Chlorotoxin conjugates and methods of using them
Patent Information
- Application Number
- DE602014092210
- Authority / Receiving Office
- DE · DE
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2014-05-07
- Filing Date
- 2014-09-17
- Publication Date
- 2025-07-30
- Estimated Expiration
- 2034-09-17
AI Technical Summary
Current methods for intra-operative identification of tumor margins or small foci of cancer cells are imprecise and rely heavily on surgical judgment, limiting the extent of surgical resection and risking harm to vital structures.
Development of chlorotoxin conjugates with a detectable label that bind selectively to cancer cells, allowing for intra-operative visualization and detection through imaging techniques.
Enhances the precision of surgical resection by enabling real-time visualization of cancerous tissues, reducing the risk of incomplete resection and damage to healthy structures.
Description
STATEMENT AS TO FEDERALLY SPONSORED RESEARCH
[0001] This invention was made with the support of the United States government by the National Cancer Institute, National Institutes of Health, Department of Health and Human Services, under Contract No. HHSN261201200054C.BACKGROUND OF THE INVENTION
[0002] For many types of cancer, the precision of surgical resection directly influences patient prognosis. Unfortunately, intra-operative identification of tumor margins or small foci of cancer cells remains imprecise or depends on surgical judgment. Thus, the extent of surgical resection is constrained by the requirement to avoid harming vital structures. WO 2011 / 142858 A2 describes chlorotoxin variants, conjugates, and methods for their use. Butte et al (2014), Neurosurg Focus, 3 6, E1, 1-8 describes near-infrared imaging of brain tumors using the Tumor Pain BLZ-100. US 5,968,479 A describes a diagnostic marker. Mizrahi et al (2011), European Journal of Medicinal Chemistry, 46, 5175-5183 describes synthesis, fluorescence and biodistribution of a bone-targeted near-infrared conjugate. US 2009 / 028788 A1 describes compounds having RD targeting moieties. US 2013 / 028836 A1 describes chlorotoxin polypeptides and conjugates and uses thereof.
[0003] Despite the advances in the development of probes for targeting and imaging tumors, there exists a need for a probe that allows for intra-operative visualization of cancerous tissues.SUMMARY OF THE INVENTION
[0004] In various aspects, the presently described compounds further comprise a detectable label, which can be used for the detection of the peptide-label conjugate and the cancerous cells to which they are bound.
[0005] The present compounds have a structure of Formula (III), or a pharmaceutically acceptable salt thereof: wherein: R 1< , R 2< , R 3< , R 4< , R 5< , R 6< , R 7< , R 8< , R 15< , and R 16< are each independently selected from hydrogen, C 1 -C 6 alkyl, C 1 -C 6 alkylene-COOH, sulfonate, -COOH, -SO 2 -NH 2 , or C 1 -C 6 alkoxy; R 9< is sulfonate; L 1< is C 3 -C 6 alkylene; L 2< is C 1 -C 10 alkylene; L 3< is a bond, -O-, -NR 10< -, -NR 10< -C 1 -C 6 alkylene-, -O-NR 10< -, -NR 10< -C 1 -C 6 alkylene- (O-C 1 -C 6 alkylene) n -, -NR 10< -L 4< -, -NR 10< -C 1 -C 6 alkylene-NR 11< -(C (= O)-C 1 -C 6 alkylene-O-) m -, or -NR 10< -C 1 -C 6 alkylene-NR 10< -C 1 -C 6 alkylene-NR 10< -C 1 -C 6 alkylene-; L 4< is a bond, -heterocyclyl-, or -heterocyclyl-C 1 -C 6 alkylene-; R 10< is hydrogen or C 1 -C 6 alkyl; R 11< is hydrogen or C 1 -C 6 alkyl; R 12< and R 13< are independently selected from hydrogen, C 1 -C 6 alkyl, or R 12< and R 13< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring; R 14< is hydrogen or C 1 -C 6 alkylene, -(L 5< )-aryl, -(L 5< )-heteroaryl, -NR 17< R 18< , R 14< and R 19< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring, or R 14< and R 20< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring; L 5< is a bond, C 1 -C 10 alkylene, -O-, or -NR 10< -; R 17< and R 18< are each independently hydrogen or aryl; R 19< and R 20< are independently selected from hydrogen, C 1 -C 6 alkyl, R 14< and R 19< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring, or R 14< and R 20< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring; n is 0, 1, 2, or 3; m is 0, 1, 2, or 3; p is 0, 1, 2, or 3; q is 0, 1, 2, or 3; and A 4< is a polypeptide having at least 90% sequence identity with MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR or a fragment thereof, wherein the fragment of A 4< comprises at least 25 amino acid residues.
[0006] In various aspects, the present disclosure provides a kit comprising a vessel configured to contain a fluid; any of the claimed compounds and compositions; and an elastomeric closure affixed to the vessel.
[0007] In various aspects, the present disclosure provides a claimed composition, wherein when the composition is intravenously administering to a human subject at a dose of from 1 mg to 30 mg, the composition produces in the human subject an average maximum compound blood plasma concentration (average C max ) of at least from 110 ng / mL to 240 ng / mL per each 1 mg dosage of the compound administered.
[0008] In various aspects, the present disclosure provides a claimed compound for use in a method of administering to a human subject, the method comprising: intravenously administering to the human subject a dose of from 1 mg to 30 mg of the compound; and producing in the human subject an average maximum compound blood plasma concentration (average C max ) of at least from 110 ng / mL to 240 ng / mL per each 1 mg dosage of the compound administered.
[0009] In various aspects, the present disclosure provides a claimed compound for use in a method of detecting a cancer cell in a human subject, the method comprising: intravenously administering to the human subject a dose of from 1 mg to 30 mg of the compound; producing in the human subject an average maximum compound blood plasma concentration (average C max ) of at least from 110 ng / mL to 240 ng / mL per each 1 mg dosage of the compound administered; and detecting the presence or absence of the detectable label in the human subject, wherein the presence of the detectable label indicates the presence of the cancer cell.
[0010] In various aspects, the present disclosure provides a claimed compound for use in a method of diagnosing cancer in a human subject, the method comprising: intravenously administering to the human subject a dose of from 1 mg to 30 mg of the compound; producing in the human subject an average maximum compound blood plasma concentration (average C max ) of at least from 110 ng / mL to 240 ng / mL per each 1 mg dosage of the compound administered; and detecting the presence or absence of the detectable label in the human subject, wherein the presence of the detectable label indicates a diagnosis of cancer.
[0011] In various aspects, the present disclosure provides a claimed compound for use in a method of treating cancer in a human subject, the method comprising: intravenously administering to the human subject a dose of from 1 mg to 30 mg of the compound conjugated to a therapeutic agent; producing in the human subject an average maximum compound blood plasma concentration (average C max ) of at least from 110 ng / mL to 240 ng / mL per each 1 mg dosage of the compound administered; and reducing or improving a symptom or condition associated with cancer in the human subject. In some aspects, the human subject is in need thereof. In some aspects, the methods comprise administering a therapeutically effective dose of the compound to the human subject
[0012] In various aspects, the present disclosure provides a claimed compound for use in a method of administering to a human subject, the method comprising: administering to the human subject a dose of from 1 mg to 30 mg of the compound; and producing in the human subject pharmacokinetic profile of FIG. 27.
[0013] In various aspects, the present disclosure provides a claimed compound for use in a method for detecting a cancer cell in a subject, the method comprising: administering the compound; and detecting the presence or absence of the compound in the subject, wherein the presence of the compound indicates the presence of a cancer cell.
[0014] In various aspects, the present disclosure provides a claimed compound for use in a method of administering to a subject, the method comprising administering a therapeutically effective amount of the compound to the subject.
[0015] In various aspects, the present disclosure provides a claimed compound for use in a method of treating a subject in need thereof, the method comprising administering to the subject the compound further comprising a therapeutic agent in an amount sufficient to treat cancer in the subject. In certain aspects, the therapeutic agent is a cytotoxic agent.
[0016] In one embodiment, the chlorotoxin conjugate comprises a chemotherapeutic, an anti-cancer agent, or an anti-cancer drug. In another embodiment, the chlorotoxin conjugate comprising the chemotherapeutic, an anti-cancer agent, or an anti-cancer drug is administered after the central or primary tumor is detected during surgery. In a further embodiment, the central or primary tumor is detected with a chlorotoxin conjugated to a labeling agent.
[0017] In another aspect is provided a chlorotoxin conjugate as elaimed for use in a method of inhibiting, preventing, minimizing, shrinking, or killing cells, or preventing metastasis in residual tumor cells in a tumor bed in an individual, comprising the step of administering the chlorotoxin conjugate to the individual wherein the chlorotoxin conjugate binds to the residual tumor cells in a tumor bed; and whereby the residual tumor cells in the tumor bed are inhibited, prevented, minimized, shrinked, or killed cells, or metastasize is prevented. In one embodiment, the chlorotoxin conjugate comprises a chemotherapeutic, an anti-cancer agent, or an anti-cancer drug. In another embodiment, the chlorotoxin conjugate comprising the chemotherapeutic, an anticancer agent, or an anti-cancer drug is admmistered after the central or primary tumor is detected during surgery. In a further embodiment, the central or primary tumor is detected with a chlorotoxin conjugated to a labeling agent.
[0018] In another aspect the invention provides, a compound as claimed conjugated to a chemotherapeutic, an anti-cancer agent, or an anti-cancer drug for use in a method of administering the same to an individual to treat, inhibit, prevent, minimize, shrink, or kill cells, or prevent metastasis in cells that are identified with a chlorotoxin conjugated to a labeling agent. In some embodiments the anti-cancer agent include antibodies, polypeptides, polysaccharides, and nucleic acids. In an embodiment, the chlorotoxin conjugate is administered about 1 day before the surgery. In another embodiment, the chlorotoxin conjugate is administered about 2 days before surgery. In another embodiment, the chlorotoxin conjugate is administered in multiple sub-doses. In an embodiment, the chlorotoxin conjugate is administered in about 2 sub-doses, 3 sub-doses, 4 sub-doses, or more sub-doses. In another embodiment, the chlorotoxin conjugate comprising the chemotherapeutic, an anti-cancer agent, or an anticancer drug is administered after the central or primary tumor is detected during surgery. In a further embodiment, the central or primary tumor is detected with a chlorotoxin conjugated to a labeling agent.
