Soybean GmJMT1 gene as well as encoding protein and application thereof

Abstract

The invention discloses a soybean GmJMT1 gene as well as an encoding protein and application thereof, the CDS sequence of the soybean GmJMT1 gene is shown as SEQ ID NO: 3 or SEQ ID NO: 5, the amino acid sequence of the encoding protein is shown as SEQ ID NO: 4 or SEQ ID NO: 6, and the soybean GmJMT1 gene and the encoding protein thereof can be used for reducing the plant height of a leguminous plant or increasing the pod number of a single leguminous plant. The invention finds that the mutated jasmonic acid anabolic pathway related gene GmJMT1 can simultaneously regulate and control the plant height and the pod number of a single plant, and the discovery of the new function of the soybean GmJMT1 gene provides a new gene target and resource for soybean genetic breeding.

Description

Technical Field

[0001] The present invention belongs to the technical field of crop genetic breeding, and in particular, relates to a soybean GmJMT1 gene and its encoding protein, as well as applications of the gene in reducing plant height of legumes or increasing the number of pods per legume plant. Background Art

[0002] Soybean [Glycine max (L.) Merr.] is an important leguminous crop. Mature soybean seeds contain about 40% protein and 20% oil, which can provide eight essential amino acids for humans. Therefore, soybean plays an important role in meeting the needs of human diet, animal feed and bio-oil, and is also widely used as a raw material for industrial products.

[0003] At present, China's soybean planting area is only 140 million mu, and the composite planting of soybeans and corn in strips is the key to solving the soybean gap. Soybeans are typical crops that are sensitive to light environments. Close planting and intercropping will cause soybeans to have obvious stem elongation and shade avoidance reactions, especially in high-latitude areas where the long-day-induced stem elongation effect is superimposed, which is more likely to cause lodging and yield reduction. At present, from the cultivation aspect, the growth and plant height of soybeans are mainly regulated by the reasonable application of nitrogen fertilizers, regulation of planting density, spraying of gibberellins, dwarfing agents, etc. From the aspect of genetic regulation, it will be a more economical and effective strategy to screen varieties with suitable plant heights, discover and utilize shade-tolerant genes related to regulating plant heights, and cultivate new varieties of densely planted and high-yield soybeans.

[0004] At present, the genes regulating soybean plant height are mainly concentrated on genes related to auxin and gibberellin (GA) synthesis and transport, such as LHY (Late elongated hypocotyl) gene, which increases internode elongation and plant height by increasing the level of active GA. GmRAV (Related to ABI3 / VP1) transcription factor inhibits GmGA3ox expression, resulting in limited GA biosynthesis and active GA formation, which ultimately limits soybean plant height. Soybean GmAP1 (APETALA1) gene has also been shown to control internode length and plant height by regulating GA metabolic pathway. GmDW1 (Dwarfmutant) encodes an enzyme in the early stage of GA biosynthesis pathway and participates in soybean plant height regulation. GmCRYs (Cryptochromes) activated by blue light significantly induce the accumulation of STFs (SoybeanTGACG-motif-binding Factor) protein. STFs bind to the G-box motif of the GmGA2ox gene promoter and promote its expression, thereby reducing endogenous gibberellin GA. 1 GA2ox8A / B also inhibits soybean stem elongation by reducing the active GA 1 and GA 4The content of phytochrome A inhibits soybean plant height. The plant phytochrome synthase GmHY2a (heme oxygenase) regulates internode length and plant height by affecting the auxin and GA pathways. The soybean phytochrome A suppressor gene SPA3 (Suppressor of phya 3) interacts with STF1 / STF2 and induces its degradation, resulting in the weakening of the induction effect of STF1 / STF2 on GA2ox7a / GA2ox7b, thereby increasing gibberellin GA 1 The content of GmILPA1 induces the elongation of soybean internodes and regulates plant height. The UV-B-dependent E3 ligase GmILPA1 regulates soybean plant height by mediating gibberellin metabolism. GmGBP1 / GmGAMYB promotes the expression of GmSAUR (Small auxin-up RNA), which binds to the promoter G-box motif of the gibberellin positive regulator GmGASA32 (Gibberellic acid-stimulatedArabidopsis), promoting the expression of this gene, and ultimately regulating soybean plant height and hypocotyl elongation.

