ability of a single-subunit RNA polymerase to synthesize a uniform population of RNA molecules in vitro decreases with the length of the DNA molecule used as a template for the RNA polymerase. Certain RNA polymerases have higher processivity than others and are capable of synthesizing highly uniform RNAs >lkb in length or longer.

[0042] Single-subunit RNA polymerases also differ in their ability to utilize non-natural nucleotides and incorporate these into the RNA molecule. Examples of such non-natural nucleotides are 2’-O-methyl NTPs, 2’-fluoro NTPs, pseudouridine-5’-triphosphate and Nl-methylpseudouridine-5'-Triphosphate. The 2’ hydroxyl of ribonucleotides has frequently been targeted for modification because this group is primarily responsible for the low stability of RNA under basic conditions. Various modifications at the 2’ position of nucleotides have been tested for increasing RNA stability. However, single-subunit RNA polymerases tend to incorporate such modified nucleotides inefficiently. Alternatively, RNA molecules containing such modified nucleotides may exhibit a high rate of sequence errors. Specific single-subunit RNA polymerases among the ones listed in SEQ ID NO: 1 through SEQ ID NO: 41 of this disclosure are able to incorporate modified nucleotides efficiently without compromising sequence fidelity.

[0043] Single-subunit RNA polymerases differ in their RNA yield based on the nucleotides added to an in vitro transcription reaction. For example, a 20 pl in vitro transcription reaction containing ImM of each of the four nucleotide triphosphates ATP, CTP, GTP and TTP can yield up to about 25 pg of RNA assuming equal representation of each of the nucleotides in the DNA template. An RNA polymerase that synthesizes 10 pg of RNA in such a reaction has a yield of 40%. Higher-yielding RNA polymerases are of value as they maximize the amount of RNA product made from a specific amount of nucleotide triphosphates added to the reaction. For example, the single-subunit RNA polymerases disclosed herein produce a transcript yield that is greater than that generated by T7 RNA polymerase, and in some cases at temperatures less than 24°C is a much as a two-fold, three-fold, or four-fold increase. Similarly, when using modified nucleotides the transcript yield of the single-subunit RNA polymerases disclosed herein can be as a two-fold or three-fold increase, depending upon the modified nucleotide used as compared to T7 RNA polymerase.

[0044] Single-subunit RNA polymerases differ in the amount of double-stranded RNA made in a reaction. Double-stranded RNA is a frequent and undesirable side product of in vitro transcription reactions (Mu 2018, Gholamalipour 2018), and its reduction or elimination reduces the cost of synthesizing pharmaceutical-grade RNA.

[0045] Single-subunit RNA polymerases differ in their temperature specificity or reaction speed at varying temperatures, both of which are important parameters in RNA synthesis. Lower reaction temperatures such as between 10 and 20 °C can stabilize the RNA. However, T7 RNA polymerase has very low activity at such temperatures. It is therefore of value to identify RNA polymerases active at low temperatures.

[0046] Single-subunit RNA polymerases differ in their overall reaction speed, irrespective of temperatures. Faster enzymes are typically more desirable because shorter reaction times reduces RNA degradation.

[0047] Single-subunit RNA polymerases differ in their sequence fidelity. High-fidelity enzymes will produce RNAs that faithfully encode a protein of interest, and therefore have a higher activity in therapeutic applications.

[0048] A novel single-subunit RNA polymerase is identified in sequence databases using iterative sequence searches by virtue of its sequence identity with T7 RNA polymerase, T3 RNA polymerase, SP6 RNA polymerase or other well-characterized single-subunit RNA polymerases (Butler 1982, McGraw 1985, Studier 1986). For example, BLAST searches are performed using the protein sequences of T7 RNA polymerase, T3 RNA polymerase or SP6 RNA polymerase as query sequences, collecting the resulting protein sequences and performing additional rounds of BLAST searching.

[0049] The resulting protein sequences are then grouped into a phylogenetic tree, for example using Clustal Omega, the Armadillo Workflow Platform, Treefinder, Phybase programs and the like. Representative enzymes are selected from various parts of the tree for expression and testing.

[0050] To facilitate protein purification, a coding sequence encoding an enzyme of interest is modified with a short sequence encoding an epitope tag or purification tag. Such tags are routinely used in protein biochemistry and are typically added to either the 5’ end or 3’ end of a sequence encoding an enzyme or a protein, such that the peptide encoded by the tag will be found either at the N-terminus or at the C-terminus of the encoded protein. Examples of frequently used epitope tags are a polyhistidine tag (or His-tag), a FLAG tag.

[0051] A His-tag comprises a string of histidine residues from four to ten residues in succession, typically consisting of six histidine residues (His6 tag). Some proteins are engineered with two His6 tags, or with a polyhistidine stretch longer than 6 histidine residues.

[0052] A FLAG tag consists of the peptide sequence DYKDDDDK (SEQ ID NO: 165), which like the His tag is added to a proteins N- or C-terminus.

[0053] Numerous other tags are known to those trained in the art and include the following: AviTag, encoded by the peptide sequence GLNDIFEAQKIEWHE (SEQ ID NO: 166), a peptide allowing biotinylation by the enzyme BirA allowing the protein to be isolated by streptavidin; Calmodulin-tag, encoded by the peptide sequence KRRWKKNFIAVSAANRFKKISSSGAL (SEQ ID NO: 167), a peptide bound by the protein calmodulin; Poly glutamate tag, encoded by the peptide sequence EEEEEE (SEQ ID NO: 183), a peptide binding efficiently to anion-exchange resin such as Mono-Q; E-tag, encoded by the peptide sequence GAPVPYPDPLEPR (SEQ ID NO: 168), a peptide recognized by an antibody; HA-tag, encoded by the peptide sequence YPYDVPDYA (SEQ ID NO: 169), a peptide from hemagglutinin recognized by an antibody; Myc-tag, encoded by the peptide sequence EQKLISEEDL (SEQ ID NO: 170), a peptide derived from c-myc recognized by an antibody; NE-tag, encoded by the peptide sequence TKENPRSNQEESYDDNES (SEQ ID NO: 171), a synthetic peptide recognized by a monoclonal IgGl antibody; S-tag, encoded by the peptide sequence KETAAAKFERQHMDS (SEQ ID NO: 172), a peptide derived from Ribonuclease A; SBP-tag, encoded by the peptide sequence MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP (SEQ ID NO: 173), a peptide which binds to streptavidin; Spot-tag, encoded by the peptide sequence PDRVRAVSHWSS (SEQ ID NO: 174), a peptide recognized by a nanobody; Strep-tag, encoded by the peptide sequence WSHPQFEK (SEQ ID NO: 175), a peptide which binds to streptavidin or the modified streptavidin streptactin; Ty tag, encoded by the peptide sequence EVHTNQDPLD (SEQ ID NO: 176); V5 tag, encoded by the peptide sequence GKPIPNPLLGLDST (SEQ ID NO: 177), a peptide recognized by an antibody; VSV-tag, encoded by the peptide sequence YTDIEMNRLGK (SEQ ID NO: 178), a peptide recognized by an antibody; Xpress tag, encoded by the peptide sequence DLYDDDDK (SEQ ID NO: 179).

[0054] A polynucleotide sequence encoding the peptide sequence of an epitope or purification tag can be joined directly to the coding sequence of an enzyme of interest, or can be joined to this coding sequence via an intervening linker sequence encoding additional amino acid residues. The use of a linker sequence separates the epitope or purification tag from the enzyme or protein of interest, making the tag more accessible to affinity reagents such as antibodies or affinity resins. A simple linker, GGTAGC, encodes the dipeptide Gly-Ser and creates separation between an epitope tag and a protein or enzyme of interest.

[0055] Linker sequences that separate two or more ORFs in a fusion polynucleotide can range between 3 and 99,999 nucleotides in length. For example linker sequences can be 3, 6, 9, 12, 15, 18, 21, 24, 27, 30, 60, 90, 120, 150, 180, 210, 240, 270, 300, 600, 900, 1200, 1500, 1800, 2100, 2400, 2700, 3000, 6000, 9000, 12000, 15000, 18000, 21000, 24000, 27000, 30000, 60000, 90000, or 99999 base pairs in length, or any length in between. A polynucleotide linker sequence typically has a nucleotide length divisible by 3 to encode an integral number of amino acid-coding codons.

[0056] In one aspect of the disclosure, a linker sequences also contains one or more introns which are spliced out of mRNAs in eukaryotic organisms.

[0057] In another aspect of the disclosure, a nucleic acid sequence encoding an epitope tag or purification tag are fused to an open reading frame encoding an enzyme of interest without any linker sequence, by directly joining the last codon of the enzyme coding sequence to the first codon of the epitope tag or purification tag, or alternatively by joining the last codon of the epitope tag or purification tag to the first codon of the enzyme coding sequence.

[0058] Linker sequences encode linker peptide or polypeptide sequences that are suitable for separating the two parts of a fusion protein. Small amino acids, such as glycine, alanine, serine, proline, threonine, aspartic acid or asparagine are suitable for linker peptides because they tend to form flexible and unstructured domains, or alpha-helical domains lacking bulky side groups, that allow separation between the two parts of the encoded randomized fusion polypeptide and that allow each part of the encoded randomized fusion polypeptide to move independently relative to the other. Accordingly, sequence insertions separating the two fused ORFs contains codons specifying these amino acids. Alternatively, the linker peptide sequence are designed to contain a specific secondary structure, such as an alpha helix, beta sheet, coiled coil or turn, or combinations thereof, permitting the two parts of the fusion polypeptide to be separated by a specific structure or combinations of specific structures.

[0059] The linker sequence separating the two ORFs in a fusion polynucleotide often encodes a short peptide that is rich in glycine and serine residues. Such a peptide is expected to be unstructured and will provide a flexible protein spacer separating the two members of a fusion polypeptide while being relatively resistant to proteolysis. Examples of suitable linker peptide sequences are GGGGSGGSGGSGGGGS (SEQ ID NO: 180) or SGGSSAAGSGSG (SEQ ID NO:181) or SAGSSAAGSGSG (SEQ ID NO:182) (Wang 2010). In another aspect of the disclosure, alpha-helical linker sequences are used, for example the sequence A(EAAAAK)nA, n=2-5 (Arai 2001; SEQ ID NO:184-187). It is possible to optimize linker sequences for a specific fusion polynucleotide or fusion polypeptide by varying the length and sequence of the linker sequence and selecting for the variant that encodes the most active, stable or effective fusion polypeptide (Arai 2001, Wang 2010).