[0019] In one aspect, the invention provides a chlorotoxin conjugate as claimed for use in a method of detecting soft-tissue sarcoma in an individual, comprising the steps of: a) administering the chlorotoxin conjugate to the individual wherein the chlorotoxin conjugate binds to the soft-tissue sarcoma; and b) imaging, visualizing, or analyzing the bound chlorotoxin conjugate. In an embodiment, the detecting comprises in vivo, or ex vivo detecting. In another embodiment, the imaging visualizing, or analyzing comprises visualizing the chlorotoxin conjugate. In a further embodiment, the imaging, visualizing, or analyzing comprises in vivo, or ex vivo imaging. visualizing, or analyzing. In some embodiments, the visualizing comprises optically imaging the sarcoma. In some embodiments a plot is made of the fluorescent intensity of the chlorotoxin conjugate.
[0020] In an aspect, a chlorotoxin conjugate comprising one or more labeling agents is used in detecting the soft-tissue sarcoma. In an embodiment, the labeling agent comprises a fluorescent moiety. In a further embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In another embodiment, the soft-tissue sarcoma is selected from the group consisting of: trachea, fat tissue tumors, muscle tissue tumors, skeletal muscle sarcomas, rhabdomyosarcomas, peripheral nerve tumors, fibrous tissue tumors, myxofibrosarcomas, fibromatosis, joint tissue tumors, tumors of blood vessels and lymph vessels, angiosarcomas, gastrointestinal stromal tumors, alveolar soft part sarcoma, dermatofibrosarcoma protuberans (DFSP), desmoplastic small round cell tumour, epithelioid sarcoma, extra skeletal myxoid chondrosarcoma, and giant cell fibroblastoma (GCF).
[0021] In another aspect a chlorotoxin conjugate is used to detect soft-tissue sarcoma in subcutaneous fatty tissue. In an embodiment, the detecting comprises imaging, visualizing, or analyzing the chlorotoxin conjugate during or related to surgery, surgical resection, or intraoperative imaging and resection. In another embodiment, the sarcoma, or a portion thereof, is removed during or related to surgery.
[0022] The invention provides a chlorotoxin conjugate as claimed for use in a method of detecting cutaneous squamous cell carcinoma in an individual, comprising the steps of: a) administering the chlorotoxin conjugate to the individual, wherein the chlorotoxin conjugate binds to the cutaneous squamous cell carcinoma; and b) imaging, visualizing, or analyzing the bound chlorotoxin conjugate. In an embodiment, the detecting comprises in vivo, or ex vivo detection. In another embodiment, the imaging, visualizing, or analyzing comprises visualizing the chlorotoxin conjugate. In another embodiment, the imaging, visualizing, or analyzing comprises in vivo, or ex vivo imaging, visualizing, or analyzing.
[0023] In another aspect, the invention provides a chlorotoxin conjugate as claimed for use in a method of using a chlorotoxin conjugate to optically image cutaneous squamous cell carcinoma. In an embodiment, the chlorotoxin conjugate comprises one or more labeling agents. In another embodiment, the labeling agent comprises a fluorescent moiety. In a further embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In some embodiments, the detecting comprises imaging, visualizing, or analyzing the chlorotoxin conjugate during or related to surgery, surgical resection, or intraoperative imaging and resection. In some embodiments, the cutaneous squamous cell carcinoma, or a portion thereof, is removed during or related to surgery. In some embodiments the fluorescent intensity of the chlorotoxin conjugate is made.
[0024] In an aspect the invention provides a chlorotoxin conjugate as claimed for use in a method of detecting a low-grade tumor in an individual, comprising the steps of: a) administering the chlorotoxin conjugate to the individual wherein the chlorotoxin conjugate binds to the low-grade tumor; and b) imaging, visualizing, or analyzing the bound chlorotoxin conjugate. In an embodiment, the detecting comprises in vivo, or ex vivo detecting. In some embodiments, the imaging, visualizing, or analyzing comprises vivo, or ex vivo imaging, visualizing, or analyzing.
[0025] The invention provides a chlorotoxin conjugate as claimed for use in a method of using a chlorotoxin conjugate to optically image a low-grade tumor. In an embodiment, the chlorotoxin conjugate comprises one or more labeling agents. In an embodiment, the labeling agent comprises a fluorescent moiety. In an embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In another embodiment, the detecting is performed during or related to surgery or resection. In a further embodiment, the low-grade tumor, or a portion thereof, is removed during or related to surgery, surgical resection, or intraoperative imaging and resection. In some embodiments, the low-grade tumor is selected from the group consisting of: a) a low-grade tumor in or from brain tissue; b) a low-grade tumor in or from subcutaneous fatty tissue; c) a low-grade tumor in or from breast or mammary tissue, and d) a low-grade tumor in or from lung tissue. In some embodiments a plot is made of the fluorescent intensity of the chlorotoxin conjugate.
[0026] In an embodiment, the chlorotoxin conjugate comprises one or more labeling agents. In an embodiment, the labeling agent comprises a fluorescent moiety. In an embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In an embodiment, the detecting comprises in vivo, or ex vivo detection. In an embodiment, the imaging, visualizing, or analyzing comprises in vivo, or ex vivo imaging, visualizing, or analyzing. In some embodiments a plot is made of the fluorescent intensity of the chlorotoxin conjugate.
[0027] In another aspect, is provided a chlorotoxin conjugate as claimed for use in a method for using a chlorotoxin conjugate to detect residual cancer in the tumor bed of an individual following removal of a primary or central tumor in breast cancer surgery, comprising: a) administering the chlorotoxin conjugate to the individual wherein the chlorotoxin conjugate binds to residual cancer; and b) imaging, visualizing, or analyzing the bound chlorotoxin conjugate. In an embodiment, the chlorotoxin conjugate comprises one or more labeling agents. In a further embodiment, the labeling agent comprises a fluorescent moiety. In another embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In some embodiments the detecting is performed during or related to surgery or resection. In further embodiments, the residual cancer, or a portion thereof, is removed during or related to surgery, surgical resection, or intraoperative imaging and resection.
[0028] In an embodiment, the chlorotoxin conjugate comprises one or more labeling agents. In a further embodiment, the labeling agent comprises a fluorescent moiety. In another embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In an aspect, the invention provides, a chlorotoxin conjugate as claimed for use in a method for detecting a tumor in an individual comprising the steps of a) administering the chlorotoxin conjugate to the individual wherein the chlorotoxin conjugate binds to the tumor; and b) imaging, visualizing, or analyzing the bound chlorotoxin conjugate wherein the chlorotoxin conjugate is administered in an amount of between about 0.9 mg / m 2< to about 1.1 mg / m 2< or in an amount of between about 3 mg to about 6 mg. In an embodiment, the detecting comprises in vivo, or ex vivo detection. In some embodiments, the imaging, visualizing, or analyzing comprises in vivo, or ex vivo imaging, visualizing, or analyzing.
[0029] The invention provides a chlorotoxin conjugate as claimed for use in a method of using a chlorotoxin conjugate to optically image a tumor, in an embodiment, the chlorotoxin conjugate comprises one or more labeling agents. In a further embodiment, the labeling agent comprises a fluorescent moiety. In a further embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In some embodiments the detecting is performed during or related to surgery or resection. In some, embodiments, the tumor, of a portion thereof, is removed during or related to surgery surgical resection, or intraoperative imaging and resection.
[0030] The invention provides a chlorotoxin conjugate as claimed for use in a method of administering a chlorotoxin conjugate to an individual to detect soft-tissue sarcoma, low-grade tumor, cutaneous squamous cell carcinoma, of cells therefrom in tumors of skin or breast, and lung and mammary cancers. In an embodiment, the chlorotoxin conjugate comprises one or more labeling agents. In an embodiment, the labeling agent comprises a fluorescent moiety. In an embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In another embodiment, the detecting is performed during or related to surgery of resection. In a further embodiment, the soft-tissue sarcoma, low-grade tumor, cutaneous squamous cell carcinoma, or cells therefrom, in tumors of skin or breast, and lung and mammary cancers, of a portion thereof is removed during or related to surgery, surgical resection, or intraoperative imaging and resection. In other embodiments, the chlorotoxin conjugate is administered in an amount of between about 0.9 mg / m 2< to about 1.1 mg / m 2< or in an amount of between about 3 mg to about 6 mg. In an embodiment, the chlorotoxin conjugate is administered about 1 day before the surgery. In another embodiment, the chlorotoxin conjugate is administered about 2 days before surgery. In another embodiment, the chlorotoxin conjugate is administered in multiple sub-doses. In an embodiment, the chlorotoxin conjugate is administered in about 2 sub-doses, 3 sub-doses, 4 sub-doses, or more sub-doses. In an embodiment, the detecting comprises in vivo, or ex vivo detection. In some embodiments, the imaging, visualizing, or analyzing comprises in vivo, or ex vivo imaging, visualizing, or analyzing. In some embodiments a plot is made of the fluorescent intensity of the chlorotoxin conjugate.
[0031] In another aspect, is provided a chlorotoxin conjugate as claimed for use in a method for using a chlorotoxin conjugate to detect residual cancer in the tumor bed of an individual following removal of a primary or central tumor in breast cancer surgery, comprising: a) administering the chlorotoxin conjugate to the individual wherein the chlorotoxin conjugate binds to residual cancer; and b) imaging, visualizing, or analyzing the bound chlorotoxin conjugate. In an embodiment, the chlorotoxin conjugate comprises one or more labeling agents. In a further embodiment, the labeling agent comprises a fluorescent moiety. In another embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In some embodiments the detecting is performed during or related to surgery or resection. In further embodiments, the residual cancer, or a portion thereof, is removed during or related to surgery. surgical resection, or intraoperative imaging and resection.
[0032] In an embodiment, the chlorotoxin conjugate comprises one or more labeling agents. In an embodiment, the labeling agent comprises a fluorescent moiety. In an embodiment, the fluorescent moiety comprises a near infrared fluorescent moiety. In another embodiment, the labeling agent comprises a radionuclide. In another embodiment, the detecting is performed during or related to surgery or resection. In an embodiment, the chlorotoxin conjugate is administered about 1 day before the surgery. In another embodiment, the chlorotoxin conjugate is administered about 2 days before surgery. In another embodiment, the chlorotoxin conjugate is administered in multiple sub-doses. In an embodiment, the chlorotoxin conjugate is administered in about 2 sub-doses, 3 sub-doses, 4 sub-doses, or more sub-doses. In an embodiment, the detecting comprises vivo, or ex vivo detection. In some embodiments, the imaging, visualizing, or analyzing comprises in vivo, or ex vivo imaging, visualizing, or analyzing. In some embodiments a plot is made of the fluorescent intensity of the chlorotoxin conjugate.