[0005] Jasmonates represented by jasmonic acid (JA) and methyljasmonate (MeJA) are new plant hormones and new natural plant growth regulators. They are widely present in various plants, have multiple biological activities, and can cause multiple morphological or physiological effects. The inhibitor of the jasmonic acid pathway, JAZ (JasmonateZIM-domain) protein, is a key factor in regulating JA response. In Arabidopsis, JA can promote the degradation of JAZ protein, release the bound transcription factors such as MYC2, and thus initiate the transcription of JA response genes, ultimately leading to shortened hypocotyls and short plant height; while overexpression of JAZ protein promotes the elongation of Arabidopsis hypocotyls. Jasmonic acid (JA) can generate methyljasmonate (MeJA) through methylation. This process requires jasmonic acid carboxyl methyltransferase (JMT), which can balance the levels between jasmonic acid (JA) and methyljasmonate (MeJA). However, there are few reports on using JA pathway-related genes to regulate soybean plant height and create new soybean germplasm. Summary of the invention

[0006] Based on this, the object of the present invention is to provide a soybean GmJMT1 gene and its encoded protein which can be used to reduce the plant height of legume plants or increase the number of pods per legume plant after mutation.

[0007] The specific technical solutions for achieving the above-mentioned invention objectives include the following.

[0008] In a first aspect of the present invention, a soybean GmJMT1 gene is provided, and the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:5.

[0009] The second aspect of the present invention provides the use of the soybean GmJMT1 gene in reducing the plant height of legumes or increasing the number of pods per legume.

[0010] In a third aspect of the present invention, a protein encoded by the soybean GmJMT1 gene is provided, wherein the amino acid sequence of the encoded protein is shown in SEQ ID NO:4 or SEQ ID NO:6.

[0011] The fourth aspect of the present invention provides the use of the protein encoded by the soybean GmJMT1 gene in reducing the plant height of legumes or increasing the number of pods per legume plant.

[0012] In a fifth aspect of the present invention, a gene editing vector of the soybean GmJMT1 gene is provided, wherein the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:5.

[0013] The sixth aspect of the present invention provides the use of the transgenic vector of the soybean GmJMT1 gene in reducing the plant height of legumes or increasing the number of pods per legume plant.

[0014] In a seventh aspect, the present invention provides a method for reducing the plant height of a legume plant, comprising the steps of: allowing the legume plant to carry and effectively express the soybean GmJMT1 gene, wherein the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:5.

[0015] In an eighth aspect of the present invention, a method for increasing the number of pods per leguminous plant is provided, comprising the steps of: allowing the leguminous plant strain to carry the soybean GmJMT1 gene and effectively express it, wherein the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO: 3 or SEQ ID NO: 5.

[0016] The inventors of the present invention found that after the mutation of the jasmonic acid synthesis metabolic pathway-related gene GmJMT1, the mutant strains Gmjmt1-108 and Gmjmt1-201 obtained had significantly shorter hypocotyl length, significantly shorter plant height, and significantly reduced main stem node number compared to wild-type soybean materials, but significantly increased the number of pods per plant. Therefore, the mutated GmJMT1 gene of the present invention can simultaneously regulate soybean plant height and the number of pods per plant. The discovery of the new function of the soybean GmJMT1 gene provides new gene targets and resources for soybean genetic breeding. BRIEF DESCRIPTION OF THE DRAWINGS

[0017] Figure 1 The target site design of the GmJMT1 gene in the CRIPR / Cas9 gene editing system in Example 1 of the present invention and the mutation types of the two Gmjmt1 mutants obtained.

[0018] Figure 2 The results of the identification and comparison of the hypocotyl length phenotype of the WT strain and the Gmjmt1-108 and Gmjmt1-201 mutant strains in Example 2 of the present invention, A is the hypocotyl phenotype observation of the WT and Gmjmt1 mutant strains; B is the determination and comparison of the hypocotyl length of the WT and Gmjmt1 mutant strains, and the * and ** in the figure indicate significant differences at the 0.05 and 0.01 levels, respectively (t-test).