[0060] Any open reading frame or coding sequence can be used as a linker sequence; Linker sequences include natural sequences encoded in the genome of a specific organism, or artificial sequences derived by de novo design or randomized synthesis, or natural sequences that are optimized by codon optimization, adjustment of GC content, or other methods for varying polynucleotide or polypeptide sequences.

[0061] Typically, linker sequences are designed to encode polypeptides that are resistant to proteolysis, or whose sequence is not cleaved by proteases present in the host cell. However, in another aspect of the disclosure, a linker sequence is specifically designed to be cleaved by cellular proteases by designing the linker sequence in a manner that it encodes a protease recognition site.

[0062] Different methods are used to generate a nucleic acid sequence encoding specific enzymes selected for testing. For example, the native enzyme coding sequence is identified in sequence databases by virtue of its association in the database with the protein sequence, or via the complete genome sequence of a bacteriophage encoding the enzyme of interest. Alternatively, the protein sequence is reverse translated into a nucleic acid sequence taking the codon preferences of the host organism into account that is to be used for protein expression.

[0063] Synthetic nucleic acid sequences encoding an enzyme of interest are created using methods known to those trained in the art. For example, a synthetic nucleic acid sequence that encodes a specific peptide sequence is generated manually using the genetic code in combination with a table of codon usage of the appropriate host organism. Alternatively, this is done using a reverse translation program such as the ones available at the internet sites bioinformatics.org, geneinfinity.org or the internet site operated by the European Bioinformatics Institute, part of the European Molecular Biology Laboratory. Reverse translation programs are also available through commercial suppliers of gene synthesis which makes such programs available as part of the process of ordering synthetic genes.

[0064] Recombinant protein expression in E.coli and other bacteria is generally carried out in the same general sequence of steps as outlined below. The gene encoding the product of interest in inserted into a plasmid DNA molecule. The insertion is accomplished by a number of cloning methods known to those skilled in the art including, but not limited to, traditional cloning using restriction enzymes and DNA ligase (ligation-dependent cloning), agarose gel-free cloning, ligation-independent (or ligation-free) cloning, site-specific recombination, homologydependent cloning, recombinational cloning, homology-dependent end joining, annealing of single-stranded ends, linker tailing, topoisomerase-catalyzed cloning, enzyme-free cloning, and others.

[0065] "Joining nucleic acid molecules" as used herein refers to any method that results in the molecules being operably linked at room temperature. Such methods include ,but are not limited to, covalent linkage (ligation), annealing of complementary strands of nucleic acid molecules and other ways of associating two or more nucleic acid molecules.

[0066] In one specific aspect of the disclosure, homologous sequences at the ends of the 5' and 3' polynucleotides to be joined are used to direct or mediate the joining event. A large number of methods accomplish such homology-dependent assembly (Lobban 1973), including linked tailing (Lathe 1984), In-Fusion cloning (Zhu 2007, Irwin 2012), Sequence and LigationIndependent Cloning (SLIC, Li 2007, Li 2012), FastCloning (Li 2011), Circular Polymerase Extension Cloning (Quan 2009, Quan 2011), the Gibson assembly method (Gibson 2009, Gibson 2010), Quick and Clean Cloning (Thieme 2011), and others (Vroom 2008).

[0067] Typically, individual clones of enzyme coding sequences, inserted into a cloning vector or expression vector of choice, are sequence verified before their use in protein expression. Sequence verification uses the Sanger sequencing process applied to purified plasmid DNA in combination with oligonucleotide primers recognizing specific sequences in the enzyme coding sequence or the cloning vector I expression vector.

[0068] Plasmid molecules suitable for encoding the polynucleotides encoding enzymes described in the present disclosure include high-copy, low-copy or single-copy plasmids. In E. coli, an example of a high-copy plasmid is one carrying the pMBl origin of replication such as the pUC plasmids and their derivatives (Yanish-Perron 1985); medium-copy plasmids include those based on the pl5A / pACYC, RK2 (Meyer 1975, Schmidhauser 1983, Schmidhauser 1985) or RSF1010 plasmid backbones (Chang 1978, Bagdasarian 1981, Tsygankov 1985, Rose 1988); low-copy plasmids include mini-F' plasmids such as those based on pBeloBACll (Shizuya 1992). Some of these plasmids are very species-specific while others are capable or replication in multiple bacterial species. For example, plasmids RK2 and RSF1010 are capable of replication in all species of gram negative bacteria.

[0069] When expressing two different proteins in the same bacterial strain, it is possible to encode the two proteins on different plasmids or alternatively on the same plasmid. When using different plasmids, the two plasmids contain different replicons that are compatible with one another, meaning that both are maintained in the same cell. Such simultaneous maintenance of two plasmid types in a single bacterial cell is often facilitated by the presence of different antibiotic-resistance markers on the two plasmids.

[0070] For stable integration of fusion polynucleotides on the bacterial chromosome, a number of genome engineering methods are used to randomly or precisely place a fusion polynucleotide, linked to a promoter and terminator, into chromosomal locations (Schweizer 2008, Madyagol 2011, Leprince 2012, Richter 2012, Jeong 2013). Common methods of inserting genes into the bacterial chromosome include spontaneous random integration upon transformation, Pl phage transduction, bacteriophage lambda integration, site-specific integration, or other methods.

[0071] Promoters used for expression of fusion polynucleotides may be strong promoters that result in high levels of protein expression, or weak promoters that result in low levels of protein expression, or promoters of intermediate strength. Promoters may also be constitutive, being expressed in all or most cells and in all or most stages of growth, or specific promoters whose activity depends on specific growth states or metabolic states. Inducible promoters, whose activity depends on the presence of a specific chemical or metabolite or growth condition which induces the promoter to be active, or repressible promoters, which are shut off or reduced in activity in the presence of a specific chemical or metabolite or growth condition are also suitable. For example, a synthetic gene encoding am RNA polymerase of interest is expressed using a promoter that is inducible by arabinose in the culture medium, with low or no promoter activity in the absence of arabinose. Such arabinose-inducible promoters are frequently used for expression of proteins in E. coli. Another aspect of the disclosure uses a promoter identical to or a derivative of the bacterial lac promoter that is inducible with the synthetic lactose analog isopropyl P-D-l-thiogalactopyranoside (IPTG). In another aspect of the disclosure, promoters are used that are induced under conditions of abiotic stress or in the presence of toxic and growth-inhibiting compounds in the growth medium. The strength of the promoter can be varied to create the optimal environment for expression of soluble, active recombinant protein - this can be determined empirically for each recombinant protein.

[0072] Terminators used for expression of fusion polynucleotides also vary in their activity. The function of a terminator in gene expression is in completing the transcription process and influencing mRNA half-life. Expression cassettes of fusion polynucleotides contain either strong or weak terminators or terminators of intermediate activity that predispose an mRNA to high, low or intermediate levels of stability. Such terminators are suitable for pairing with strong, weak or intermediate promoters to achieve a desirable level of gene expression.

[0073] In order to accomplish high-level expression, many gene signals must be optimized. Typically, the gene is inserted immediately downstream of a strong E. coli promoter that will result in large quantity of transcript. This promoter can be constitutive or inducible. Examples of inducible promoters are the T7 bacteriophage promoter and the arabinose promoter although many more examples are found in the literature. Inducible promoters allows for the controlled expression of the product of interest. When using the T7 bacteriophage promoter, E. coli strains are often used that contain an integrated copy of the T7 RNA polymerase under control of the bacterial lac promoter (inducible by IPTG). An example of such a strain is the E. coli protein expression strain BL21(DE3).

[0074] In addition to a promoter, the target gene must contain a sequence of nucleotides called a ribosome binding site (or Shine Delgamo sequence in bacteria) immediately upstream of the start of the coding region. Numerous ribosome binding sites have been identified in the literature, and these tend to be purine-rich. High level expression is also potentiated by insertion of a transcription termination site immediately downstream of the coding region of the target gene. Many transcription termination sites have been reported in the literature and are used for this purpose.

[0075] Nucleic acid sequences encoding an enzyme of interest are used to express protein in one of two general ways: in vitro using a cell-free system and in vivo using a host organism. In both cases, a nucleic acid template molecule generated by cloning or PCR amplification from a synthetic gene is used to direct expression of the RNA polymerase of interest.

[0076] Cell-free expression systems have multiple advantages over use of live expression hosts, including fast reaction times, high reproducibility, high yield in small reactions, relatively high starting purity of the protein of interest, and independence of toxic effects of the expressed protein. The relatively low complexity of proteins present in these reactions allows rapid and accurate assessment of translation efficiency of each candidate enzyme. However, cell-free expression systems are expensive and do not scale as easily as in vivo expression systems.

[0077] Expressing a protein or an enzyme using a cell-free expression system uses the following procedure, or a variant thereof. Each sequence-verified enzyme coding sequence is joined at its 5’ end to a sequence encoding a suitable promoter (for example the T7 promoter), a 5’ untranslated sequence (5’ UTR) (for example the T7 5’ UTR), including a translation initiation sequence, and at its 3’ end to a sequence encoding a 3’ untranslated sequence (3’ UTR) and a suitable terminator. The sequences are joined using any cloning or sequence assembly methods known to those trained in the art, including the methods listed above. A promoter, 5 ’ UTR and translation initiation site can also be incorporated into a nucleic acid sequence encoding an enzyme by PCR amplification, by incorporating the promoter, 5 ’ UTR and translation initiation site into the 5’ PCR primer. A 3’ UTR and terminator can also be incorporated into a nucleic acid sequence encoding an enzyme by PCR amplification, by incorporating the 3 ’ UTR and terminator into the 3 ’ PCR primer.

[0078] The nucleic acid molecule suitable for cell-free protein expression that results from the sequence assembly described in the preceding paragraph will result in a nucleic acid molecule comprising a promoter, 5’ UTR, translation initiation site, enzyme ORF, 3’ UTR and terminator.