[0033] The invention further provides a chlorotoxin conjugate as claimed for use in a method for detecting soft tissue sarcoma in an individual comprising, administering the chlorotoxin conjugate to the individual, wherein the chlorotoxin conjugate comprises a detectable agent, binding the chlorotoxin conjugate to the soft tissue sarcoma, and detecting the bound chlorotoxin conjugate, wherein an elevated level of bound chlorotoxin conjugate indicates the presence of soft tissue sarcoma.BRIEF DESCRIPTION OF THE DRAWINGS
[0034] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which: FIG. 1 shows SDS-PAGE of chlorotoxin conjugate formulations after 14 days at room temperature. FIG. 2 shows SDS-PAGE of chlorotoxin conjugate formulations after 5 days at 40 °C (and t0). FIG. 3 shows SDS-PAGE of chlorotoxin conjugate formulations after 3 days at room temperature in the light or 3X F / T. Samples are after 3 days at room temperature in the light unless marked as F / T FIG. 4 shows total peak area of RP-HPLC chromatograms for chlorotoxin conjugate formulations with no lyophilization or lyophilization with fast or slow freezing. FIG. 5 shows FTIR-derived secondary structures obtained for chlorotoxin conjugate lyophilized with slow versus fast freezing (left) and in a liquid formulation (right). FIG. 6 shows SDS-PAGE analysis of various lyophilized formulations. FIG. 7 shows signal-to-noise ratios (SNRs) of chlorotoxin conjugates in U87 flank tumors 24 hours after injection. FIG. 8 shows fluorescent images of Compound 76-2kD (left), Compound 76-5kD (middle) and Compound 76-40kD (right). FIG. 9A shows a fluorescent image of Compound 76-5kD. FIG. 9B shows an H&E stain of the tissue sample. FIG. 10 shows biodistribution analysis of Compound 76-5kD. FIG. 10A shows integrated intensity for sections from liver, kidney, spleen, heart and brain. FIGS. 10B and 10C show representative images from liver and kidney, respectively. FIG. 11 shows an Odyssey fluorescent image of Compound 76-5kD (top) and H&E stain (bottom) of heart tissue. FIG. 12A SNR (tumor / muscle) for different doses of chlorotoxin conjugate (n = 2-7; sample size is shown inside each column; error = standard deviation). FIG. 12B shows signal from a subset of tumor and muscle samples. Representative muscle and tumor images for the 6 nmol and 20 nmol dose groups 1 and 3 days post injection are shown below the graph. FIG. 13 shows biodistribution of select tissues using the IVIS Spectrum imaging system. FIG. 13A represents tissues one day after injection. FIG. 13B shows tissues imaged three days post injection. (B- brain, H- heart, K- kidney, S- skin, L- liver). FIG. 13C shows fluorescent signal in tissues for the 2 nmol and 20 nmol groups one and three days after injection. FIG. 14 shows whole body live animal imaging of chlorotoxin conjugate from six hours to three days after injection. FIG. 15A shows ex vivo imaging of chlorotoxin conjugate 1 day after injection using the IVIS Spectrum. FIG. 15B shows ex vivo imaging of the brain from orthotopic mouse 2. FIG. 15C shows ex vivo Odyssey imaging of the brain and skull from orthotopic mouse 1. FIG. 16 shows fluorescence intensity in gross tumors, grouped by tumor type. Regions of interest (ROI) were drawn on Odyssey scans of gross tumors. ROIs were the same size across the data set. FIG. 17 shows ex vivo imaging of a canine soft tissue sarcoma. Patient 13 was a 7-year-old female Standard Poodle who presented with a subcutaneous hemangiopericytoma, a type of soft tissue sarcoma. She was treated with BLZ-100 at 0.94 mg / m 2< , and surgery was performed 48 hours later. White light (A, C) and Odyssey near-infrared (B, D) images are shown of gross tumor and adjacent normal fat (A, B) and uninvolved skin (C, D). Gross ratios of tumor to fat were 257:1 to 127:1, and gross ratios of tumor to skin were 89:1 to 33:1. FIG. 18 shows a determination of the chlorotoxin conjugate dose at which tumor to background ratio is maximal. Sections of tumor and non-tumor tissue were scored by a histopathologist who was blinded to the fluorescence data. Total fluorescence in 2x2 mm grid squares was measured, and each square was designated tumor or non-tumor by overlaying the fluorescence image with the H&E image scored by the histopathologist. The average of tumor and non-tumor squares was used to compute the tumor to background ratio (TBR), shown at right of each data point. FIG. 19 shows a box & whiskers plot of gross tumor intensity for soft-tissue sarcomas (all subtypes) and carcinomas (including adenocarcinoma and squamous cell carcinoma). Tissues were labeled with BLZ-100. FIG. 20 shows signal and image analysis of tumor versus normal cortical tissue in SmoA1 mouse brain. FIG. 21 shows small foci of fluorescence that correspond to small clusters of tumor cells highlighted in the H&E stained slide. FIG. 22 shows the mean (SD) of serum BLZ-100 concentration vs. time profiles following a single intravenous bolus of 0.02 mg BLZ-100 administered to female mice. FIG. 23 shows the mean (SD) of serum BLZ-100 concentration vs. time profiles following a single intravenous bolus of 0.03 or 0.3 mg dose to male rats. FIG. 24 shows the individual serum BLZ-100 concentration vs. time profiles following a single intravenous bolus dose of 0.6 mg to male monkeys. FIG. 25 shows the mean (±SD) BLZ-100 serum concentrations (ng / mL) summarized by dose following a single intravenous bolus dose to male and female rats. FIG. 26 shows the mean (±SD) BLZ-100 serum concentrations (ng / mL) summarized by dose following a single intravenous bolus dose to male and female monkeys. FIG. 27 shows chlorotoxin conjugate serum concentration vs time for human subjects. FIG. 28 shows intraoperative imaging of a soft-tissue sarcoma (patient 19). (A) White light preoperative image of gross tumor showing ulcerated and grossly swollen peritumoral skin. (B) NIR image of tumor in situ. (C) Plot of fluorescence intensity along the line drawn through the image in panel B. (D) NIR image of excised tumor. (E) Plot of fluorescence intensity along the line drawn through the image in panel D. (F) NIR image of peritumoral skin, surrounding uninvolved skin, and tumor bed. Peritumoral skin is 6-fold more intense than uninvolved skin. There is no residual fluorescence in the tumor bed. Tissues were labeled with BLZ-100. FIG. 29 shows intraoperative imaging of a mammary carcinoma (patient 22). (A) NIR image of fluorescence from the primary mass (arrow) imaged from the bottom of the resected tissue, taken immediately post-excision. This aspect had a margin of about 0.5 cm of normal tissue. Panels B (fluorescence) and C (overlay) show the primary mass from the skin side, after the skin was opened and a slice removed for further imaging. The small fluorescent patches were originally part of the primary mass, but were separated by the removal of the slice. Panels D and E show the gross appearance and fluorescence overlay of the pieces submitted for further imaging. The contrast between gross tumor and adjacent tissue is about 2.5-fold. (F) Overlay image of the tumor bed, showing lack of residual fluorescence in the muscle wall. Tissues were labeled with BLZ-100. FIG. 30 shows intraoperative imaging of a cutaneous squamous cell carcinoma (patient 23). (A) White light preoperative image of tumor site, showing grossly ulcerated and swollen peritumoral skin. Panels B and C show preoperative NIR fluorescence images of the tumor from the top (B) and side (C). NIR fluorescence (D) and overlay (E) are shown following removal of the tail. The mass at right is a section of central tumor removed for further analysis. The skin is retracted, and the remaining gross tumor (arrow) is revealed. Fluorescence intensity is similar in the central tumor and remaining gross tumor, while peritumoral skin has somewhat lower fluorescence intensity (F). Tissues were labeled with BLZ-100. FIG. 31 shows intraoperative imaging of a thyroid carcinoma (patient 20). (Top) White light images of excised lymph node, thyroid mass, and tumor bed. (Middle) NIR fluorescence signal overlaid on white light images. (Bottom) Monochrome NIR images. The lymph node and thyroid mass each have a section removed for further analysis, shown side-by-side with the bulk tissue. FIG. 32 shows a box & whiskers plots of fluorescence intensity in grid squares for each tissue section analyzed. T, tumor. NT, adjacent non-tumor tissue. PS, peritumoral skin. S, uninvolved skin. For the cutaneous tumors, the NT consisted of underlying dermis, subcutaneous fat, and adjacent dermis / epidermis. Tissues were labeled with a chlorotoxin conjugate compound. FIG. 33 shows imaging of a brain tumor labeled with BLZ-100. (A) NIR fluorescence image of tumor in situ. T, tumor. M, nasal mucosa. B, normal brain. Panels B and C show fluorescence images of 30 micron sections from two of the tumor pieces. Panels D and E show H&E stains of the sections in B and C, respectively. DETAILED DESCRIPTION
[0035] The present disclosure provides compositions and methods for the detection and / or treatment of cancers. The compositions described herein comprise peptide conjugates comprising a detectable label, which are suitable for the detection and treatment of various cancers. In certain aspects, the compositions are provided in combination with a pharmaceutically acceptable carrier, which can be administered to a subject by any parenteral route of administration. The compositions described herein give rise to a pharmacokinetic profile when administered intravenously to a human subject. Following administration of the compositions described herein, the conjugates bind selectively to cancer cells. The cancer cells can then be detected, for example, by imaging or other visualization or detection method suitable for detecting the detectable label of the peptide conjugate. In further aspects, the presently described compositions can be used to treat cancer by way of a therapeutic agent, which is attached to the conjugate and which acts on the cancer cells following binding by the peptide portion of the conjugate. These and other aspects are described in detail herein.
[0036] The invention will best be understood by reference to the following detailed description of the aspects and embodiments of the invention, taken in conjunction with the accompanying drawings and figures. The discussion below is descriptive, illustrative and exemplary and is not to be taken as limiting the scope defined by any appended claims.