[0019] Figure 3 The phenotypic identification and comparison results of plant height, main stem node number and single pod number of WT strain and Gmjmt1-108 and Gmjmt1-201 mutant strains in Example 2 of the present invention, A is the plant height phenotypic observation of WT and Gmjmt1 mutant strains when they grew for one and a half months; B is the plant height measurement and comparison of WT and Gmjmt1 mutant strains when they grew for one and a half months; C is the phenotypic observation of plant height, main stem node number and single pod number of WT and Gmjmt1 mutant strains after maturity; D is the main stem node number measurement and comparison of WT and Gmjmt1 mutant strains after maturity; E is the measurement and comparison of the number of pods per plant of WT and Gmjmt1 mutant strains after maturity, and * and ** in the figure indicate significant differences at the 0.05 and 0.01 levels, respectively (t-test). DETAILED DESCRIPTION

[0020] In order to facilitate the understanding of the present invention, the present invention will be described more fully below. The present invention can be implemented in many different forms and is not limited to the embodiments described herein. On the contrary, the purpose of providing these embodiments is to make the understanding of the disclosure of the present invention more thorough and comprehensive.

[0021] Unless otherwise defined, all technical and scientific terms used in the present invention have the same meaning as those commonly understood by those skilled in the art to which the present invention belongs. The terms used in the specification of the present invention are only for the purpose of describing specific embodiments and are not intended to limit the present invention. The term "and / or" used in the present invention includes any and all combinations of one or more of the related listed items.

[0022] Unless otherwise specified, the examples are based on conventional experimental conditions, such as Sambrook et al. Molecular Cloning: a Laboratory Manual (Sambrook J & Russell DW, Molecular Cloning: a Laboratory Manual, 2013), or the conditions recommended by the manufacturer's instructions.

[0023] The present invention first designed two sgRNA target sites of the GmJMT1 gene, and successfully obtained two mutant strains of the GmJMT1 gene through genetic transformation through the CRISPR / Cas9 gene editing technology system, namely the Gmjmt1 mutant strains, which respectively lacked 3 bases and 18 bases in the coding region of the original GmJMT1 gene. After 10 days of germination, the length of the hypocotyls of the wild-type soybean material and the Gmjmt1 mutant material was observed and measured, and it was found that the length of the hypocotyls of the Gmjmt1 mutant material was significantly shorter than that of the wild-type soybean material. After growing for one and a half months under natural light conditions, the plant heights of the wild-type soybean material and the Gmjmt1 mutant material were observed and measured. Both biological experiments (the first half and the second half of 2024) found that the plant height of the Gmjmt1 mutant material was also significantly shorter than that of the wild-type soybean material. After harvest, a statistical analysis of the number of main stem nodes was performed, and it was found that the number of main stem nodes of the Gmjmt1 mutant material was significantly less than that of the wild-type soybean material (by regulating the number and length of soybean internodes, the height of soybean is ultimately regulated), but the number of pods per plant was significantly more than that of the wild-type soybean material.

[0024] In some embodiments of the present invention, a soybean GmJMT1 gene is disclosed, and the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO: 3 or SEQ ID NO: 5. SEQ ID NO: 3 and SEQ ID NO: 5 have 3 bases and 18 bases deleted respectively in the coding region of the original soybean GmJMT1 gene (nucleotide sequence shown in SEQ ID NO: 1, amino acid sequence shown in SEQ ID NO: 2).

[0025] In other embodiments of the present invention, the use of the soybean GmJMT1 gene in reducing the plant height of legumes or increasing the number of pods per legume is disclosed.

[0026] In other embodiments of the present invention, the encoded protein of the soybean GmJMT1 gene is disclosed, and the amino acid sequence of the encoded protein is shown in SEQ ID NO:4 or SEQ ID NO:6.

[0027] In other embodiments of the present invention, disclosed is the use of the protein encoded by the soybean GmJMT1 gene in reducing the plant height of legumes or increasing the number of pods per legume plant.