[0079] The nucleic acid molecule suitable for cell-free protein expression is then combined with a commercially available cell-free expression system, or a custom-made cell free expression system, to express the enzyme of interest. Commercially available expression systems include coupled in vitro transcription / translation systems that use prokaryotic cell extracts derived from E. coli and / or E. coli infected with bacteriophages. Others use cell extracts derived from rabbit reticulocytes or wheat germ.

[0080] For protein expression using a live expression host, the following general procedure is followed. Once the enzyme coding sequence has been inserted into an expression vector and the sequence has been verified, the resulting nucleic acid construct must be introduced into a protein expression host of interest. The expression host can be any organism capable of protein synthesis, including E. coli, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Bacillus subtilis, Pseudomonas fluorescens, other Pseudomonas species, other species of bacteria, other species of yeast, filamentous fungi for example those in the genera Aspergillus or Trichoderma, cultured insect cells or cultured mammalian cells.

[0081] The expression vector construct is introduced into a suitable expression host by chemical transformation methods (i.e. transformation facilitated by calcium chloride or other cations, polyethylene glycol, dimethyl sulfoxide), or by physical transformation methods (i.e. electroporation), or by combinations thereof.

[0082] There is a wide choice of bacterial strains for expression. Important features of the host strain include compatibility with the promoter system (i.e. T7 RNA polymerase needs to be present in the host strain when using the T7 promoter driving expression of the target protein), presence (or absence) of potentially protein-destroying proteases, presence or absence of additional elements to facilitate expression of the target such as chaperones, is considered. In many instances, the overexpression of a recombinant protein yields a product that during protein synthesis folds in an aberrant fashion such that its product is insoluble and precipitates out in a structure called an inclusion body. Protein produced in this manner are, by definition, inactive and do not retain their normal enzymatic or structural activities.

[0083] Overexpression of the target protein of interest is then accomplished by growing the bacteria in optimal media (rich media such as Luria-Bertani medium or minimal media such as M9 medium) at a temperature optimal for the expression of the target protein (37°C, 30°C, room temperature, 20-25°C, 18°C and 15°C are all commonly used). The medium may contain an inducer molecule (for example arabinose or IPTG) that activates an inducible promoter. The inducer molecule is added at a specific time during cultivation, for example when the culture has reached a specific optical density, in order to induce the target protein of interest at that time.

[0084] The cells are then cultured on a shaker for an appropriate amount of time to ensure optimal expression of recombinant protein. The culturing time can be anywhere between 30 minutes and 144 hours, including 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 10 hours, 12 hours, 24 hours, 36 hours, 48 hours, 60 hours, 72 hours, 96 hours, 120 hours and 144 hours or any time in between). The culturing time after adding an inducer molecule can vary anywhere between 10 minutes and 144 hours, including 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 10 hours, 12 hours, 24 hours, 36 hours, 48 hours, 60 hours, 72 hours, 96 hours, 120 hours and 144 hours or any time in between).

[0085] Cells are harvested by centrifugation, resuspended in a suitable lysis buffer, the cells are lysed and target protein recovered and purified by any of numerous methods to isolate recombinant protein.

[0086] Cell lysis methods include physical methods (sonication, French press, mortar and pestle grinding, dounce homogenizer, disruption in a waring blender, lysis by freeze-thaw, shaking with glass beads), enzymatic methods (i.e. cell treatment with lysozyme), chemical methods (i.e. cell treatment with acids, bases, detergents or combinations thereof), or combinations thereof.

[0087] For protein purification, if target protein is in native form (i.e. does not contain purification facilitation tags), target protein are separated from the E. coli host proteins by a number of chromatography steps optimized for the protein of interest. When the target protein contains a purification tag, columns or magnetic beads containing material to specifically bind the tag is used to separate the target from the host proteins. In either instance the target protein is then specifically eluted to obtain more highly purified product.

[0088] Often, recombinant protein is folded incorrectly during its synthesis. Reasons for incorrect folding include speed of expression in E. coli (compared with the organism the protein is encoded by), lack of folding assisting chaperones or similar foldases, or specific interactions with host proteins not encountered in the native organism. Incorrect folding often leads to recombinant protein becoming insoluble in the host cytoplasm and precipitating out from the host cell lysate during purification. Such protein precipitates often form visual particles within the cell that are referred to as inclusion bodies. Protein produced in insoluble or precipitated form that does not fold correctly will not retain its normal enzymatic or structural activity.

[0089] Purification of proteins incorporating His-tags relies on immobilized metal affinity chromatography, in which transition metal ions are immobilized on a resin matrix using a chelating agent such as iminodiacetic acid. Ni2+ is the most frequently used ion for purification of a his-tagged recombinant protein is, although Co2+, Cu2+, and Zn2+ are also used. The His-tag has a high affinity for these metal ions and binds strongly to chelating resin. Most other cellular proteins will not bind to the resin, or will bind only weakly. The combination of a His-tag and immobilized metal affinity chromatography enables rapid generation of pure protein from a crude lysate.

[0090] Imidazole competes with the his-tag for binding to the metal-charged resin and thus is used for elution of the protein from an IMAC column. Typically, a low concentration of imidazole is added to both binding and wash buffers to interfere with the weak binding of other proteins and to elute any proteins that weakly bind. His-tagged protein is then eluted with a higher concentration of imidazole.

[0091] Ni2+ is most commonly used for his-tag purification since it gives a high yield. Using Co2+ can give higher purity but with a lower yield. Bio-Rad has his-tag resins and his-tag purification kits that are precharged with Ni2+ for fast, easy his-tag protein purification. Uncharged resins and kits that can be charged with Co2+ or other divalent or trivalent metal ions are also available. Uncharged kits give users the option of trying different metals to determine if one gives higher purity or yield for a particular his-tagged recombinant protein.

[0092] After a protein has been purified, its purity and concentration is assessed using a number of methods, including SDS-polyacrylamide gels.

[0093] A purified RNA polymerase is tested in in vitro transcription reactions in order to optimize its activity and assess its ability to produce RNA under a variety of conditions. In vitro transcription reactions typically contain buffers and salts, a divalent cation such as Mg+2, a nucleic acid template molecule, at least four nucleotide triphosphates (ATP, CTP, GTP and UTP), and the RNA polymerase enzyme. In vitro transcription reactions are typically run between 20 °C and 42 °C for 30 minutes to 6 hours.

[0094] The nucleic acid template molecule present in an in vitro transcription reaction serves as a template for synthesis of the RNA by an RNA polymerase. In one aspect-of the disclosure, the nucleic acid template molecule is a double-stranded DNA molecule. The nucleic acid template molecule typically contains a promoter sequence recognized by a particular singlesubunit RNA polymerase, and additional sequence downstream of the promoter. The sequence downstream of the promoter can encode a structural RNA or a protein. The sequence downstream of the promoter can vary in length between 50 base pairs and 100 kilobases, for example 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, 10000, 20000, 30000, 40000, 50000, 60000, 70000, 80000, 90000, 100000 base pairs or any length in between.

[0095] The promoter sequence contained in the nucleic acid template molecule present in an in vitro transcription reaction is often specific to a particular single-subunit RNA polymerase and needs to be predicted or discovered to allow the RN polymerase to be tested in in vitro transcription reactions. The promoter sequence recognized by a specific single-subunit RNA polymerase is discovered through one or more of several bioinformatic or molecular genetic methods. The bioinformatics methods include alignments of sequences found upstream of open reading frames in bacteriophage genomes encoding single-subunit RNA polymerases and sequence motif searches within sequences found upstream of open reading frames in bacteriophage genomes encoding single-subunit RNA polymerases. An example of a molecular genetic method is the generation of sequence data from reverse transcribed RNAs derived from in vitro transcription reactions containing a specific RNA polymerase and genomic DNA from the bacteriophage that encodes the polymerase, or from a closely related bacteriophage, followed by alignment of the resulting sequence data to the bacteriophage genome sequence and deduction of the location of the promoter and its sequence. Other examples of molecular genetic methods are DNAse I protection assays, run-off in vitro transcription assays using fragments of a bacteriophage genome, and related methods.

[0096] The promoter sequence recognized by a particular single-subunit RNA polymerase is followed by one or more nucleotides that constitute the transcriptional start site of the polymerase (Imburgio 2000). The transcriptional start site often contains a purine residue that directs the placement of the first nucleotide in the RNA molecule. The transcriptional start site placed downstream of the promoter sequence may be critical for efficient RNA synthesis by the RNA polymerase (Imburgio 2000). Depending on the preferences of the particular singlesubunit RNA polymerase, the transcriptional start site may have any dinucleotide or trinucleotide sequence, such as GG, GA, GC, GT, AA, AC, AG, AT, CA, CC, CG, CT, TA, TC, TG, TT, GGG, GGA, GGC, GGT, GAA, GAC, GAG, GAT, etc. The transcriptional start site may be positioned immediately downstream of the promoter sequence, or separated from the promoter sequence by one or more nucleotides, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 nucleotides.

[0097] The reaction conditions of an in vitro transcription reaction is varied in order to determine specific properties of a single-subunit RNA polymerase or optimize the activity of such enzyme. For example, the reaction pH can vary from acidic (pH 4.0-6.5), neutral (pH 6.58.0) or basic (pH 8.0-10.0), or any values within these ranges or in between.

[0098] The in vitro transcription reaction contains one or more divalent cations required for RNA polymerase activity, such as Ca+2, Mg+2, Mn+2, Co+2, Zn+2 or others, or any combinations thereof. The concentration of the divalent cation can vary, for example from InM to lOOmM or any concentration in between. The divalent cations added to the reaction can be in the form of various salts thereof, such as Cl- salts, acetate salts or other salts used in molecular biology.

[0099] The in vitro transcription reaction contains buffering agents such as Tris, HEPES, PIPES, acetate or other buffering agents used in molecular biology. Other salts can be present in the reaction mixture, such as NaCl, KC1, LiCl, sodium acetate, potassium acetate, lithium acetate or any other salts commonly used in molecular biology or any combinations thereof. These salts are present in the reaction in any concentration ranging from OmM to 2M.