[0037] As used in the specification and appended claims, unless specified to the contrary, the following terms have the meaning indicated.
[0038] As used herein and in the appended claims, the singular forms "a," "and," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "a compound" includes a plurality of such compounds, reference to "an agent" includes a plurality of such agents, and reference to "the cell" includes reference to one or more cells (or to a plurality of cells) and equivalents thereof known to those skilled in the art, and so forth. When ranges are used herein for physical properties, such as molecular weight, or chemical properties, such as chemical formulae, all combinations and subcombinations of ranges and specific embodiments therein are intended to be included. The term "about" when referring to a number or a numerical range means that the number or numerical range referred to is an approximation within experimental variability (or within statistical experimental error), and thus the number or numerical range may vary between 1% and 15% of the stated number or numerical range. The term "comprising" (and related terms such as "comprise" or "comprises" or "having" or "including") is not intended to exclude that in other certain embodiments, for example, an embodiment of any composition of matter, composition, method, or process, or the like, described herein, may "consist of" or "consist essentially of" the described features.
[0039] "Cyano" refers to the -CN radical.
[0040] "Nitro" refers to the -NO 2 radical.
[0041] "Oxa" refers to the -O- radical.
[0042] "Oxo" refers to the = O radical.
[0043] "Thioxo" refers to the = S radical.
[0044] "Imino" refers to the = N-H radical.
[0045] "Hydrazino" refers to the = N-NH 2 radical.
[0046] "Alkyl" refers to a straight or branched hydrocarbon chain radical consisting solely of carbon and hydrogen atoms, containing no unsaturation, having from one to fifteen carbon atoms (e.g., C 1 -C 15 alkyl). In certain embodiments, an alkyl comprises one to thirteen carbon atoms (e.g., C 1 -C 13 alkyl). In certain embodiments, an alkyl comprises one to eight carbon atoms (e.g., C 1 -C 8 alkyl). In other embodiments, an alkyl comprises five to fifteen carbon atoms (e.g., C 5 -C 15 alkyl). In other embodiments, an alkyl comprises five to eight carbon atoms (e.g., C 5 -C 8 alkyl). The alkyl is attached to the rest of the molecule by a single bond, for example, methyl (Me), ethyl (Et), n-propyl, 1-methylethyl (iso-propyl), n-butyl, n-pentyl, 1,1-dimethylethyl (t-butyl), 3-methylhexyl, 2-methylhexyl, and the like. Unless stated otherwise specifically in the specification, an alkyl group is optionally substituted by one or more of the following substituents: halo, cyano, nitro, oxo, thioxo, trimethylsilanyl, -OR a< ,-SR a< , -OC(O)-R a< , -N(R a< ) 2 , -C(O)R a< , -C(O)OR a< , -C(O)N(R a< ) 2 , -N(R a< )C(O)OR a< , -N(R a< )C(O)R a< , -N(R a< )S(O) t R a< (where t is 1 or 2), -S(O) t OR a< (where t is 1 or 2) and -S(O) t N(R a< ) 2 (where t is 1 or 2) where each R a< is independently hydrogen, alkyl, fluoroalkyl, carbocyclyl, carbocyclylalkyl, aryl, aralkyl, heterocyclyl, heterocyclylalkyl, heteroaryl or heteroarylalkyl.
[0047] "Alkenyl" refers to a straight or branched hydrocarbon chain radical group consisting solely of carbon and hydrogen atoms, containing at least one double bond, and having from two to twelve carbon atoms. In certain embodiments, an alkenyl comprises two to eight carbon atoms. In other embodiments, an alkenyl comprises two to four carbon atoms. The alkenyl is attached to the rest of the molecule by a single bond, for example, ethenyl (i.e., vinyl), prop-1-enyl (i.e., allyl), but-1-enyl, pent-1-enyl, penta-1,4-dienyl, and the like. Unless stated otherwise specifically in the specification, an alkenyl group is optionally substituted by one or more of the following substituents: halo, cyano, nitro, oxo, thioxo, trimethylsilanyl, -OR a< ,-SR a< , -OC(O)-R a< , -N(R a< ) 2 , -C(O)R a< , -C(O)OR a< , -C(O)N(R a< ) 2 , -N(R a< )C(O)OR a< , -N(R a< )C(O)R a< , -N(R a< )S(O) t R a< (where t is 1 or 2), -S(O) t OR a< (where t is 1 or 2) and -S(O) t N(R a< ) 2 (where t is 1 or 2) where each R a< is independently hydrogen, alkyl, fluoroalkyl, carbocyclyl, carbocyclylalkyl, aryl, aralkyl, heterocyclyl, heterocyclylalkyl, heteroaryl or heteroarylalkyl.
[0048] "Alkynyl" refers to a straight or branched hydrocarbon chain radical group consisting solely of carbon and hydrogen atoms, containing at least one triple bond, having from two to twelve carbon atoms. In certain embodiments, an alkynyl comprises two to eight carbon atoms. In other embodiments, an alkynyl has two to four carbon atoms. The alkynyl is attached to the rest of the molecule by a single bond, for example, ethynyl, propynyl, butynyl, pentynyl, hexynyl, and the like. Unless stated otherwise specifically in the specification, an alkynyl group is optionally substituted by one or more of the following substituents: halo, cyano, nitro, oxo, thioxo, trimethylsilanyl, -OR a< ,-SR a< , -OC(O)-R a< , -N(R a< ) 2 , -C(O)R a< , -C(O)OR a< , -C(O)N(R a< ) 2 , -N(R a< )C(O)OR a< , -N(R a< )C(O)R a< , -N(R a< )S(O) t R a< (where t is 1 or 2), -S(O) t OR a< (where t is 1 or 2) and -S(O) t N(R a< ) 2 (where t is 1 or 2) where each R a< is independently hydrogen, alkyl, fluoroalkyl, carbocyclyl, carbocyclylalkyl, aryl, aralkyl, heterocyclyl, heterocyclylalkyl, heteroaryl or heteroarylalkyl.
[0049] "Alkylene" or "alkylene chain" refers to a straight or branched divalent hydrocarbon chain linking the rest of the molecule to a radical group, consisting solely of carbon and hydrogen, containing no unsaturation and having from one to twelve carbon atoms, for example, methylene, ethylene, propylene, n-butylene, and the like. The alkylene chain is attached to the rest of the molecule through a single bond and to the radical group through a single bond. The points of attachment of the alkylene chain to the rest of the molecule and to the radical group can be through one carbon in the alkylene chain or through any two carbons within the chain. Unless stated otherwise specifically in the specification, an alkylene chain is optionally substituted by one or more of the following substituents: halo, cyano, nitro, aryl, cycloalkyl, heterocyclyl, heteroaryl, oxo, thioxo, trimethylsilanyl, -OR a< ,-SR a< , -OC(O)-R a< , -N(R a< ) 2 , -C(O)R a< , -C(O)OR a< , -C(O)N(R a< ) 2 , -N(R a< )C(O)OR a< , -N(R a< )C(O)R a< , -N(R a< )S(O) t R a< (where t is 1 or 2), -S(O) t OR a< (where t is 1 or 2) and -S(O) t N(R a< ) 2 (where t is 1 or 2) where each R a< is independently hydrogen, alkyl, fluoroalkyl, carbocyclyl, carbocyclylalkyl, aryl, aralkyl, heterocyclyl, heterocyclylalkyl, heteroaryl or heteroarylalkyl.
[0050] "Alkenylene" or "alkenylene chain" refers to a straight or branched divalent hydrocarbon chain linking the rest of the molecule to a radical group, consisting solely of carbon and hydrogen, containing at least one double bond and having from two to twelve carbon atoms, for example, ethenylene, propenylene, n-butenylene, and the like. The alkenylene chain is attached to the rest of the molecule through a double bond or a single bond and to the radical group through a double bond or a single bond. The points of attachment of the alkenylene chain to the rest of the molecule and to the radical group can be through one carbon or any two carbons within the chain. Unless stated otherwise specifically in the specification, an alkenylene chain is optionally substituted by one or more of the following substituents: halo, cyano, nitro, aryl, cycloalkyl, heterocyclyl, heteroaryl, oxo, thioxo, trimethylsilanyl, -OR a< ,-SR a< , -OC(O)-R a< , -N(R a< ) 2 , -C(O)R a< , -C(O)OR a< , -C(O)N(R a< ) 2 , -N(R a< )C(O)OR a< , -N(R a< )C(O)R a< , -N(R a< )S(O) t R a< (where t is 1 or 2), -S(O) t OR a< (where t is 1 or 2) and -S(O) t N(R a< ) 2 (where t is 1 or 2) where each R a< is independently hydrogen, alkyl, fluoroalkyl, cycloalkyl, cycloalkylalkyl, aryl (optionally substituted with one or more halo groups), aralkyl, heterocyclyl, heterocyclylalkyl, heteroaryl or heteroarylalkyl, and where each of the above substituents is unsubstituted unless otherwise indicated.
[0051] "Aryl" refers to a radical derived from an aromatic monocyclic or multicyclic hydrocarbon ring system by removing a hydrogen atom from a ring carbon atom. The aromatic monocyclic or multicyclic hydrocarbon ring system contains only hydrogen and carbon from six to eighteen carbon atoms, where at least one of the rings in the ring system is fully unsaturated, i.e., it contains a cyclic, delocalized (4n+2) π-electron system in accordance with the Hückel theory. Aryl groups include, but are not limited to, groups such as phenyl, fluorenyl, and naphthyl. Unless stated otherwise specifically in the specification, the term "aryl" or the prefix "ar-" (such as in "aralkyl") is meant to include aryl radicals optionally substituted by one or more substituents independently selected from alkyl, alkenyl, alkynyl, halo, fluoroalkyl, cyano, nitro, optionally substituted aryl, optionally substituted aralkyl, optionally substituted aralkenyl, optionally substituted aralkynyl, optionally substituted carbocyclyl, optionally substituted carbocyclylalkyl, optionally substituted heterocyclyl, optionally substituted heterocyclylalkyl, optionally substituted heteroaryl, optionally substituted heteroarylalkyl, -R b< -OR a< , -R b< -OC(O)-R a< , -R b< -N(R a< ) 2 , -R b< -C(O)R a< , -R b< -C(O)OR a< , -R b< -C(O)N( R a< ) 2 , -R b< -O-R c< -C(O)N(R a< ) 2 , -R b< -N(R a< )C(O)OR a< , -R b< -N(R a< )C(O)R a< , -R b< -N(R a< )S(O) t R a< (where t is 1 or 2), -R b< -S(O) t OR a< (where t is 1 or 2) and -R b< -S(O) t N(R a< ) 2 (where t is 1 or 2), where each R a< is independently hydrogen, alkyl, fluoroalkyl, cycloalkyl, cycloalkylalkyl, aryl (optionally substituted with one or more halo groups), aralkyl, heterocyclyl, heterocyclylalkyl, heteroaryl or heteroarylalkyl, each R b< is independently a direct bond or a straight or branched alkylene or alkenylene chain, and R c< is a straight or branched alkylene or alkenylene chain, and where each of the above substituents is unsubstituted unless otherwise indicated.