[0028] In other embodiments of the present invention, a transgenic vector of the soybean GmJMT1 gene is disclosed, and the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:5.

[0029] In other embodiments of the present invention, disclosed is the use of the transgenic vector of the soybean GmJMT1 gene in reducing the plant height of legume plants or increasing the number of pods per legume plant.

[0030] In some embodiments, the leguminous plant is a plant of the genus Glycine max, more preferably soybean.

[0031] In other embodiments of the present invention, a method for reducing the plant height of a legume plant is disclosed, the method comprising causing the legume plant to carry and effectively express the soybean GmJMT1 gene, wherein the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:5.

[0032] In other embodiments of the present invention, a method for increasing the number of pods per leguminous plant is disclosed, the method comprising causing the leguminous plant to carry the soybean GmJMT1 gene and effectively express it, wherein the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:5.

[0033] In some of the embodiments, the method includes the steps of: using SEQ ID NO:7 or SEQ ID NO:8 as the sgRNA target site, and using CRISPR / Cas9 editing technology to obtain a gene-edited plant of the soybean GmJMT1 gene, wherein the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:5.

[0034] In some embodiments, the leguminous plant is a plant of the genus Glycine max, more preferably soybean.

[0035] The present invention is described in detail below with reference to the accompanying drawings and specific embodiments.

[0036] Example 1 Construction of a gene editing vector for the soybean GmJMT1 gene and acquisition of a Gmjmt1 mutant strain

[0037] 1. RNA was extracted from HC-6 (Wildtype, WT) soybean variety (stored in the applicant's laboratory), and complementary deoxyribonucleic acid (cDNA) was obtained after reverse transcription. The coding sequence (CDS) of the GmJMT1 gene was obtained by polymerase chain reaction (PCR, primers F: ATGCAAACAACAACTCGAAGGA (SEQ ID NO: 9) and R: TCAACCTTGCTTGACGAGAGAA (SEQ ID NO: 10)) and sequencing. The nucleotide sequence is shown in SEQ ID NO: 1, and the amino acid sequence of the encoded protein is shown in SEQ ID NO: 2.

[0038] 2. According to the coding sequence (CDS) of the GmJMT1 gene, two specific sgRNA target sites (SEQ ID NO: 7 and SEQ ID NO: 8) located at the front end of the coding region of the GmJMT1 gene were designed, and the linkers were connected to design amplification primers (as shown in SEQ ID NO: 11 to SEQ ID NO: 12 and SEQ ID NO: 13 to SEQ ID NO: 14, respectively, see Table 1). Through the CRISPR / Cas9 gene editing technology system related vectors, a CRISPR / Cas9 vector carrying the GmJMT1 gene sgRNA target site was obtained through a one-step cloning method.

[0039] SEQ ID NO:7

[0040] GAGGAAAGAAATGGAAACGTTGG

[0041] SEQ ID NO:8

[0042] GTCATTTCGGAGATATTGGATGG

[0043] Table 1

[0044]

[0045]

[0046] 3. Genetic transformation method using Agrobacterium to infect soybean cotyledon nodes, the CRISPR / Cas9 vector carrying the sgRNA target site of the GmJMT1 gene was transformed into EHA105 Agrobacterium; HC-6 (Wild type, WT) soybean variety was used as the genetic transformation recipient material, and gene-edited plants were obtained through genetic transformation and tissue culture. After sequencing verification, two homozygous mutant Gmjmt1 mutant strains were finally obtained, namely Gmjmt1-108 (which lacked 3 bases in the coding region of the original GmJMT1 gene, the nucleotide sequence is shown in SEQ ID NO:3, and the amino acid sequence is shown in SEQ ID NO:4) and Gmjmt1-201 (which lacked 18 bases in the coding region of the original GmJMT1 gene, the nucleotide sequence is shown in SEQ ID NO:5, and the amino acid sequence is shown in SEQ ID NO:6) (the gene editing site is shown in SEQ ID NO:7). Figure 1 shown).