[00100] The in vitro transcription reaction contains various nucleotide triphosphates, minimally the set of four natural ribonucleotide triphosphates ATP, CTP, GTP and UTP. Nonnatural or modified nucleotide triphosphates may also be present, such as 2’-0Me NTPs, 2’-F NTPs, pseudo-UTP, 5-methyl-CTP or any of a number of other modified nucleotides (Padilla 2002, Kariko 2008, Siegmund 2012, Sahin 2014, Andries 2015, Meyer 2015, Sergeeva 2016, Pardi 2017, Potapov 2018). Nucleotides are present in the reaction at concentrations ranging from InM to 50mM.

[00101] The in vitro transcription reaction can also contain polyamines such as spermidine and spermine or diamines such as putrescine and cadaverine, present in concentrations ranging from 0 to 10 mg / ml.

[00102] The in vitro transcription reaction can also contain 5’-capping compounds or dinucleotide caps designed to stabilize the 5 ’ end of the RNA against degradation, or to give it specific properties such as a high efficiency of translation in a specific organism. Capping compounds often have a dinucleotide structure such as 7-methyl-guanosine triphosphateguanosine (m7GpppG) but can have other sequences and structures, including various modification of the ribose moieties or bases in the dinucleotide cap (Konarska 1984, Darzynkiewicz 1988, Pasquinelli 1995, Stepinski 2001). A capping compound can contain any sequence of two nucleotides, such as G-G, G-A, G-C, G-I, G-T, G-U, A-A, A-C, A-G, A-I, A-T, A-U, C-A, C-C, C-G, C-I, C-T, C-U, T-A, T-C, T-G, T-I, T-T, T-U, U-A, U-C, U-G, U-I, U-T, U-U, or any other dinucleotide sequence. The two nucleotides in the capping compound can be linked by any linkage or bond, such as the triphosphate linkage found in m7GpppG, monophosphate linkages, diphosphate linkages, phosphorothioate linkages, or any other chemical group or covalent bond linking the two nucleotides. Each nucleotide in the cap may be modified by methylation such as the 7-methyl-guanosine residue fond in m7GpppG, or by any other modification of the nucleotide, whether present on the ribose moiety or the base moiety (Pasquinelli 1995, Stepinski 2001). Capping compounds may contain more than two nucleotides, such as 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, 500, 600, 700, 800, 900 or 1000 nucleotides in length, or any length in between, containing any sequence of nucleotides linked in any manner and containing any nucleotide modifications. Capping compounds can be present in the reaction at concentrations ranging from 0 to lOOmM.

[00103] The in vitro transcription reaction can also contain other proteins such as bovine serum albumin, gelatin, milk proteins, and / or hydrolysates thereof, as stabilizers of the RNA polymerase or modifiers of RNA polymerase activity. These proteins are present in concentrations ranging from Opg / ml to 20 mg / ml.

[00104] The in vitro transcription reaction can also contain soluble polysaccharides such as starch, modified starch, glycogen, pectin, xanthan gum, dextran, welan gum, gellan gum, diutan gum, alginate, agar, agarose and pullulan. These polymers may be present in concentrations ranging from Opg / ml to 20 mg / ml.

[00105] The in vitro transcription reaction can also contain other polymers used in molecular biology as crowding agents and enzyme stabilizers, such as polyethylene glycol (PEG), polyvinyl pyrrolidone (PVP), dextran sulfate and others used in molecular biology, present in concentrations ranging from Opg / ml to 20 mg / ml.

[00106] The in vitro transcription reaction can also contain sugars as osmotic agents or stabilizers such as sorbitol, mannitol, sucrose, trehalose, or any other mono- or disaccharide, present in concentrations of 0 to IM.

[00107] The in vitro transcription reaction can also contain molecules such as glycerol, betaine (trimethylglycine), dimethylsulfoxide or trehalose that are used in molecular biology as antifreeze compounds, enzyme stabilizers and modulators of enzyme activity, present at concentrations of 0 to 2M.

[00108] The in vitro transcription reaction can also contain destabilizers of base pairing such as formamide or urea.

[00109] The in vitro transcription reaction can also contain wetting agents or detergents such as Nonidet P40, Tween20, Triton X-100 or any other detergent used in molecular biology, present at concentrations of 0 to 10 mg / ml.

[00110] The in vitro transcription reaction is incubated at various temperatures ranging from 10°C to 80°C, 18°C to 50°C, 10°C to 50°C, 10°C to 20°C or any temperature in between, such as 18°C, 24°C, or 37°C, to name but a few.

[00111] The in vitro transcription reaction is run for an amount of time as low as 5 minutes ranging to 48 hours, or any time in between.

[00112] The RNA generated in an in vitro transcription reaction is characterized for its length, sequence, amount of double-stranded RNA and ability to serve as template for synthesis of active protein using a variety of methods developed for RNA analysis. Agarose gel electrophoresis methods are used to estimate the RNA amount and characterize its size distribution. Commercially available systems for nucleic acid analysis such as the Agilent Bioanalyzer are also used to determine RNA size and estimate RNA amounts. The uniformity of the size distribution of an RNA sample is estimated in the same manner, using either agarose gel electrophoresis or a Bioanalyzer, or related methods.

[00113] RNA sequence is determined by reverse transcribing RNAs synthesized by a particular RNA polymerase and sequencing the resulting DNA molecules by any of a variety of sequencing methods, including Sanger sequencing, pyrosequenceing, nanopore sequencing, sequencing by ligation, sequencing by synthesis, and any other next-generation, 2nd-generation or 3rd-generation sequencing systems such as those produced by Illumina Corporation, Ion Torrent Inc, Oxford Nanopore or equivalent.

[00114] The amount of double-stranded RNA is determined using RNA blots or dot blots employing antibodies developed for this purpose (Weber 2006, Son 2015, Monsion 2018), such as the dsRNA-specific monoclonal antibody mAb J2 (Schbnbom 1991, Zangger 2013, available from Millipore Sigma, Burlington, MA) or commercially available kits (sold by Cisbio).

[00115] The ability of RNA produced by an RNA polymerase in an in vitro transcription reaction to serve as template for synthesis of active protein requires that a protein be encoded by the DNA molecule that serves as a template for RNA synthesis. For example, if the template contains the open reading frame encoding a gene or enzyme which is detected biochemically or enzymatically, then an in vitro translation system is used to translate the RNA generated in vitro and the completed translation reaction assayed to detect the protein encoded by the template. For example, if the template DNA molecule encodes a firefly luciferase enzyme, then RNA produced from a specific template molecule by an RNA polymerase is translated in a suitable in vitro translation system (for example translation systems based on extracts prepared from wheat germ or from rabbit reticulocytes), and the completed translation reaction assayed for luciferase activity.

[00116] The propensity of an RNA synthesized by an RNA polymerase from a DNA template that encodes a protein to be translated into active protein is dependent on the qualities of the RNA polymerase and the degree to which the RNA polymerase is capable of generating full-length transcripts that contain the entire protein coding sequence, the transcriptional fidelity of the RNA polymerase and the absence of additional transcribed sequences that may inhibit translation of the RNA. This propensity is referred to as the translational capacity of the RNA. Translational capacity can be measured by in vitro translation of an RNA or by in vivo translation of the RNA after introducing it into a cell or organism. RNA polymerases that synthesize RNAs with high translational capacity are desirable because the ultimate utility of an RNA is to direct synthesis of an active protein encoded by the RNA. While some polymerases efficiently generate RNA in vitro from a DNA template, this RNA may have low translational capacity which lowers the value and utility of the RNA polymerase.

[00117] The protein sequences of the RNA polymerases described in this disclosure are given in SEQ ID NO: 1 to 41. The same protein sequences, joined to a His6 N-terminal tag and a short Gly-Ser linker sequence, are given in SEQ ID NO: 42 to 82. The promoter sequences recognized by these enzymes are given in SEQ ID NO: 83 to 123. The RNA polymerases encoded by Cyanophage Syn5 (SEQ ID NO: 9 and 50), Salmonella virus SP6 (SEQ ID NO: 16 and 57), Enterobacteria phage T3 (SEQ ID NO: 35 and 76) and especially Escherichia phage T7 (SEQ ID NO: 41 and 82) have been previously isolated and characterized and represent known control RNA polymerases among the enzymes described in this disclosure (Butler 1982, McGraw 1985, Studier 1986, Zhu 2013, Zhu 2014).

[00118] The sequences of template molecules for the enzymes described in this disclosure and containing, from the 5’ to the 3’ end, the promoter sequences, a 5’ UTR, a Shine-Delgamo sequence, an open reading frame encoding firefly luciferase and the bacteriophage lambda tl terminator are given in SEQ ID NO: 124 to 164. The length of the template molecules given in SEQ ID NO: 124-164 ranges between 1815 and 1845 bp in length and the RNAs encoded by each are roughly 1800 bases in length. The identities of each promoter and template sequence in terms of their correspondence to each of the enzymes listed in SEQ ID NO: 1-82 are given in Table 1 below. Table 1: SEQ ID NOs of all 41 RNA polymerases, promoter elements and template molecules Organism RNApol SEQ ID NO His-tagged RNApol SEQ ID NO Promoter SEQ ID NO Template SEQ ID NO Yersinia phage phiR8-01 1 42 83 124 Aeromonas phage phi AS 7 2 43 84 125 Aquamicrobium phage P14 3 44 85 126 Caulobacter phage Percy 4 45 86 127 Xanthomonas phage f30-Xaj 5 46 87 128 Burkholderia phage Bp-AMP4 6 47 88 129 Pseudomonas phage Bf7 7 48 89 130 Pseudomonas phage Andromeda 8 49 90 131 Cyanophage Syn5 9 50 91 132 Pantoea phage LIMEzero 10 51 92 133 Acinetobacter phage Petty 11 52 93 134 Pantoea phage LIMElight 12 53 94 135 Erwinia amylovora phage Eral03 13 54 95 136 Proteus phage vB_PmiP_Pm5460 14 55 96 137 Proteus phage PM 93 15 56 97 138 Salmonella virus SP6 16 57 98 139 Lelliottia phage phD2B 17 58 99 140 Escherichia phage ECBP5 18 59 100 141 Delftia phage IME-DE1 19 60 101 142 Pseudomonas phage phi 15 20 61 102 143 Vibrio phage VP3 21 62 103 144 Vibriophage VP4 22 63 104 145 Vibrio phage ICP3_2008_A 23 64 105 146 Vibrio phage ICP3_2007_A 24 65 106 147 Vibrio phage N4 25 66 107 148 Cronobacter phage Dev2 26 67 108 149 Escherichia phage vB_EcoP_GA2A 27 68 109 150 Enterobacteria phage EcoDS 1 28 69 110 151 Morganella phage vB_MmoP_MP2 29 70 111 152 Yersinia phage Yepe2 30 71 112 153 Kluyvera phage Kvpl 31 72 113 154 Klebsiella phage KI 1 32 73 114 155 Klebsiella phage KP32 33 74 115 156 Klebsiella phage vB_KpnP_KpV766 34 75 116 157 Enterobacteria phage T3 35 76 117 158 Serratia phage SM9-3Y 36 77 118 159 Yersinia phage YpP-R 37 78 119 160 Pectobacterium phage PP99 38 79 120 161 Aeromonas phage 25AhydR2PP 39 80 121 162 Stenotrophomonas phage IME15 40 81 122 163 Escherichia phage T7 41 82 123 164 Examples: Example 1: Recombinant RNA polymerase expression in E. coli.