[0052] "Aralkyl" refers to a radical of the formula -R c< -aryl where R c< is an alkylene chain as defined above, for example, benzyl, diphenylmethyl and the like. The alkylene chain part of the aralkyl radical is optionally substituted as described above for an alkylene chain. The aryl part of the aralkyl radical is optionally substituted as described above for an aryl group.
[0053] "Aralkenyl" refers to a radical of the formula -R d< -aryl where R d< is an alkenylene chain as defined above. The aryl part of the aralkenyl radical is optionally substituted as described above for an aryl group. The alkenylene chain part of the aralkenyl radical is optionally substituted as defined above for an alkenylene group.
[0054] "Aralkynyl" refers to a radical of the formula -R e< -aryl, where R e< is an alkynylene chain as defined above. The aryl part of the aralkynyl radical is optionally substituted as described above for an aryl group. The alkynylene chain part of the aralkynyl radical is optionally substituted as defined above for an alkynylene chain.
[0055] "Carbocyclyl" refers to a stable non-aromatic monocyclic or polycyclic hydrocarbon radical consisting solely of carbon and hydrogen atoms, which may include fused or bridged ring systems, having from three to fifteen carbon atoms. In certain embodiments, a carbocyclyl comprises three to ten carbon atoms. In other embodiments, a carbocyclyl comprises five to seven carbon atoms. The carbocyclyl is attached to the rest of the molecule by a single bond. Carbocyclyl may be saturated, (i.e., containing single C-C bonds only) or unsaturated (i.e., containing one or more double bonds or triple bonds.) A fully saturated carbocyclyl radical is also referred to as "cycloalkyl." Examples of monocyclic cycloalkyls include, e.g., cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. An unsaturated carbocyclyl is also referred to as "cycloalkenyl." Examples of monocyclic cycloalkenyls include, e.g., cyclopentenyl, cyclohexenyl, cycloheptenyl, and cyclooctenyl. Polycyclic carbocyclyl radicals include, for example, adamantyl, norbornyl (i.e., bicyclo[2.2.1]heptanyl), norbornenyl, decalinyl, 7,7-dimethyl-bicyclo[2.2.1]heptanyl, and the like. Unless otherwise stated specifically in the specification, the term "carbocyclyl" is meant to include carbocyclyl radicals that are optionally substituted by one or more substituents independently selected from alkyl, alkenyl, alkynyl, halo, fluoroalkyl, oxo, thioxo, cyano, nitro, optionally substituted aryl, optionally substituted aralkyl, optionally substituted aralkenyl, optionally substituted aralkynyl, optionally substituted carbocyclyl, optionally substituted carbocyclylalkyl, optionally substituted heterocyclyl, optionally substituted heterocyclylalkyl, optionally substituted heteroaryl, optionally substituted heteroarylalkyl, -R b< -OR a< , -R b< -SR a< , -R b< -OC(O)-R a< , -R b< -N(R a< ) 2 , -R b< -C(O)R a< , -R b< -C(O)OR a< , -R b< -C(O)N(R a< ) 2 , -R b< -O-R c< -C(O)N(R a< ) 2 , -R b< -N(R a< )C(O)OR a< , -R b< -N(R a< )C(O)R a< , -R b< -N(R a< )S(O) t R a< (where t is 1 or 2), -R b< -S(O) t OR a< (where t is 1 or 2) and -R b< -S(O) t N(R a< ) 2 (where t is 1 or 2), where each R a< is independently hydrogen, alkyl, fluoroalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocyclyl, heterocyclylalkyl, heteroaryl or heteroarylalkyl, each R b< is independently a direct bond or a straight or branched alkylene or alkenylene chain, and R c< is a straight or branched alkylene or alkenylene chain, and where each of the above substituents is unsubstituted unless otherwise indicated.
[0056] "Carbocyclylalkyl" refers to a radical of the formula -R c< -carbocyclyl where R c< is an alkylene chain as defined above. The alkylene chain and the carbocyclyl radical is optionally substituted as defined above.
[0057] "Halo" or "halogen" refers to bromo, chloro, fluoro or iodo substituents.
[0058] "Fluoroalkyl" refers to an alkyl radical, as defined above, that is substituted by one or more fluoro radicals, as defined above, for example, trifluoromethyl, difluoromethyl, 2,2,2-trifluoroethyl, 1-fluoromethyl-2-fluoroethyl, and the like. The alkyl part of the fluoroalkyl radical is optionally substituted as defined above for an alkyl group.
[0059] "Heterocyclyl" refers to a stable 3- to 18-membered non-aromatic ring radical that comprises two to twelve carbon atoms and from one to six heteroatoms selected from nitrogen, oxygen and sulfur. Unless stated otherwise specifically in the specification, the heterocyclyl radical is a monocyclic, bicyclic, tricyclic or tetracyclic ring system, which may include fused or bridged ring systems. The heteroatoms in the heterocyclyl radical may be optionally oxidized. One or more nitrogen atoms, if present, are optionally quaternized. The heterocyclyl radical is partially or fully saturated. The heterocyclyl may be attached to the rest of the molecule through any atom of the ring(s). Examples of such heterocyclyl radicals include, but are not limited to, dioxolanyl, thienyl[1,3]dithianyl, decahydroisoquinolyl, imidazolinyl, imidazolidinyl, isothiazolidinyl, isoxazolidinyl, morpholinyl, octahydroindolyl, octahydroisoindolyl, 2-oxopiperazinyl, 2-oxopiperidinyl, 2-oxopyrrolidinyl, oxazolidinyl, piperidinyl, piperazinyl, 4-piperidonyl, pyrrolidinyl, pyrazolidinyl, quinuclidinyl, thiazolidinyl, tetrahydrofuryl, trithianyl, tetrahydropyranyl, thiomorpholinyl, thiamorpholinyl, 1-oxo-thiomorpholinyl, and 1,1-dioxo-thiomorpholinyl. Unless stated otherwise specifically in the specification, the term "heterocyclyl" is meant to include heterocyclyl radicals as defined above that are optionally substituted by one or more substituents selected from alkyl, alkenyl, alkynyl, halo, fluoroalkyl, oxo, thioxo, cyano, nitro, optionally substituted aryl, optionally substituted aralkyl, optionally substituted aralkenyl, optionally substituted aralkynyl, optionally substituted carbocyclyl, optionally substituted carbocyclylalkyl, optionally substituted heterocyclyl, optionally substituted heterocyclylalkyl, optionally substituted heteroaryl, optionally substituted heteroarylalkyl, -R b< -OR a< , -R b< -SR a< , -R b< -OC(O)-R a< , -R b< -N(R a< ) 2 , -R b< -C(O)R a< , -R b< -C(O)OR a< , -R b< -C(O)N(R a< ) 2 , -R b< -O-R c< -C(O)N(R a< ) 2 , -R b< -N(R a< )C(O)OR a< , -R b< -N(R a< )C(O)R a< , -R b< -N(R a< )S(O) t R a< (where t is 1 or 2), -R b< -S(O) t OR a< (where t is 1 or 2) and -R b< -S(O) t N(R a< ) 2 (where t is 1 or 2), where each R a< is independently hydrogen, alkyl, fluoroalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocyclyl, heterocyclylalkyl, heteroaryl or heteroarylalkyl, each R b< is independently a direct bond or a straight or branched alkylene or alkenylene chain, and R c< is a straight or branched alkylene or alkenylene chain, and where each of the above substituents is unsubstituted unless otherwise indicated.
[0060] "N-heterocyclyl" or "N-attached heterocyclyl" refers to a heterocyclyl radical as defined above containing at least one nitrogen and where the point of attachment of the heterocyclyl radical to the rest of the molecule is through a nitrogen atom in the heterocyclyl radical. An N-heterocyclyl radical is optionally substituted as described above for heterocyclyl radicals. Examples of such N-heterocyclyl radicals include, but are not limited to, 1-morpholinyl, 1-piperidinyl, 1-piperazinyl, 1-pyrrolidinyl, pyrazolidinyl, imidazolinyl, and imidazolidinyl.
[0061] "C-heterocyclyl" or "C-attached heterocyclyl" refers to a heterocyclyl radical as defined above containing at least one heteroatom and where the point of attachment of the heterocyclyl radical to the rest of the molecule is through a carbon atom in the heterocyclyl radical. A C-heterocyclyl radical is optionally substituted as described above for heterocyclyl radicals. Examples of such C-heterocyclyl radicals include, but are not limited to, 2-morpholinyl, 2- or 3- or 4-piperidinyl, 2-piperazinyl, 2- or 3-pyrrolidinyl, and the like.
[0062] "Heterocyclylalkyl" refers to a radical of the formula -R c< -heterocyclyl where R c< is an alkylene chain as defined above. If the heterocyclyl is a nitrogen-containing heterocyclyl, the heterocyclyl is optionally attached to the alkyl radical at the nitrogen atom. The alkylene chain of the heterocyclylalkyl radical is optionally substituted as defined above for an alkylene chain. The heterocyclyl part of the heterocyclylalkyl radical is optionally substituted as defined above for a heterocyclyl group.