[0047] The CDS nucleotide and amino acid sequences of WT, Gmjmt1-108 and Gmjmt1-201 are as follows: SEQ ID NO: 1 (WT)

[0048] ATGCAAACAACAACTCGAAGGAAAGAAATGGAAACGTTGGAAGTACTTC

[0049] ACATGAACAAAGGCGCAGGCCAAACTAGCTATGCCATGAACTCTTCCGTTC

[0050] AGAATACGATAATTCTCTTGCGCGGAGCCAGCAAGAAAGAAAGCCTTGTG

[0051] CAAATTCTTTGCTCAAGTAATTGGCCTGAGAAGATGGGAATTGCGGACTTG

[0052] GGTTGTTCCTCAGGACCAAATGCCTTAAGGGTCATTTCGGAGATATTGGAT

[0053] GGTGTGTATGCCACCACATGCCTCTTGAATCGCCCTGCGCCAGAGTTGGTG

[0054] GTGTATTTGAATGACCTTTTCACCAATGACTTCAACAACATCTTTGGCTCAT

[0055] TGCCATCTTTCTACAGAAAACAGAAGCAAGAAAAGGGTAGTGGGTTTGGA

[0056] TCATATTTTGTTTCAGCAGTCCCTGGCTCTTTCTATGGTAGGCTTTTCCCTAG

[0057] CAAAAGCCTCCACTTTGCGCACTCTTCTTCTAGCCTCCATTGGCTTTCTCG

[0058] GGTTCCTAGTGGGTTAGAGAATGGTAGTGGGAGAGCATTGAACAAGCGAA

[0059] AGATCTACTTATCAAAGAGCAGTCCAAAGTGCGTGCTAGATGCTTATTCTC

[0060] AGCAATTCAAAAACGATTTTTCAGTGTTTCTTGCTTCACGTTCCCAAGAAA

[0061] TGGTAGCGGGGGGACGCATGGTCTTGTCTCTTATGGGCAGAGAATCCATGG

[0062] ACCCAACCACTGACCATAGTTGCTATCAGTGGGAACTCTTAGCACGATCCC

[0063] TCATGAGCATGGTTTCTGAGGGTCTTTTAGAAGAGGAAAAGGTGGATTCTT

[0064] TTGACGCTCCATACTATGCACCATGCTTGGAGGAAATGAAAATGGAGATTC

[0065] AAAAGGAAGGGTCATTTATTGTGACTGAGCATGAAGCTTATGAAATCGATT

[0066] GGGATGCTGGAATGGAATTGCAAAGTGATTCCCCAACAACAGGTACGCCA

[0067] TTAACGAGTGGAGAACGAGTTGCAAGGAGCATTAGGGCTGTGGTTGAATC

[0068] CATGTTGGAATCTCATTTCGGGTGCCACATAATGGATGAGCTGTTTCGAAG

[0069] GTACGCACAAATGGTAGAGGACCACTTATCAAAGACTAGGACCAAATACAT

[0070] TAATTTGGTCATTTTCTCTCGTCAAGCAAGGTTGA

[0071] SEQ ID NO:2(WT)

[0072] MQTTTRRKEMETLEVLHMNKGAGQTSYAMNSSVQNTIISCAEPARKKALVQI

[0073] LCSSNWPEKMGIADLGCSSGPNALRVISEILDGVYATTCLLNRRPAPELVVYLN

[0074] DLFTNDFNNIFGSLPSFYRKQKQEKGSGFGSYFVSAVPGSFYGRLFPSKSLHFA

[0075] HSSSSLHWLSRVPSGLENGSGRANLKRKIYLSKSSPKCVLDAYSQQFKNDFSV

[0076] FLASRSQEMVAGGRMVLSLMGRESMDPTTDHSCYQWELLARSLMSMVSEG

[0077] LLEEEKVDSFDAPYYAPCLEEMKMEIQKEGSFIVTEHEAYEIDWDAGMELQS

[0078] DSPTTGTPLTSGERVARSIRAVVESMLESHFGCHIMDELFRRYAQMVEDHLSKTRTKYINLVISLVKQG*

[0079] SEQ ID NO:3 (Gmjmt1-108)