[00119] RNA polymerase genes are designed with six histidine tag at their N-terminus (for example as in SEQ. ID. NOs 42-82) and cloned on a bacterial plasmid with an pMBl plasmid replicon conferring high copy number in E. coli. The plasmid has an arabinose inducible promoter and a Lambda T1 terminator. E. coli strain BL21 is transformed with the expression plasmid and a single colony picked for cultivation and protein expression. The bacterial cells are grown in LB medium at 37 °C to log phase culture and induced by addition of L-arabinose. After 5 hours of induction, the cultures are harvested by centrifugation and the collected E. coli cells are lysed by lysozyme treatment and sonication. RNA polymerase is purified with nickel affinity chromatography according to the metal resin manufacturer’s instructions (Qiagen, Germany). The RNA polymerase is eluted with 250mM imidazole solution, concentrated with Amicon Ultra-centrifugal filter (EMD Millipore, Burlington, MA, USA) and changed into a storage buffer composed of 50mM Tris pH 8.0, 75mM NaCl, O.lmM EDTA, lOmM P-mercaptoethanol and 50% glycerol. Example 2: Recombinant RNA polymerase expression in vitro using cell-free extracts

[00120] A T7 promoter and T7 terminator are added by PCR to the 5’ and 3’ ends, respectively, of a full-length open reading frame encoding an RNA polymerase, using primers encoding the T7 promoter and T7 terminator, respectively, to create an expression cassette suitable for in vitro protein expression. The PCR fragment is added to a commercially available E. co / z-based in vitro transcription and translation extract sold by Fisher Scientific. After incubation for protein expression according to the manufacturer’s instructions, the protein mixture is harvested and centrifuged. RNA polymerase is purified from the supernatant with nickel affinity chromatography according to the metal resin manufacturer’s instruction (Qiagen, Germany). The RNA polymerase is eluted with imidazole solution, concentrated with Amicon Ultra-centrifugal filter (EMD Millipore, Burlington, MA, USA) and changed into a storage buffer composed of 50mM Tris pH 8.0, 75mM NaCl, O.lmM EDTA, lOmM P-mercaptoethanol and 50% glycerol. Example 3: Characterization of RNAs produced with different RNA polymerases by in vitro transcription

[00121] The RNA polymerases tested in this example are compared to known RNA polymerases encoded by Cyanophage Syn5 (SEQ ID NO: 9 and 50), Salmonella virus SP6 (SEQ ID NO: 16 and 57), Enterobacteria phage T3 (SEQ ID NO: 35 and 76) and especially Escherichia phage T7 (SEQ ID NO: 41 and 82) which serve as controls in the datasets given below (Butler 1982, McGraw 1985, Studier 1986, Zhu 2013, Zhu 2014).

[00122] RNA is synthesized using a purified RNA polymerase at its permissive temperatures ranging from 18°C to 50°C. A 20pl in vitro transcription reaction using normal nucleotides is composed of 40mM Tris buffer, pH 7.9 at 25°C, 6mM MgC12, 5mM DTT, ImM of each NTP (ATP, CTP, GTP and UTP each), Ipg of RNA polymerase protein, 400ng of a linear, double-stranded DNA template and RNAase inhibitor (lU / ul). The linear, doublestranded DNA template has a promoter specific for the RNA polymerase near its 5 ’ end and upstream of an open reading frame encoding a firefly luciferase enzyme. The sequences of the DNA template molecules for each RNA polymerase are given in SEQ ID NO: 124-164, and the RNA transcribed from each is approximately 1800 nucleotides in length from transcription start site to the 3 ’ end of the molecule.

[00123] Alternatively, a 20pl in vitro transcription reaction is composed of 40mM Tris buffer, pH 7.9 at 25°C, 6mM MgC12, 5mM DTT, ImM of each NTP (ATP, CTP, GTP and UTP, with one NTP substituted for a modified nucleotide triphosphate), Ipg of RNA polymerase protein, 400ng of a linear, double-stranded DNA template and RNAase inhibitor (lU / ul). Modified nucleotide triphosphates include but are not limited to compounds such as 2’-O-methyl NTPs, 2’-fluoro NTPs, pseudouridine-5’-triphosphate, Nl-methylpseudouridine-5'-triphosphate and 5-methyl-cytidine-5’-triphosphate, which are either substituted for the corresponding NTP, or are added to the reaction replacing 50%-90% of the corresponding NTP.

[00124] The linear DNA template is generated by PCR reactions with the 5 ’ primer encoding a promoter sequence specific for the RNA polymerase.

[00125] The in vitro transcription reaction is incubated at its permissive temperature for 2 hours. A 3 pl - 10 pl aliquot of the reaction is electrophoresed on a 1% agarose gel together with RNA markers to visualize the synthesized RNA and estimate its size. Size uniformity of the RNA is assessed qualitatively on a scale from 1 to 4 from the intensity of the primary RNA band and any higher- or lower-molecular weight smears surrounding it, with a score of 1 being lower size uniformity and a score of 4 higher size uniformity. The remainder of the reaction is treated with DNAse I and electrophoresed in the same manner to clearly establish the identity of specific bands on the gel as RNA molecules. Examples of in vitro synthesized RNAs electrophoresed on agarose gels are shown in Figure 1.

[00126] To measure RNA yields resulting from in vitro transcription reaction, RNA generated using in vitro transcription reactions is purified using commercially available silica-based resins and eluted in low-salt Tris buffer. Specifically, the RNA Clean & Concentrator kit sold by Zymo Research Corporation (Irvine, CA, USA) is used according to the manufacturer’s instructions. The concentration of the eluted RNA is determined using a NanoDrop™ One / OneC Microvolume UV-Vis Spectrophotometer (Thermo Fisher Scientific) and total RNA yields are calculated by multiplying the RNA concentration by the volume of recovered RNA. Percentages of theoretical yields are calculated by dividing the RNA yield by 25.7 pg (the combined weights of 20 nmol each (1 mM x 20 pl) of AMP, CMP, GMP and UMP incorporated into RNA, using 329.2 g / mol for AMP, 305.2 g / mol for CMP, 345.2 g / mol for GMP and 306.2 g / mol for UMP) and converting to percentages.

[00127] A dot blot assay is used to determine double-stranded RNA (dsRNA) levels. RNA is spotted onto super-charged Nytran membrane (Millipore Sigma, Burlington, MA), dried, blocked with 5% non-fat dry milk in TBST buffer (50mM Tris-Hcl, 150mM NaCl, 0.05% Tween-20, pH7.4), and incubated with dsRNA-specific monoclonal antibody mAb J2 (Schbnbom 1991, Zangger 2013, available from Millipore Sigma, Burlington, MA, USA) for 60min. Membranes are washed 4 times with TBST and reacted with HRP conjugated secondary antibody, washed 5 times with TBST and detected with ECL Plus Western blot detection reagent (Millipore Sigma, Burlington, MA, USA). Images are captured with an Azure 600 digital imaging system (Azure Biosytems, Dublin, CA, USA). To determine the correspondence between signal intensity and dsRNA amounts in each sample, sense and antisense RNAs are produced using the same template sequence, quantitated with a NanoDrop™ One / OneC Microvolume UV-Vis Spectrophotometer (Thermo Fisher Scientific), combined in equal amounts and annealed in vitro, and different amounts tested in the dot blot assay. Such a quantitative experiment established the following relationship between dsRNA amounts and dot blot signal intensity: 50ng dsRNA:high signal; 17ng dsRNA:medium signal; 6ng dRNA: low signal; 2ng dsRNA: low signal.

[00128] To measure the translational capacity of in vitro transcribed RNA, the mRNA encoding firefly luciferase produced by the in vitro transcription reaction and purified with the RNA Clean & Concentrator kit (Zymo Research Corporation, Irvine, CA, USA) is translated in vitro and enzyme activity measured. One pg mRNA is added to a 20pl in vitro translation reaction mediated by wheat germ cell-free extracts (Promega Corporation, Madison, WI, USA), according to the manufacturer’s instructions. Five microliters of the in vitro translation reaction is mixed with luciferin substrate (Promega Corporation, Madison, WI, USA) and the bioluminescence is measured on a micro-titer plate reader (BioTek, Winooski ,VT, USA). Translation capacity of the RNA polymerase is calculated as the percentage of the bioluminescence produced by the RNA polymerase mRNA divided by the control mRNA provided in the wheat germ in vitro translation kit.