[0063] "Heteroaryl" refers to a radical derived from a 3- to 18-membered aromatic ring radical that comprises two to seventeen carbon atoms and from one to six heteroatoms selected from nitrogen, oxygen and sulfur. As used herein, the heteroaryl radical may be a monocyclic, bicyclic, tricyclic or tetracyclic ring system, wherein at least one of the rings in the ring system is fully unsaturated, i.e., it contains a cyclic, delocalized (4n+2) π-electron system in accordance with the Hückel theory. Heteroaryl includes fused or bridged ring systems. The heteroatom(s) in the heteroaryl radical is optionally oxidized. One or more nitrogen atoms, if present, are optionally quaternized. The heteroaryl is attached to the rest of the molecule through any atom of the ring(s). Examples of heteroaryls include, but are not limited to, azepinyl, acridinyl, benzimidazolyl, benzindolyl, 1,3-benzodioxolyl, benzofuranyl, benzooxazolyl, benzo[d]thiazolyl, benzothiadiazolyl, benzo[b][1,4]dioxepinyl, benzo[b][1,4]oxazinyl, 1,4-benzodioxanyl, benzonaphthofuranyl, benzoxazolyl, benzodioxolyl, benzodioxinyl, benzopyranyl, benzopyranonyl, benzofuranyl, benzofuranonyl, benzothienyl (benzothiophenyl), benzothieno[3,2-d]pyrimidinyl, benzotriazolyl, benzo[4,6]imidazo[1,2-a]pyridinyl, carbazolyl, cinnolinyl, cyclopenta[d]pyrimidinyl, 6,7-dihydro-5H-cyclopenta[4,5]thieno[2,3-d]pyrimidinyl, 5,6-dihydrobenzo[h]quinazolinyl, 5,6-dihydrobenzo[h]cinnolinyl, 6,7-dihydro-5H-benzo[6,7]cyclohepta[1,2-c]pyridazinyl, dibenzofuranyl, dibenzothiophenyl, furanyl, furanonyl, furo[3,2-c]pyridinyl, 5,6,7,8,9,10-hexahydrocycloocta[d]pyrimidinyl, 5,6,7,8,9,10-hexahydrocycloocta[d]pyridazinyl, 5,6,7,8,9,10-hexahydrocycloocta[d]pyridinyl,isothiazolyl, imidazolyl, indazolyl, indolyl, indazolyl, isoindolyl, indolinyl, isoindolinyl, isoquinolyl, indolizinyl, isoxazolyl, 5,8-methano-5,6,7,8-tetrahydroquinazolinyl, naphthyridinyl, 1,6-naphthyridinonyl, oxadiazolyl, 2-oxoazepinyl, oxazolyl, oxiranyl, 5,6,6a,7,8,9,10,10a-octahydrobenzo[h]quinazolinyl, 1-phenyl-1H-pyrrolyl, phenazinyl, phenothiazinyl, phenoxazinyl, phthalazinyl, pteridinyl, purinyl, pyrrolyl, pyrazolyl, pyrazolo[3,4-d]pyrimidinyl, pyridinyl, pyrido[3,2-d]pyrimidinyl, pyrido[3,4-d]pyrimidinyl, pyrazinyl, pyrimidinyl, pyridazinyl, pyrrolyl, quinazolinyl, quinoxalinyl, quinolinyl, isoquinolinyl, tetrahydroquinolinyl, 5,6,7,8-tetrahydroquinazolinyl, 5,6,7,8-tetrahydrobenzo[4,5]thieno[2,3-d]pyrimidinyl, 6,7,8,9-tetrahydro-5H-cyclohepta[4,5]thieno[2,3-d]pyrimidinyl, 5,6,7,8-tetrahydropyrido[4,5-c]pyridazinyl, thiazolyl, thiadiazolyl, triazolyl, tetrazolyl, triazinyl, thieno[2,3-d]pyrimidinyl, thieno[3,2-d]pyrimidinyl, thieno[2,3-c]pridinyl, and thiophenyl (i.e. thienyl). Unless stated otherwise specifically in the specification, the term "heteroaryl" is meant to include heteroaryl radicals as defined above which are optionally substituted by one or more substituents selected from alkyl, alkenyl, alkynyl, halo, fluoroalkyl, haloalkenyl, haloalkynyl, oxo, thioxo, cyano, nitro, optionally substituted aryl, optionally substituted aralkyl, optionally substituted aralkenyl, optionally substituted aralkynyl, optionally substituted carbocyclyl, optionally substituted carbocyclylalkyl, optionally substituted heterocyclyl, optionally substituted heterocyclylalkyl, optionally substituted heteroaryl, optionally substituted heteroarylalkyl, -R b< -OR a< , -R b< -SR a< , -R b< -OC(O)-R a< , -R b< -N(R a< ) 2 , -R b< -C(O)R a< , -R b< -C(O)OR a< , -R b< -C(O)N(R a< ) 2 , -R b< -O-R c< -C(O)N(R a< ) 2 , -R b< -N(R a< )C(O)OR a< , -R b< -N(R a< )C(O)R a< , -R b< -N(R a< )S(O) t R a< (where t is 1 or 2), -R b< -S(O) t OR a< (where t is 1 or 2) and -R b< -S(O) t N(R a< ) 2 (where t is 1 or 2), where each R a< is independently hydrogen, alkyl, fluoroalkyl, cycloalkyl, cycloalkylalkyl, aryl, aralkyl, heterocyclyl, heterocyclylalkyl, heteroaryl or heteroarylalkyl, each R b< is independently a direct bond or a straight or branched alkylene or alkenylene chain, and R c< is a straight or branched alkylene or alkenylene chain, and where each of the above substituents is unsubstituted unless otherwise indicated.
[0064] "N-heteroaryl" refers to a heteroaryl radical as defined above containing at least one nitrogen and where the point of attachment of the heteroaryl radical to the rest of the molecule is through a nitrogen atom in the heteroaryl radical. An N-heteroaryl radical is optionally substituted as described above for heteroaryl radicals.
[0065] "C-heteroaryl" refers to a heteroaryl radical as defined above and where the point of attachment of the heteroaryl radical to the rest of the molecule is through a carbon atom in the heteroaryl radical. A C-heteroaryl radical is optionally substituted as described above for heteroaryl radicals.
[0066] "Heteroarylalkyl" refers to a radical of the formula -R c< -heteroaryl, where R c< is an alkylene chain as defined above. If the heteroaryl is a nitrogen-containing heteroaryl, the heteroaryl is optionally attached to the alkyl radical at the nitrogen atom. The alkylene chain of the heteroarylalkyl radical is optionally substituted as defined above for an alkylene chain. The heteroaryl part of the heteroarylalkyl radical is optionally substituted as defined above for a heteroaryl group.
[0067] The compounds, or their pharmaceutically acceptable salts may contain one or more asymmetric centers and may thus give rise to enantiomers, diastereomers, and other stereoisomeric forms that may be defined, in terms of absolute stereochemistry, as (R)- or (S)- or, as (D)- or (L)- for amino acids. When the compounds described herein contain olefinic double bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E (or trans) and Z (cis) geometric isomers. Likewise, all possible isomers, as well as their racemic and optically pure forms, and all tautomeric forms are also intended to be included.
[0068] A "stereoisomer" refers to a compound made up of the same atoms bonded by the same bonds but having different three-dimensional structures, which are not interchangeable. It is therefore contemplated that various stereoisomers and mixtures thereof and includes "enantiomers," which refers to two stereoisomers whose molecules are nonsuperimposeable mirror images of one another.
[0069] A "tautomer" refers to a proton shift from one atom of a molecule to another atom of the same molecule. The compounds presented herein may exist as tautomers. Tautomers are compounds that are interconvertible by migration of a hydrogen atom, accompanied by a switch of a single bond and adjacent double bond. In solutions where tautomerization is possible, a chemical equilibrium of the tautomers will exist. The exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Some examples of tautomeric pairs include:
[0070] "Optional" or "optionally" means that a subsequently described event or circumstance may or may not occur and that the description includes instances when the event or circumstance occurs and instances in which it does not.
[0071] "Pharmaceutically acceptable salt" includes both acid and base addition salts. A pharmaceutically acceptable salt of any one of the alkoxyphenyl-linked amine derivative compounds described herein is intended to encompass any and all pharmaceutically suitable salt forms. Preferred pharmaceutically acceptable salts of the compounds described herein are pharmaceutically acceptable acid addition salts and pharmaceutically acceptable base addition salts.
[0072] "Pharmaceutically acceptable acid addition salt" refers to those salts which retain the biological effectiveness and properties of the free bases, which are not biologically or otherwise undesirable, and which are formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, hydroiodic acid, hydrofluoric acid, phosphorous acid, and the like. Also included are salts that are formed with organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, alkanedioic acids, aromatic acids, aliphatic and. aromatic sulfonic acids, etc. and include, for example, acetic acid, trifluoroacetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, and the like. Exemplary salts thus include sulfates, pyrosulfates, bisulfates, sulfites, bisulfites, nitrates, phosphates, monohydrogenphosphates, dihydrogenphosphates, metaphosphates, pyrophosphates, chlorides, bromides, iodides, acetates, trifluoroacetates, propionates, caprylates, isobutyrates, oxalates, malonates, succinate suberates, sebacates, fumarates, maleates, mandelates, benzoates, chlorobenzoates, methylbenzoates, dinitrobenzoates, phthalates, benzenesulfonates, toluenesulfonates, phenylacetates, citrates, lactates, malates, tartrates, methanesulfonates, and the like. Also contemplated are salts of amino acids, such as arginates, gluconates, and galacturonates (see, for example, Berge S.M. et al., "Pharmaceutical Salts," Journal of Pharmaceutical Science, 66: 1-19 (1997)).
[0073] Acid addition salts of basic compounds may be prepared by contacting the free base forms with a sufficient amount of the desired acid to produce the salt according to methods and techniques with which a skilled artisan is familiar.
[0074] "Pharmaceutically acceptable base addition salt" refers to those salts that retain the biological effectiveness and properties of the free acids, which are not biologically or otherwise undesirable. These salts are prepared from addition of an inorganic base or an organic base to the free acid. Pharmaceutically acceptable base addition salts may be formed with metals or amines, such as alkali and alkaline earth metals or organic amines. Salts derived from inorganic bases include, but are not limited to, sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum salts and the like. Salts derived from organic bases include, but are not limited to, salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, for example, isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, ethanolamine, diethanolamine, 2-dimethylaminoethanol, 2-diethylaminoethanol, dicyclohexylamine, lysine, arginine, histidine, caffeine, procaine, N,N-dibenzylethylenediamine, chloroprocaine, hydrabamine, choline, betaine, ethylenediamine, ethylenedianiline, N-methylglucamine, glucosamine, methylglucamine, theobromine, purines, piperazine, piperidine, N-ethylpiperidine, polyamine resins and the like. See Berge et al., supra.