[0080] ATGCAAACAACAACTCGAAGGAAAGAAATGGAAACGTTGGAAGTACTTC

[0081] ACATGAACAAAGGCGCAGGCCAAACTAGCTATGCCATGAACTCTTCGTTC

[0082] AGAATACGATAATCTCTTGCGCGGAGCCAGCAAGAAAGAAAGCTCTTGTG

[0083] CAAATTCTTTGCTCAAGTAATTGGCCTGAGAAGATGGGAATTGCGGACTTG

[0084] GGTTGTTCCTCAGGACCAAATGCCTTAAGGGTCATTTCGGAGATGGATGGT

[0085] GTGTATGCCACCACATGCCTCTTGAATCGCCCTGCGCCAGAGTTGGTGGTG

[0086] TATTTGAATGACCTTTTCACCAATGACTTCAACAACATCTTTGGCTCATTGC

[0087] CATCTTTCTACAGAAAACAGAAGCAAGAAAAGGGTAGTGGGTTTGGATCA

[0088] TATTTTGTTTCAGCAGTCCCTGGCTCTTTCTATGGTAGGCTTTTCCCTAGCA

[0089] AAAGCCTCCACTTTGCGCACTCTTCTTCTAGCCTCCATTGGCTTTCTCGGGT

[0090] TCCTAGTGGGTTAGAGAATGGTAGTGGGAGAGCATTGAACAAGCGAAAGA

[0091] TCTACTTATCAAAGAGCAGTCCAAAGTGCGTGCTAGATGCTTATTCTCAGC

[0092] AATTCAAAAACGATTTTTCAGTGTTTCTTGCTTCACGTTCCCAAGAAATGG

[0093] TAGCGGGGGGACGCATGGTCTTGTCTCTTATGGGCAGAGAATCCATGGACC

[0094] CAACCACTGACCATAGTTGCTATCAGTGGGAACTCTTAGCACGATCCCTCA

[0095] TGAGCATGGTTTCTGAGGGTCTTTTAGAAGAGGAAAAGGTGGATTCTTTTG

[0096] ACGCTCCATACTATGCACCATGCTTGGAGGAAATGAAAATGGAGATTCAAA

[0097] AGGAAGGGTCATTTATTGTGACTGAGCATGAAGCTTATGAAATCGATTGGG

[0098] ATGCTGGAATGGAATTGCAAAGTGATTCCCCAACAACAGGTACGCCATTAA

[0099] CGAGTGGAGAACGAGTTGCAAGGAGCATTAGGGCTGTGGTTGAATCCATG

[0100] TTGGAATCTCATTTCGGGTGCCACATAATGGATGAGCTGTTTCGAAGGTAC

[0101] GCACAAATGGTAGAGGACCACTTATCAAAGACTAGGACCAAATACATTAAT

[0102] TTGGTCATTTCTCTCGTCAAGCAAGGTTGA

[0103] SEQ ID NO:4(Gmjmt1-108)

[0104] MQTTTRRKEMETLEVLHMNKGAGQTSYAMNSSVQNTIISCAEPARKKALVQI

[0105] LCSSNWPEKMGIADLGCSSGPNALRVISEMDGVYATTCLLNRPAPELVVYLN

[0106] DLFTNDFNNIFGSLPSFYRKQKQEKGSGFGSYFVSAVPGSFYGRLFPSKSLHFA

[0107] HSSSSLHWLSRVPSGLENGSGRALNKRKIYLSKSSPKCVLDAYSQQFKNDFSV

[0108] FLASRSQEMVAGGRMVLSLMGRESMDPTTDHSCYQWELLARSLMSMVSEG

[0109] LLEEEKVDSFDAPYYAPCLEEMKMEIQKEGSFIVTEHEAYEIDWDAGMELQS

[0110] DSPTTGTPLTSGERVARSIRAVVESMLESHFGCHIMDELFRRYAQMVEDHLSKTRTKYINLVISLVKQG*

[0111] SEQ ID NO:5(Gmjmt1-201)