[00129] Activities of the 41 RNA polymerases are summarized in Table 2 and Table 3. N.T. = Not Tested. Table 2A: RNA yields and double-stranded RNA levels of RNAs transcribed in vitro with different RNA polymerases (absolute yields) Organism His-tagged RNApol SEQID NO RNA yield (pg, with Doublestranded RNA (24°C) Size uniformity natural NT] Ps) 18°C 24°C 37°C Yersinia phage phiR8-01 42 13.7 11.9 9.9 low 4 Aeromonas phage phiAS7 43 17.0 13.8 18.6 low 4 Aquamicrobium phage P14 44 0.0 0.8 1.9 low 2 Caulobacter phage Percy 45 3.7 6.2 8.2 medium 2 Xanthomonas phage f30-Xaj 46 12.9 12.0 8.8 low 4 Burkholderia phage Bp-AMP4 47 3.2 6.1 7.9 low 2 Pseudomonas phage Bf7 48 4.1 8.2 1.1 low 4 Pseudomonas phage Andromeda 49 17.2 14.8 11.9 low 4 Cyanophage Syn5 50 N.T. 1.4 0.3 medium 2 Pantoea phage LIMEzero 51 0.2 0.1 0.4 N.T. 1 Acinetobacter phage Petty 52 0.0 0.8 1.7 N.T. 2 Pantoea phage LIMElight 53 5.6 7.4 4.7 medium 4 Erwinia amylovora phage Eral03 54 N.T. 17.5 11.3 low 4 Proteus phage vB PmiP Pm5460 55 18.3 16.1 12.8 low 4 Proteus phage PM 93 56 11.1 7.2 9.5 high 4 Salmonella virus SP6 57 11.8 12.3 12.3 medium 4 Lelliottia phage phD2B 58 18.7 9.2 11.7 low 4 Escherichia phage ECBP5 59 15.9 13.7 9.4 low 4 Delftia phage IME-DE1 60 20.2 13.4 13.8 low 4 Pseudomonas phage phi 15 61 14.7 7.9 12.4 low 4 Vibrio phage VP3 62 17.3 7.2 10.3 low 4 Vibriophage VP4 63 12.4 14.5 17.8 low 3 Vibrio phage ICP3_2008_A 64 5.1 4.2 7.9 medium 1 Vibrio phage ICP3_2007_A 65 1.1 5.2 3.4 low 2 Vibrio phage N4 66 21.2 16.5 13.8 low 4 Cronobacter phage Dev2 67 1.1 6.1 4.6 low 1 Escherichia phage vB_EcoP_GA2A 68 11.2 7.3 10.0 low 4 Enterobacteria phage EcoDS 1 69 8.2 5.2 8.8 medium 3 Morganella phage vB MmoP MP2 70 18.4 19.1 11.1 high 4 Yersinia phage Yepe2 71 7.1 5.8 5.8 medium 1 Kluyvera phage Kvpl 72 4.6 4.1 4.7 medium 1 Klebsiella phage KI 1 73 12.5 7.7 9.6 high 3 Klebsiella phage KP32 74 11.2 8.1 8.1 high 4 Klebsiella phage vB KpnP KpV766 75 14.8 9.6 9.1 high 2 Enterobacteria phage T3 76 4.1 6.3 6.1 medium 3 Serratia phage SM9-3Y 77 5.7 9.2 12.3 medium 4 Yersinia phage YpP-R 79 6.8 8.3 9.2 high 2 Pectobacterium phage PP99 80 10.7 13.7 4.6 low 4 Aeromonas phage 25AhydR2PP 81 2.1 3.0 0.3 high 2 Stenotrophomonas phage IME15 82 13.0 18.4 13.8 medium 4 T7 bacteriophage (control) - 3.5 12.0 10.0 high 3 Table 2B: RNA yields and double-stranded RNA levels of RNAs tri different RNA polymerases (% of theoretical yie inscribed in vitro with ds) Organism His-tagged RNApol SEQID NO RNA yield (pg natural NT , with Ps) Doublestranded RNA (24°C) Size uniformity 18°C 24°C 37°C Yersinia phage phiR8-01 42 53% 46% 38% low 4 Aeromonas phage phiAS7 43 66% 54% 72% low 4 Aquamicrobium phage P14 44 0% 3% 7% low 2 Caulobacter phage Percy 45 14% 24% 32% medium 2 Xanthomonas phage f30-Xaj 46 50% 47% 34% low 4 Burkholderia phage Bp-AMP4 47 12% 24% 31% low 2 Pseudomonas phage Bf7 48 16% 32% 4% low 4 Pseudomonas phage Andromeda 49 67% 58% 46% low 4 Cyanophage Syn5 50 N.T. 5% 1% medium 2 Pantoea phage LIMEzero 51 1% 0% 2% N.T. 1 Acinetobacter phage Petty 52 0% 3% 7% N.T. 2 Pantoea phage LIMElight 53 22% 29% 18% medium 4 Erwinia amylovora phage Eral03 54 N.T. 68% 44% low 4 Proteus phage vB PmiP Pm5460 55 71% 63% 50% low 4 Proteus phage PM 93 56 43% 28% 37% high 4 Salmonella virus SP6 57 46% 48% 48% medium 4 Lelliottia phage phD2B 58 73% 36% 45% low 4 Escherichia phage ECBP5 59 62% 53% 37% low 4 Delftia phage IME-DE1 60 79% 52% 54% low 4 Pseudomonas phage phi 15 61 57% 31% 48% low 4 Vibrio phage VP3 62 67% 28% 40% low 4 Vibriophage VP4 63 48% 57% 69% low 3 Vibrio phage ICP3_2008_A 64 20% 16% 31% medium 1 Vibrio phage ICP3_2007_A 65 4% 20% 13% low 2 Vibrio phage N4 66 82% 64% 54% low 4 Cronobacter phage Dev2 67 4% 24% 18% low 1 Escherichia phage vB_EcoP_GA2A 68 44% 28% 39% low 4 Enterobacteria phage EcoDS 1 69 32% 20% 34% medium 3 Morganella phage vB MmoP MP2 70 72% 74% 43% high 4 Yersinia phage Yepe2 71 28% 23% 23% medium 1 Kluyvera phage Kvpl 72 18% 16% 18% medium 1 Klebsiella phage KI 1 73 49% 30% 37% high 3 Klebsiella phage KP32 74 44% 31% 31% high 4 Klebsiella phage vB KpnP KpV766 75 58% 37% 35% high 2 Enterobacteria phage T3 76 16% 25% 24% medium 3 Serratia phage SM9-3Y 77 22% 36% 48% medium 4 Yersinia phage YpP-R 79 26% 32% 36% high 2 Pectobacterium phage PP99 80 42% 53% 18% low 4 Aeromonas phage 25AhydR2PP 81 8% 12% 1% high 2 Stenotrophomonas phage IME15 82 50% 72% 54% medium 4 T7 bacteriophage (control) - 14% 47% 39% high 3 Table 3A: RNA yields and translational capacity of RNAs transcribed in vitro with different RNA polymerases (absolute yields) Organism RNApol SEQID NO His-tagged RNApol SEQ ID NO RNA yield (pg, with modified nucleotides) Translational capacity (24°C) Pseudo-UTP 5-Methyl-CTP Yersinia phage phiR8-01 1 42 9.1 9.3 116% Aeromonas phage phiAS7 2 43 8.9 8.9 103% Aquamicrobium phage P14 3 44 0.3 0.6 17% Caulobacter phage Percy 4 45 N.T. 1.8 42% Xanthomonas phage f30-Xaj 5 46 0.6 3.7 92% Burkholderia phage Bp-AMP4 6 47 0.3 1.5 99% Pseudomonas phage Bf7 7 48 1.7 3.1 63% Pseudomonas phage Andromeda 8 49 5.0 8.0 105% Cyanophage Syn5 9 50 0.6 0.8 74% Pantoea phage LIMEzero 10 51 0.2 0.1 N.T. Acinetobacter phage Petty 11 52 0.4 0.2 N.T. Pantoea phage LIMElight 12 53 3.1 7.0 9% Erwinia amylovora phage Eral03 13 54 6.2 8.6 60% Proteus phage vB PmiP Pm5460 14 55 7.1 10.2 118% Proteus phage PM 93 15 56 11.7 5.6 63% Salmonella virus SP6 16 57 0 11.7 80% Lelliottia phage phD2B 17 58 11.5 9.4 118% Escherichia phage ECBP5 18 59 7.5 11.4 93% Delftia phage IME-DE1 19 60 9.4 10.4 23% Pseudomonas phage phi 15 20 61 8.9 10.6 138% Vibrio phage VP3 21 62 10.8 10.1 66% Vibriophage VP4 22 63 14.8 3.8 36% Vibrio phage ICP3_2008_A 23 64 1.5 4.8 18% Vibrio phage ICP3_2007_A 24 65 0.3 0.1 15% Vibrio phage N4 25 66 9.8 10.3 59% Cronobacter phage Dev2 26 67 3.5 0.6 3% Escherichia phage vB_EcoP_GA2A 27 68 5.4 10.1 75% Enterobacteria phage EcoDS 1 28 69 4 7.5 34% Morganella phage vB MmoP MP2 29 70 8.4 9.3 73% Yersinia phage Yepe2 30 71 2.4 2.9 26% Kluyvera phage Kvpl 31 72 0.7 2.4 N.T. Klebsiella phage KI 1 32 73 9.2 8.3 29% Klebsiella phage KP32 33 74 3.3 8.6 4% Klebsiella phage vB KpnP KpV766 34 75 5.8 4.8 13% Enterobacteria phage T3 35 76 3.1 3.3 7% Serratia phage SM9-3Y 36 77 5.4 6.1 27% Yersinia phage YpP-R 38 79 4.6 4.0 31% Pectobacterium phage PP99 39 80 10.4 5.8 63% Aeromonas phage 25AhydR2PP 40 81 1.7 1.0 36% Stenotrophomonas phage IME15 41 82 8.1 6.5 60% T7 bacteriophage (control) - - 4.8 5.8 32% Table 3B: RNA yields and translational capacity of RNAs transcribed in vitro with different RNA polymerases (% of theoretical yields) Organism RNApol SEQID NO His-tagged RNApol SEQ ID NO RNA yield (pg, with modified nucleotides) Translational capacity (24°C) Pseudo-UTP 5-Methyl-CTP Yersinia phage phiR8-01 1 42 35% 36% 116% Aeromonas phage phi AS 7 2 43 35% 35% 103% Aquamicrobium phage P14 3 44 1% 2% 17% Caulobacter phage Percy 4 45 N.T. 7% 42% Xanthomonas phage f30-Xaj 5 46 2% 14% 92% Burkholderia phage Bp-AMP4 6 47 1% 6% 99% Pseudomonas phage Bf7 7 48 7% 12% 63% Pseudomonas phage Andromeda 8 49 19% 31% 105% Cyanophage Syn5 9 50 2% 3% 74% Pantoea phage LIMEzero 10 51 1% 0% N.T. Acinetobacter phage Petty 11 52 2% 1% N.T. Pantoea phage LIMElight 12 53 12% 27% 9% Erwinia amylovora phage Eral03 13 54 24% 33% 60% Proteus phage vB PmiP Pm5460 14 55 28% 40% 118% Proteus phage PM 93 15 56 45% 22% 63% Salmonella virus SP6 16 57 0% 45% 80% Lelliottia phage phD2B 17 58 45% 37% 118% Escherichia phage ECBP5 18 59 29% 44% 93% Delftia phage IME-DE1 19 60 37% 40% 23% Pseudomonas phage phi 15 20 61 35% 41% 138% Vibrio phage VP3 21 62 42% 39% 66% Vibriophage VP4 22 63 58% 15% 36% Vibrio phage ICP3_2008_A 23 64 6% 19% 18% Vibrio phage ICP3_2007_A 24 65 1% 0% 15% Vibrio phage N4 25 66 38% 40% 59% Cronobacter phage Dev2 26 67 14% 2% 3% Escherichia phage vB_EcoP_GA2A 27 68 21% 39% 75% Enterobacteria phage EcoDS 1 28 69 16% 29% 34% Morganella phage vB MmoP MP2 29 70 33% 36% 73% Yersinia phage Yepe2 30 71 9% 11% 26% Kluyvera phage Kvpl 31 72 3% 9% N.T. Klebsiella phage Kll 32 73 36% 32% 29% Klebsiella phage KP32 33 74 13% 33% 4% Klebsiella phage vB KpnP KpV766 34 75 23% 19% 13% Enterobacteria phage T3 35 76 12% 13% 7% Serratia phage SM9-3Y 36 77 21% 24% 27% Yersinia phage YpP-R 38 79 18% 16% 31% Pectobacterium phage PP99 39 80 40% 23% 63% Aeromonas phage 25AhydR2PP 40 81 7% 4% 36% Stenotrophomonas phage IME15 41 82 31% 25% 60% T7 bacteriophage (control) - - 19% 23% 32% References