[0075] As used herein, "treatment" or "treating," or "palliating" or "ameliorating" are used interchangeably herein. These terms refers to an approach for obtaining beneficial or desired results including but not limited to therapeutic benefit and / or a prophylactic benefit. By "therapeutic benefit" is meant eradication or amelioration of the underlying disorder being treated. Also, a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the patient, notwithstanding that the patient may still be afflicted with the underlying disorder. For prophylactic benefit, the compositions may be administered to a patient at risk of developing a particular disease, or to a patient reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease may not have been made.
[0076] "Prodrug" is meant to indicate a compound that may be converted under physiological conditions or by solvolysis to a biologically active compound described herein. Thus, the term "prodrug" refers to a precursor of a biologically active compound that is pharmaceutically acceptable. A prodrug may be inactive when administered to a subject, but is converted in vivo to an active compound, for example, by hydrolysis. The prodrug compound often offers advantages of solubility, tissue compatibility or delayed release in a mammalian organism (see, e.g., Bundgard, H., Design of Prodrugs (1985), pp. 7-9, 21-24 (Elsevier, Amsterdam).
[0077] A discussion of prodrugs is provided in Higuchi, T., et al., "Pro-drugs as Novel Delivery Systems," A.C.S. Symposium Series, Vol. 14, and in Bioreversible Carriers in Drug Design, ed. Edward B. Roche, American Pharmaceutical Association and Pergamon Press, 1987.
[0078] The term "prodrug" is also meant to include any covalently bonded carriers, which release the active compound in vivo when such prodrug is administered to a mammalian subject. Prodrugs of an active compound, as described herein, may be prepared by modifying functional groups present in the active compound in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent active compound. Prodrugs include compounds wherein a hydroxy, amino or mercapto group is bonded to any group that, when the prodrug of the active compound is administered to a mammalian subject, cleaves to form a free hydroxy, free amino or free mercapto group, respectively. Examples of prodrugs include, but are not limited to, acetate, formate and benzoate derivatives of alcohol or amine functional groups in the active compounds and the like.Conjugate Compounds
[0079] The present disclosure provides compounds that selectively bind to cancerous cells and tissues. In various aspects, the compounds of the present disclosure comprise a peptide portion and a detectable agent conjugated together.
[0080] In various aspects of the present disclosure, the peptide portions of the compounds described herein have certain features in common with the native chlorotoxin (CTX) peptide. The native chlorotoxin peptide was originally isolated from the scorpion Leiurus quinquestriatus. Chlorotoxin is a 36 amino acid peptide that selectively binds to cancerous cells. The peptide portions of the present compounds have advantageously retained at least some of the cancer-cell binding activity of chlorotoxin. The cancer-cell binding activity of chlorotoxin provides certain advantages for the detection and treatment of cancer because it facilitates the selective localization of detectable agents and therapeutic agents to the cancer cells for the detection and treatment of cancer.
[0081] Table 1 below sets forth certain polypeptide sequences for use with the present disclosure. Citrulline is designated as"Cit" in the sequences. Table 1. Exemplary peptide sequences suitable for use in the compounds of the present disclosure. Cit = Citrulline.SEQ ID NO. Polypeptide Sequence 1MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR2MCMPCFTTDHQMARACDDCCGGKGRGKCYGPQCLCR3MCMPCFTTDHQMARRCDDCCGGKGRGKCYGPQCLCR4MCMPCFTTDHQMARKCDDCCGGAGRGKCYGPQCLCR5MCMPCFTTDHQMARACDDCCGGAGRGKCYGPQCLCR6MCMPCFTTDHQMARRCDDCCGGAGRGKCYGPQCLCR7MCMPCFTTDHQMARKCDDCCGGRGRGKCYGPQCLCR8MCMPCFTTDHQMARACDDCCGGRGRGKCYGPQCLCR9MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR10MCMPCFTTDHQMARKCDDCCGGKGRGACYGPQCLCR11MCMPCFTTDHQMARACDDCCGGKGRGACYGPQCLCR12MCMPCFTTDHQMARRCDDCCGGKGRGACYGPQCLCR13MCMPCFTTDHQMARKCDDCCGGAGRGACYGPQCLCR14MCMPCFTTDHQMARACDDCCGGAGRGACYGPQCLCR15MCMPCFTTDHQMARRCDDCCGGAGRGACYGPQCLCR16MCMPCFTTDHQMARKCDDCCGGRGRGACYGPQCLCR17MCMPCFTTDHQMARACDDCCGGRGRGACYGPQCLCR18MCMPCFTTDHQMARRCDDCCGGRGRGACYGPQCLCR19MCMPCFTTDHQMARKCDDCCGGKGRGRCYGPQCLCR20MCMPCFTTDHQMARACDDCCGGKGRGRCYGPQCLCR21MCMPCFTTDHQMARRCDDCCGGKGRGRCYGPQCLCR22MCMPCFTTDHQMARKCDDCCGGAGRGRCYGPQCLCR23MCMPCFTTDHQMARACDDCCGGAGRGRCYGPQCLCR24MCMPCFTTDHQMARRCDDCCGGAGRGRCYGPQCLCR25MCMPCFTTDHQMARKCDDCCGGRGRGRCYGPQCLCR26MCMPCFTTDHQMARACDDCCGGRGRGRCYGPQCLCR27MCMPCFTTDHQMARRCDDCCGGRGRGRCYGPQCLCR28MCMPCFTTDHQMARRCDDCCGGRGRGRCYGPQCLCR29KCMPCFTTDHQMARRCDDCCGGRGRGRCYGPQCLCR30ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR31KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR32MCMPCFTTDHQMAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR33MCMPCFTTDHQMAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR34KCMPCFTTDHQMAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR35ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR36ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR37KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR38MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCRGAGAAGG39MCMPCFTTDHQMARACDDCCGGKGRGKCYGPQCLCRGAGAAGG40MCMPCFTTDHQMARRCDDCCGGKGRGKCYGPQCLCRGAGAAGG41MCMPCFTTDHQMARKCDDCCGGAGRGKCYGPQCLCRGAGAAGG42MCMPCFTTDHQMARACDDCCGGAGRGKCYGPQCLCRGAGAAGG43MCMPCFTTDHQMARRCDDCCGGAGRGKCYGPQCLCRGAGAAGG44MCMPCFTTDHQMARKCDDCCGGRGRGKCYGPQCLCRGAGAAGG45MCMPCFTTDHQMARACDDCCGGRGRGKCYGPQCLCRGAGAAGG46MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCRGAGAAGG47MCMPCFTTDHQMARKCDDCCGGKGRGACYGPQCLCRGAGAAGG48MCMPCFTTDHQMARACDDCCGGKGRGACY