[0112] ATGCAAACAACAACTCGAAGGAAAGAAATGGTGCAGGGGAAAGGCGCAG

[0113] GCCAAACTAGCTATGCCATGAACTCTTCCGTTCAGAATACGATAATCTCTTG

[0114] CGCGGAGCCAGCAAGAAAGAAAGCTCTTGTGCAAATTCTTTGCTCAAGTA

[0115] ATTGGCCTGAGAAGATGGGAATTGCGGACTTGGGTTGTTCCTCAGGACCA

[0116] AATGCCTTAAGGGTCATTTCGGAGATGGATGGTGTGTATGCCACCACATGC

[0117] CTCTTGAATCGCCCTGCGCCAGAGTTGGTGGTGTATTTGAATGACCTTTTC

[0118] ACCAATGACTTCAACAACATCTTTGGCTCATTGCCATCTTTCTACAGAAAA

[0119] CAGAAGCAAGAAAAGGGTAGTGGGTTTGGATCATATTTTGTTTCAGCAGTC

[0120] CCTGGCTCTTTCTATGGTAGGCTTTTCCCTAGCAAAAGCCTCCACTTTGCGC

[0121] ACTCTTCTTCTAGCCTCCATTGGCTTTCTCGGGTTCCTAGTGGGTTAGAGAA

[0122] TGGTAGTGGGAGAGCATTGAACAAGCGAAAGATCTACTTATCAAAGAGCA

[0123] GTCCAAAGTGCGTGCTAGATGCTTATTCTCAGCAATTCAAAAACGATTTTT

[0124] CAGTGTTTCTTGCTTCACGTTCCCAAGAAATGGTAGCGGGGGGACGCATG

[0125] GTCTTGTCTCTTATGGGCAGAGAATCCATGGACCCAACCACTGACCATAGT

[0126] TGCTATCAGTGGGAACTCTTAGCACGATCCCTCATGAGCATGGTTTCTGAG

[0127] GGTCTTTTAGAAGAGGAAAAGGTGGATTCTTTTGACGCTCCATACTATGCA

[0128] CCATGCTTGGAGGAAATGAAAATGGAGATTCAAAAGGAAGGGTCATTTATT

[0129] GTGACTGAGCATGAAGCTTATGAAATCGATTGGGATGCTGGAATGGAATTG

[0130] CAAAGTGATTCCCCAACAACAGGTACGCCATTAACGAGTGGAGAACGAGT

[0131] TGCAAGGAGCATTAGGGCTGTGGTTGAATCCATGTTGGAATCTCATTTCGG

[0132] GTGCCACATAATGGATGAGCTGTTTCGAAGGTACGCACAAATGGTAGAGG

[0133] ACCACTTATCAAAGACTAGGACCAAATACATTAATTTGGTCATTTCTCTCGT

[0134] CAAGCAAGGTTGA

[0135] SEQ ID NO:6 (Gmjmt1-201)

[0136] MQTTTRRKEMVQGKGAGQTSYAMNSSVQNTIISCAEPARKKALVQILCSSNW

[0137] PEKMGIADLGCSSGPNALRVISEMDGVYATTCLLNRPAPELVVYLNDLFTNDF

[0138] NNIFGSLPSFYRKQKQEKGSGFGSYFVSAVPGSFYGRLFPSKSLHFAHSSSSLH

[0139] WLSRVPSGLENGSGRALNKRKIYLSKSSPKCVLDAYSQQFKNDFSVFLASRSQ

[0140] EMVAGGRMVLSLMGRESMDPTTDHSCYQWELLARSLMSMVSEGLLEEEKV

[0141] DSFDAPYYAPCLEEMKMEIQKEGSFIVTEHEAYEIDWDAGMELQSDSPTTGTP

[0142] LTSGERVARSIRAVVESMLESHFGCHIMDELFRRYAQMVEDHLSKTRTKYINLVISLVKQG*

[0143] Example 2 Study on the properties of soybean Gmjmt1 mutant strains

[0144] 1. Hypocotyl length

[0145] The harvested HC-6 (WT) seeds and Gmjmt1 seeds were germinated in moist vermiculite. After 10 days of growth, the hypocotyls of WT and Gmjmt1 plants were observed and measured (the experiment was repeated three times, and four independent soybean seedlings were measured in each repetition. The mean ± standard deviation of three biological repetitions was used as the final measurement data). The results are shown in Figure 2 As shown, the hypocotyls of the Gmjmt1 mutant lines were significantly shorter than those of the WT lines ( Figure 2 The measurement results also showed that the hypocotyl length of Gmjmt1-108 and Gmjmt1-201 mutant lines was significantly shorter than that of WT lines ( Figure 2 B).