[00130] Andries O, Me Cafferty S, De Smedt SC, Weiss R, Sanders NN, Kitada T (2015). N(l)-methylpseudouridine-incorporated mRNA outperforms pseudouridine-incorporated mRNA by providing enhanced protein expression and reduced immunogenicity in mammalian cell lines and mice. J Control Release 217:337-344.

[00131] Arai R, Ueda H, Kitayama A, Kamiya N, Nagamune T (2001). Design of the linkers which effectively separate domains of a bifunctional fusion protein. Protein Engineering 14 (8): 529-532.

[00132] Bagdasarian M, Lurz R, Ruckert B, Franklin FC, Bagdasarian MM, Frey J, Timmis KN (1981). Specific-purpose plasmid cloning vectors. II. Broad host range, high copy number, RSFlOlO-derived vectors, and a host-vector system for gene cloning in Pseudomonas. Gene 16(1-3):237-247.

[00133] Burnett JC, Rossi JJ, Tiemann K (2011). Current progress of siRNA / shRNA therapeutics in clinical trials. Biotechnol J. 6(9):1130-1146.

[00134] Butler ET, Chamberlin MJ (1982). Bacteriophage SP6-specific RNA polymerase. I. Isolation and characterization of the enzyme. J Biol Chern. 257(10):5772-5778.

[00135] Chang AC, Cohen SN (1978). Construction and characterization of amplifiable multicopy DNA cloning vehicles derived from the P15A cryptic miniplasmid. J Bacteriol. 134(3):1141-1156.

[00136] Chelliserrykattil J, Ellington AD (2004). Evolution of a T7 RNA polymerase variant that transcribes 2'-O-methyl RNA. Nat Biotechnol. 22(9):1155-1160.

[00137] Ge Q, Dallas A, Ilves H, Shorenstein J, Behlke MA, Johnston BH (2010). Effects of chemical modification on the potency, serum stability, and immunostimulatory properties of short shRNAs. RNA 16(1):118-130.

[00138] Darzynkiewicz E, Stepinski J, Ekiel I, Jin Y, Haber D, Sijuwade T, Tahara SM (1988). Beta-globin mRNAs capped with m7G, m2.7(2)G or m2.2.7(3)G differ in intrinsic translation efficiency. Nucleic Acids Res. 16(18):8953-62.

[00139] Gholamalipour Y, Karunanayake MA, Martin CT (2018). 3' end additions by T7 RNA polymerase are RNA self-templated, distributive and diverse in character - RNA-Seq analyses. Nucleic Acids Res.;46(18):9253-9263.

[00140] Gibson DG, Young L, Chuang RY, Venter JC, Hutchison CA 3rd, Smith HO (2009). Enzymatic assembly of DNA molecules up to several hundred kilobases. Nat Methods. 6(5):343-345.

[00141] Gibson DG, Smith HO, Hutchison CA 3rd, Venter JC, Merryman C. (2010). Chemical synthesis of the mouse mitochondrial genome. Nat Methods. 7(11):901-903.

[00142] Ibach J, Dietrich L, Koopmans KR, Nobel N, Skoupi M, Brakmann S (2013). Identification of a T7 RNA polymerase variant that permits the enzymatic synthesis of fully 2'-O-methyl-modified RNA. J Biotechnol. 167(3):287-295.

[00143] Imburgio D, Rong M, Ma K, McAllister WT (2000). Studies of promoter recognition and start site selection by T7 RNA polymerase using a comprehensive collection of promoter variants. Biochemistry 39(34):10419-10430.

[00144] Irwin CR, Farmer A, Wilier DO, Evans DH (2012). In-fusion® cloning with vaccinia virus DNA polymerase. Methods Mol Biol. 890:23-35.

[00145] Jackson AL, Burchard J, Leake D, Reynolds A, Schelter J, Guo J, Johnson JM, Lim L, Karpilow J, Nichols K, Marshall W, Khvorova A, Linsley PS (2006). Position-specific chemical modification of siRNAs reduces "off-target" transcript silencing. RNA 12(7):1197-1205.

[00146] Jeong J, Cho N, Jung D, Bang D (2013). Genome-scale genetic engineering in Escherichia coli. Biotechnol Adv. 31(6):804-810.

[00147] Kariko K, Muramatsu H, Welsh FA, Ludwig J, Kato H, Akira S, Weissman D (2008). Incorporation of pseudouridine into mRNA yields superior nonimmunogenic vector with increased translational capacity and biological stability. Mol Ther. 16(11):1833-1840

[00148] Kole R, Krainer AR, Altman S (2012). RNA therapeutics: beyond RNA interference and antisense oligonucleotides. Nat Rev Drug Discov. 11(2):125-140.

[00149] Konarska MM, Padgett RA, Sharp PA (1984). Recognition of cap structure in splicing in vitro of mRNA precursors. Cell 38(3):731-736.

[00150] Kraynack BA, Baker BF (2005). Small interfering RNAs containing full 2'-O-methylribonucleotide-modified sense strands display Argonaute2 / eIF2C2-dependent activity. RNA 12(1):163-176.

[00151] Layzer JM, McCaffrey AP, Tanner AK, Huang Z, Kay MA, Sullenger BA (2004). In vivo activity of nuclease-resistant siRNAs. RNA 10(5):766-771.

[00152] Lathe R, Kieny MP, Skory S, Lecocq JP (1984). Linker tailing: unphosphorylated linker oligonucleotides for joining DNA termini. DNA 3(2): 173-182

[00153] Leprince A, van Passel MW, dos Santos VA (2012). Streamlining genomes: toward the generation of simplified and stabilized microbial systems. Curr Opin Biotechnol. 23(5):651-658.

[00154] Li MZ, Elledge SJ. (2007). Harnessing homologous recombination in vitro to generate recombinant DNA via SLIC. Nat Methods. 4(3): 251-256.

[00155] Li C, Wen A, Shen B, Lu J, Huang Y, Chang Y. (2011). FastCloning: a highly simplified, purification-free, sequence- and ligation-independent PCR cloning method. BMC Biotechnol. 11:92.

[00156] Li MZ, Elledge SJ. (2012). SLIC: a method for sequence- and ligationindependent cloning. Methods Mol Biol. 852:51-59.

[00157] Lobban PE, Kaiser AD (1973). Enzymatic end-to end joining of DNA molecules. J Mol Biol. 78(3): 453-471.

[00158] Madyagol M, ALAlami H, Levarski Z, Drahovska H, Turha J, Stuchlrk S (2011). Gene replacement techniques for Escherichia coli genome modification. Folia Microbiol (Praha) 56(3):253-263.

[00159] Majlessi M, Nelson NC, Becker MM (1998). Advantages of 2'-O-methyl oligoribonucleotide probes for detecting RNA targets. Nucleic Acids Res. 26(9):2224-2229.

[00160] McGraw NJ, Bailey JN, Cleaves GR, Dembinski DR, Goeke CR, Joliffe LK, MacWright RS, McAllister WT (1985). Sequence and analysis of the gene for bacteriophage T3 RNA polymerase. Nucleic Acids Res. 13(18):6753-6766.

[00161] Meyer R, Figurski D, Helinski DR (1975). Molecular vehicle properties of the broad host range plasmid RK2. Science 190(4220):1226-1228.

[00162] Meyer AJ, Garry DJ, Hall B, Byrom MM, McDonald HG, Yang X, Yin YW, Ellington AD (2015). Transcription yield of fully 2'-modified RNA can be increased by the addition of thermostabilizing mutations to T7 RNA polymerase mutants. Nucleic Acids Res. 43(15):7480-7488.

[00163] Monsion B, Incarbone M, Hleibieh K, Poignavent V, Ghannam A, Dunoyer P, Daeffler L, Tilsner J, Ritzenthaler C (2018). Efficient detection of long dsRNA in vitro and in vivo using the dsRNA binding domain from FHV B2 Protein. Front Plant Sci. 9: 70.

[00164] Mu X, Greenwald E, Ahmad S, Hur S (2018). An origin of the immunogenicity of in vitro transcribed RNA. Nucleic Acids Res. 46(10): 5239-5249.

[00165] Padilla R, Sousa R (2002). A Y639F / H784A T7 RNA polymerase double mutant displays superior properties for synthesizing RNAs with non-canonical NTPs. Nucleic Acids Res. 30(24):el38.

[00166] Pardi N, Weissman D (2017). Nucleoside Modified mRNA Vaccines for Infectious Diseases. Methods Mol Biol. 1499:109-121.

[00167] Pasquinelli AE, Dahlberg JE, Lund E (1995). Reverse 5' caps in RNAs made in vitro by phage RNA polymerases. RNA 1(9):957-967.

[00168] Potapov V, Fu X, Dai N, Correa IR Jr, Tanner NA, Ong JL (2018). Base modifications affecting RNA polymerase and reverse transcriptase fidelity. Nucleic Acids Res. 46(11):5753-5763.

[00169] Quan J, Tian J (2009). Circular polymerase extension cloning of complex gene libraries and pathways. PLoS One. 4(7): e6441.

[00170] Quan J, Tian J (2011). Circular polymerase extension cloning for high-throughput cloning of complex and combinatorial DNA libraries. Nat Protoc. 6(2):242-251.

[00171] Regalado, A (2015). The Next Great GMO Debate. MIT Technology Review Aug 11, 2015. Available on the technologyreview website.

[00172] Richter K, Gescher J (2012); The molecular toolbox for chromosomal heterologous multiprotein expression in Escherichia coli. Biochem Soc Trans. 40(6):1222-1226.

[00173] Rose RE (1988). The nucleotide sequence of pACYC184. Nucleic Acids Res. 16(1):355.

[00174] Rossbach M (2010). Small non-coding RNAs as novel therapeutics. Curr Mol Med. 10(4):361-368.

[00175] Sahin U, Kariko K, Tiireci O (2014). mRNA-based therapeutics—developing a new class of drugs. Nat Rev Drug Discov. 13(10):759-780.

[00176] Sambrook, J., Fritsch, E. F., and Maniatis, T. (1989) Molecular Cloning: A Laboratory Manual, Second Ed., Cold Spring Harbor Laboratory Press, Plainview, New York.

[00177] Schmidhauser TJ, Filutowicz M, Helinski DR (1983). Replication of derivatives of the broad host range plasmid RK2 in two distantly related bacteria. Plasmid 9(3):325-330.

[00178] Schmidhauser TJ, Helinski DR (1985). Regions of broad-host-range plasmid RK2 involved in replication and stable maintenance in nine species of gram-negative bacteria. J Bacteriol. 164(1):446-455.

[00179] Schbnborn J, Oberstrass J, Breyel E, Tittgen J, Schumacher J, Lukacs N (1991). Monoclonal antibodies to double-stranded RNA as probes of RNA structure in crude nucleic acid extracts. Nucleic Acids Res. 19(11):2993-3000.

[00180] Schweizer H (2008). Bacterial genetics: past achievements, present state of the field, and future challenges. Biotechniques 44(5):633-641.

[00181] Sergeeva OV, Koteliansky VE, Zatsepin TS (2016). mRNA-Based Therapeutics -Advances and Perspectives. Biochemistry (Mose) 81(7):709-22.

[00182] Shizuya H, Birren B, Kim UJ, Mancino V, Slepak T, Tachiiri Y, Simon M (1992). Cloning and stable maintenance of 300-kilobase-pair fragments of human DNA in Escherichia coli using an F-factor-based vector. Proc Natl Acad Sci USA. 89(18):8794-8797.

[00183] Siegmund V, Santner T, Micura R, Marx A (2012). Screening mutant libraries of T7 RNA polymerase for candidates with increased acceptance of 2'-modified nucleotides. Chern Commun (Camb). 48(79):9870-9872.

[00184] Son KN, Liang Z, Lipton HL (2015). Double-stranded RNA Is detected by immunofluorescence analysis in RNA and DNA virus infections, including those by negative-stranded RNA viruses. J Virol. 89(18):9383-9392.

[00185] Stepinski J, Waddell C, Stolarski R, Darzynkiewicz E, Rhoads RE (2001). Synthesis and properties of mRNAs containing the novel "anti-reverse" cap analogs 7-methyl(3'-O-methyl)GpppG and 7-methyl (3'-deoxy)GpppG. RNA 7(10):1486-1495.

[00186] Studier FW, Moffatt BA (1986). Use of bacteriophage T7 RNA polymerase to direct selective high-level expression of cloned genes. J Mol Biol. 189(1):113-130..

[00187] Thieme F, Engler C, Kandzia R, Marillonnet S (2011). Quick and clean cloning: a ligation-independent cloning strategy for selective cloning of specific PCR products from nonspecific mixes. PLoS One 6(6): e20556

[00188] Tsygankov YD, Chistoserdov AY (1985). Specific-purpose broad-host-range vectors. Plasmid 14(2):118-125.

[00189] Vroom JA, Wang CL (2008). Modular construction of plasmids through ligation-free assembly of vector components with oligonucleotide linkers. Biotechniques 44(7): 924-926.

[00190] Wang R, Xue Y, Wu X, Song X, Peng J (2010). Enhancement of engineered trifunctional enzyme by optimizing linker peptides for degradation of agricultural by-products. Enzyme and Microb. Technol. 47 (5): 194-199.

[00191] Weber F, Wagner V, Rasmussen SB, Hartmann R, Paludan SR (2006). Doublestranded RNA is produced by positive-strand RNA viruses and DNA viruses but not in detectable amounts by negative-strand RNA viruses. J Virol. 80(10): 5059-5064.

[00192] Wilson C, Keefe AD (2006). Building oligonucleotide therapeutics using nonnatural chemistries. Curr Opin Chern Biol. 10(6):607-614.

[00193] Yanisch-Perron C, Vieira J, Messing J (1985). Improved Ml3 phage cloning vectors and host strains: nucleotide sequences of the M13mpl8 and pUC19 vectors. Gene 33(1):103-119.

[00194] Zangger H, Ronet C, Desponds C, Kuhlmann FM, Robinson J, Hartley MA, Prevel F, Castiglioni P, Pratlong F, Bastien P, Muller N, Parmentier L, Saravia NG, Beverley SM, Fasel N (2013). Detection of Leishmania RNA virus in Leishmania parasites. PLoS Negi Trop Dis. 7(l):e2006.

[00195] Zhu B, Cai G, Hall EO, Freeman GJ (2007). In-fusion assembly: seamless engineering of multidomain fusion proteins, modular vectors, and mutations. BioTechniques 43:354-359.

[00196] Zhu B, Tabor S, Raytcheva DA, Hernandez A, King JA, Richardson CC (2013). The RNA polymerase of marine cyanophage Syn5. J Biol Chern. 288(5):3545-3552.

[00197] Zhu B, Tabor S, Richardson CC (2014). Syn5 RNA polymerase synthesizes precise run-off RNA products. Nucleic Acids Res. 42(5):e33.

Claims

1. A method of performing in vitro transcription comprising the steps of(a) combining(i) a polypeptide having at least 95% amino acid sequence identity to an RNA polymerase (RNApol) molecule comprising the amino acid sequence of SEQ ID NO:23,(ii) a double-stranded DNA template comprising a promoter comprising the nucleotide sequence of SEQ ID NO:105, operatively linked to a polynucleotide encoding a protein or polypeptide; and(iii) one or more nucleotide triphosphates;(b) incubating the combination of (a) at a temperature from 10oC to 80oC; and(c) producing a transcript or a population of transcripts.

2. The method according to claim 1, wherein the sequence identity is 100%.

3. The method according to claim 1 or claim 2, wherein at least one of the nucleotide triphosphates is a modified nucleotide triphosphate.

4. The method according to claim 3, wherein at least one of the nucleotide triphosphates is selected from the group consisting of 2’-O-methyl NTPs, 2’-fluoro NTPs, pseudouridine-5’-triphosphate, 5-methyl-CTP, and N1-methylpseudouridine-5'-triphosphate.

5. The method according to any one of claims 1 to 4, wherein the temperature is 18oC to 50oC.

6. The method according to any one of claims 1 to 5, wherein the transcript or population of transcripts is at least 1 kb in length.

7. The method according to any one of claims 1 to 6, wherein the RNApol produces a transcript yield that is greater than that produced by T7 RNApol under the same in vitro transcription conditions.

8. The method according to any one of claims 1 to 7, wherein the RNApol produces a transcript yield that is at least two fold to five-fold greater than that produced by T7 RNApol under the same in vitro transcription conditions.2020283757   24 Mar 20269. The method according to any one of claims 1 to 7, wherein when using modified nucleic acids the RNApol produces a transcript yield that is at least two fold to three-fold greater than that produced by T7 RNApol under the same in vitro transcription conditions.

10. The method according to any one of claims 1 to 9, wherein a transcript or population of transcripts produced by the RNApol has less double-stranded RNA that that for transcripts produced with T7 RNApol under the same in vitro transcription conditions11. The method according to any one of claims 1 to 10, wherein the transcript or population of transcripts produced by the RNApol has a translational capacity that is at least 20% to 80% greater than that for transcripts produced with T7 RNApol under the same in vitro transcription conditions.

12. The transcript obtained by the method according to any one of claims 1 to 11 for use in the manufacture of a medicament, vaccine, or diagnostic agent.

13. An isolated nucleic acid molecule comprising:(a) a heterologous regulatory sequence capable of causing transcription and / or translation of a nucleotide sequence encoding a polypeptide having at least 95% to 100% amino acid sequence identity to SEQ ID NO:23; or(b) a nucleic acid which is a complement of the nucleotide sequence according to (a).

14. A vector construct comprising:(a) a first nucleic acid having a regulatory sequence capable of causing transcription and / or translation in a bacterium; and(b) a second nucleic according to claim 13.

15. The vector construct according to claim 14, wherein the first nucleic acid comprises a promoter and a terminator.

16. The vector construct according to claim 14 or claim 15, wherein the first nucleic acid is heterologous to the second nucleic acid.2020283757   24 Mar 202617. The vector construct according to any one of claims 14 to 16, wherein the first nucleic acid is a plasmid.

18. A host cell comprising a nucleic acid molecule according to claim 13 or the vector construct according to any one of claims 14 to 17.

19. A method of introducing an isolated nucleic acid or a vector construct into a host cell comprising:(a) providing an isolated nucleic acid molecule according to claim 13; or a vector construct according to any one of claims 14 to 17; and(b) contacting the isolated nucleic acid molecule with the host cell under conditions that permit insertion of the nucleic acid into the host cell.

20. The method according to claim 19, wherein the host cell is a bacterial cell.