[0146] 2. Plant height, number of main stem nodes and number of pods per plant

[0147] In order to evaluate the function of the GmJMT1 gene in regulating soybean plant height, WT and Gmjmt1 mutant plants were planted in large pots under natural light conditions. After one and a half months of growth, the plant height of WT and Gmjmt1 mutant plants was observed and measured (the experiment was repeated twice, in the first half and second half of 2024 in natural environments, and 8 independent soybean plants were measured in each repetition. The mean ± standard deviation of two biological repetitions was used as the final measurement data). The results showed that the plant height of the Gmjmt1 mutant line was significantly shorter than that of the WT line ( Figure 3 A in the figure). After measurement with a ruler, it was also proved that the plant height of the Gmjmt1-108 and Gmjmt1-201 mutant lines was significantly shorter than that of the WT line ( Figure 3 B).

[0148] Three months later, statistical analysis of agronomic traits of mature soybean plants revealed that the number of main stem nodes in the Gmjmt1-108 and Gmjmt1-201 mutant lines was significantly less than that in the WT line ( Figure 3 C and D in Figure 3). Further statistical analysis of the number of pods per plant of each genetic material revealed that the number of pods per plant of the Gmjmt1-108 and Gmjmt1-201 mutant lines was significantly greater than that of the WT line ( Figure 3 E).

[0149] The technical features of the above-described embodiments may be arbitrarily combined. To make the description concise, not all possible combinations of the technical features in the above-described embodiments are described. However, as long as there is no contradiction in the combination of these technical features, they should be considered to be within the scope of this specification.

[0150] The above-mentioned embodiments only express several implementation methods of the present invention, and the descriptions thereof are relatively specific and detailed, but they cannot be understood as limiting the scope of the invention patent. It should be pointed out that, for ordinary technicians in this field, several variations and improvements can be made without departing from the concept of the present invention, and these all belong to the protection scope of the present invention. Therefore, the protection scope of the patent of the present invention shall be subject to the attached claims.

Claims

1. A soybean GmJMT1 gene, characterized in that: The CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:

5.

2. Use of the soybean GmJMT1 gene according to claim 1 in reducing the plant height of legumes or increasing the number of pods per legume.

3. A protein encoded by soybean GmJMT1 gene, characterized in that: The amino acid sequence of the encoded protein is shown in SEQ ID NO:4 or SEQ ID NO:

6.

4. Use of the protein encoded by the soybean GmJMT1 gene according to claim 3 in reducing the plant height of legumes or increasing the number of pods per legume.

5. A gene editing vector of soybean GmJMT1 gene, characterized in that: The CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:

5.

6. Use of the gene editing vector of the soybean GmJMT1 gene according to claim 5 in reducing the plant height of legumes or increasing the number of pods per legume plant.

7. The use according to claim 2, 4 or 6, characterized in that: The leguminous plant is a plant of the genus Glycine max, more preferably soybean.

8. A method for reducing the plant height of leguminous plants, characterized in that: The method comprises the steps of: making the leguminous plant strain carry the soybean GmJMT1 gene and effectively express it, wherein the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:

5.

9. A method for increasing the number of pods per leguminous plant, characterized in that: The method comprises the steps of: making the leguminous plant strain carry the soybean GmJMT1 gene and effectively express it, wherein the CDS sequence of the soybean GmJMT1 gene is shown in SEQ ID NO:3 or SEQ ID NO:

5.

10. The method according to claim 8 or 9, characterized in that: The leguminous plant is a plant of the genus Glycine max, more preferably soybean.

Images