GPQCLCRGAGAAGG49MCMPCFTTDHQMARRCDDCCGGKGRGACYGPQCLCRGAGAAGG50MCMPCFTTDHQMARKCDDCCGGAGRGACYGPQCLCRGAGAAGG51MCMPCFTTDHQMARACDDCCGGAGRGACYGPQCLCRGAGAAGG52MCMPCFTTDHQMARRCDDCCGGAGRGACYGPQCLCRGAGAAGG53MCMPCFTTDHQMARKCDDCCGGRGRGACYGPQCLCRGAGAAGG54MCMPCFTTDHQMARACDDCCGGRGRGACYGPQCLCRGAGAAGG55MCMPCFTTDHQMARRCDDCCGGRGRGACYGPQCLCRGAGAAGG56MCMPCFTTDHQMARKCDDCCGGKGRGRCYGPQCLCRGAGAAGG57MCMPCFTTDHQMARACDDCCGGKGRGRCYGPQCLCRGAGAAGG58MCMPCFTTDHQMARRCDDCCGGKGRGRCYGPQCLCRGAGAAGG59MCMPCFTTDHQMARKCDDCCGGAGRGRCYGPQCLCRGAGAAGG60MCMPCFTTDHQMARACDDCCGGAGRGRCYGPQCLCRGAGAAGG61MCMPCFTTDHQMARRCDDCCGGAGRGRCYGPQCLCRGAGAAGG62MCMPCFTTDHQMARKCDDCCGGRGRGRCYGPQCLCRGAGAAGG63MCMPCFTTDHQMARACDDCCGGRGRGRCYGPQCLCRGAGAAGG64MCMPCFTTDHQMARRCDDCCGGRGRGRCYGPQCLCRGAGAAGG65MCMPCFTTDHQMARRCDDCCGGRGRGRCYGPQCLCRGAGAAGG66KCMPCFTTDHQMARRCDDCCGGRGRGRCYGPQCLCRGAGAAGG67ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCRGAGAAGG68KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCRGAGAAGG69MCMPCFTTDHQMAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCRGAGAAGG70MCMPCFTTDHQMAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG71KCMPCFTTDHQMAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG72ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCRGAGAAGG73ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG74KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG75MCMPCFTTDHQMVRKCDDCCGGKGRGKCYGPQCLCR76MCMPCFTTDHQMVRVCDDCCGGKGRGKCYGPQCLCR77MCMPCFTTDHQMVRRCDDCCGGKGRGKCYGPQCLCR78MCMPCFTTDHQMVRKCDDCCGGVGRGKCYGPQCLCR79MCMPCFTTDHQMVRVCDDCCGGVGRGKCYGPQCLCR80MCMPCFTTDHQMVRRCDDCCGGVGRGKCYGPQCLCR81MCMPCFTTDHQMVRKCDDCCGGRGRGKCYGPQCLCR82MCMPCFTTDHQMVRVCDDCCGGRGRGKCYGPQCLCR83MCMPCFTTDHQMVRRCDDCCGGRGRGKCYGPQCLCR84MCMPCFTTDHQMVRKCDDCCGGKGRGVCYGPQCLCR85MCMPCFTTDHQMVRVCDDCCGGKGRGVCYGPQCLCR86MCMPCFTTDHQMVRRCDDCCGGKGRGVCYGPQCLCR87MCMPCFTTDHQMVRKCDDCCGGVGRGVCYGPQCLCR88MCMPCFTTDHQMVRVCDDCCGGVGRGVCYGPQCLCR89MCMPCFTTDHQMVRRCDDCCGGVGRGVCYGPQCLCR90MCMPCFTTDHQMVRKCDDCCGGRGRGVCYGPQCLCR91MCMPCFTTDHQMVRVCDDCCGGRGRGVCYGPQCLCR92MCMPCFTTDHQMVRRCDDCCGGRGRGVCYGPQCLCR93MCMPCFTTDHQMVRKCDDCCGGKGRGRCYGPQCLCR94MCMPCFTTDHQMVRVCDDCCGGKGRGRCYGPQCLCR95MCMPCFTTDHQMVRRCDDCCGGKGRGRCYGPQCLCR96MCMPCFTTDHQMVRKCDDCCGGVGRGRCYGPQCLCR97MCMPCFTTDHQMVRVCDDCCGGVGRGRCYGPQCLCR98MCMPCFTTDHQMVRRCDDCCGGVGRGRCYGPQCLCR99MCMPCFTTDHQMVRKCDDCCGGRGRGRCYGPQCLCR100MCMPCFTTDHQMVRVCDDCCGGRGRGRCYGPQCLCR101MCMPCFTTDHQMVRRCDDCCGGRGRGRCYGPQCLCR102MCMPCFTTDHQMVRRCDDCCGGRGRGRCYGPQCLCR103KCMPCFTTDHQMVRRCDDCCGGRGRGRCYGPQCLCR104VCVPCFTTDHQVVRRCDDCCGGRGRGRCYGPQCLCR105KCVPCFTTDHQVVRRCDDCCGGRGRGRCYGPQCLCR106MCMPCFTTDHQMVR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR107MCMPCFTTDHQMVR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR108KCMPCFTTDHQMVR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR109VCVPCFTTDHQVVR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR110VCVPCFTTDHQVVR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR111KCVPCFTTDHQVVR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR112MCMPCFTTDHQMVRKCDDCCGGKGRGKCYGPQCLCRGAGAAGG113MCMPCFTTDHQMVRVCDDCCGGKGRGKCYGPQCLCRGAGAAGG114MCMPCFTTDHQMVRRCDDCCGGKGRGKCYGPQCLCRGAGAAGG115MCMPCFTTDHQMVRKCDDCCGGVGRGKCYGPQCLCRGAGAAGG116MCMPCFTTDHQMVRVCDDCCGGVGRGKCYGPQCLCRGAGAAGG117MCMPCFTTDHQMVRRCDDCCGGVGRGKCYGPQCLCRGAGAAGG118MCMPCFTTDHQMVRKCDDCCGGRGRGKCYGPQCLCRGAGAAGG119MCMPCFTTDHQMVRVCDDCCGGRGRGKCYGPQCLCRGAGAAGG120MCMPCFTTDHQMVRRCDDCCGGRGRGKCYGPQCLCRGAGAAGG121MCMPCFTTDHQMVRKCDDCCGGKGRGVCYGPQCLCRGAGAAGG122MCMPCFTTDHQMVRVCDDCCGGKGRGVCYGPQCLCRGAGAAGG123MCMPCFTTDHQMVRRCDDCCGGKGRGVCYGPQCLCRGAGAAGG124MCMPCFTTDHQMVRKCDDCCGGVGRGVCYGPQCLCRGAGAAGG125MCMPCFTTDHQMVRVCDDCCGGVGRGVCYGPQCLCRGAGAAGG126MCMPCFTTDHQMVRRCDDCCGGVGRGVCYGPQCLCRGAGAAGG127MCMPCFTTDHQMVRKCDDCCGGRGRGVCYGPQCLCRGAGAAGG128MCMPCFTTDHQMVRVCDDCCGGRGRGVCYGPQCLCRGAGAAGG129MCMPCFTTDHQMVRRCDDCCGGRGRGVCYGPQCLCRGAGAAGG130MCMPCFTTDHQMVRKCDDCCGGKGRGRCYGPQCLCRGAGAAGG131MCMPCFTTDHQMVRVCDDCCGGKGRGRCYGPQCLCRGAGAAGG132MCMPCFTTDHQMVRRCDDCCGGKGRGRCYGPQCLCRGAGAAGG133MCMPCFTTDHQMVRKCDDCCGGVGRGRCYGPQCLCRGAGAAGG134MCMPCFTTDHQMVRVCDDCCGGVGRGRCYGPQCLCRGAGAAGG135MCMPCFTTDHQMVRRCDDCCGGVGRGRCYGPQCLCRGAGAAGG136MCMPCFTTDHQMVRKCDDCCGGRGRGRCYGPQCLCRGAGAAGG137MCMPCFTTDHQMVRVCDDCCGGRGRGRCYGPQCLCRGAGAAGG138MCMPCFTTDHQMVRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG139MCMPCFTTDHQMVRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG140KCMPCFTTDHQMVRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG141VCVPCFTTDHQVVRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG142KCVPCFTTDHQVVRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG143MCMPCFTTDHQMVR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCRGAGAAGG144MCMPCFTTDHQMVR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG145KCMPCFTTDHQMVR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG146VCVPCFTTDHQVVR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCRGAGAAGG147VCVPCFTTDHQVVR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG148KCVPCFTTDHQVVR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG149MCMPCFTTDHQMLRKCDDCCGGKGRGKCYGPQCLCR150MCMPCFTTDHQMLRLCDDCCGGKGRGKCYGPQCLCR151MCMPCFTTDHQMLRRCDDCCGGKGRGKCYGPQCLCR152MCMPCFTTDHQMLRKCDDCCGGLGRGKCYGPQCLCR153MCMPCFTTDHQMLRLCDDCCGGLGRGKCYGPQCLCR154MCMPCFTTDHQMLRRCDDCCGGLGRGKCYGPQCLCR155MCMPCFTTDHQMLRKCDDCCGGRGRGKCYGPQCLCR156MCMPCFTTDHQMLRLCDDCCGGRGRGKCYGPQCLCR157MCMPCFTTDHQMLRRCDDCCGGRGRGKCYGPQCLCR158MCMPCFTTDHQMLRKCDDCCGGKGRGLCYGPQCLCR159MCMPCFTTDHQMLRLCDDCCGGKGRGLCYGPQCLCR160MCMPCFTTDHQMLRRCDDCCGGKGRGLCYGPQCLCR161MCMPCFTTDHQMLRKCDDCCGGLGRGLCYGPQCLCR162MCMPCFTTDHQMLRLCDDCCGGLGRGLCYGPQCLCR163MCMPCFTTDHQMLRRCDDCCGGLGRGLCYGPQCLCR164MCMPCFTTDHQMLRKCDDCCGGRGRGLCYGPQCLCR165MCMPCFTTDHQMLRLCDDCCGGRGRGLCYGPQCLCR166MCMPCFTTDHQMLRRCDDCCGGRGRGLCYGPQCLCR167MCMPCFTTDHQMLRKCDDCCGGKGRGRCYGPQCLCR168MCMPCFTTDHQMLRLCDDCCGGKGRGRCYGPQCLCR169MCMPCFTTDHQMLRRCDDCCGGKGRGRCYGPQCLCR170MCMPCFTTDHQMLRKCDDCCGGLGRGRCYGPQCLCR171MCMPCFTTDHQMLRLCDDCCGGLGRGRCYGPQCLCR172MCMPCFTTDHQMLRRCDDCCGGLGRGRCYGPQCLCR173MCMPCFTTDHQMLRKCDDCCGGRGRGRCYGPQCLCR174MCMPCFTTDHQMLRLCDDCCGGRGRGRCYGPQCLCR175MCMPCFTTDHQMLRRCDDCCGGRGRGRCYGPQCLCR176MCMPCFTTDHQMLRRCDDCCGGRGRGRCYGPQCLCR177KCMPCFTTDHQMLRRCDDCCGGRGRGRCYGPQCLCR178LCLPCFTTDHQLLRRCDDCCGGRGRGRCYGPQCLCR179KCLPCFTTDHQLLRRCDDCCGGRGRGRCYGPQCLCR180MCMPCFTTDHQMLR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR181MCMPCFTTDHQMLR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR182KCMPCFTTDHQMLR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR183LCLPCFTTDHQLLR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR184LCLPCFTTDHQLLR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR185KCLPCFTTDHQLLR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR186MCMPCFTTDHQMLRKCDDCCGGKGRGKCYGPQCLCRGAGAAGG187MCMPCFTTDHQMLRLCDDCCGGKGRGKCYGPQCLCRGAGAAGG188MCMPCFTTDHQMLRRCDDCCGGKGRGKCYGPQCLCRGAGAAGG189MCMPCFTTDHQMLRKCDDCCGGLGRGKCYGPQCLCRGAGAAGG190MCMPCFTTDHQMLRLCDDCCGGLGRGKCYGPQCLCRGAGAAGG191MCMPCFTTDHQMLRRCDDCCGGLGRGKCYGPQCLCRGAGAAGG192MCMPCFTTDHQMLRKCDDCCGGRGRGKCYGPQCLCRGAGAAGG193MCMPCFTTDHQMLRLCDDCCGGRGRGKCYGPQCLCRGAGAAGG194MCMPCFTTDHQMLRRCDDCCGGRGRGKCYGPQCLCRGAGAAGG195MCMPCFTTDHQMLRKCDDCCGGKGRGLCYGPQCLCRGAGAAGG196MCMPCFTTDHQMLRLCDDCCGGKGRGLCYGPQCLCRGAGAAGG197MCMPCFTTDHQMLRRCDDCCGGKGRGLCYGPQCLCRGAGAAGG198MCMPCFTTDHQMLRKCDDCCGGLGRGLCYGPQCLCRGAGAAGG199MCMPCFTTDHQMLRLCDDCCGGLGRGLCYGPQCLCRGAGAAGG200MCMPCFTTDHQMLRRCDDCCGGLGRGLCYGPQCLCRGAGAAGG201MCMPCFTTDHQMLRKCDDCCGGRGRGLCYGPQCLCRGAGAAGG202MCMPCFTTDHQMLRLCDDCCGGRGRGLCYGPQCLCRGAGAAGG203MCMPCFTTDHQMLRRCDDCCGGRGRGLCYGPQCLCRGAGAAGG204MCMPCFTTDHQMLRKCDDCCGGKGRGRCYGPQCLCRGAGAAGG205MCMPCFTTDHQMLRLCDDCCGGKGRGRCYGPQCLCRGAGAAGG206MCMPCFTTDHQMLRRCDDCCGGKGRGRCYGPQCLCRGAGAAGG207MCMPCFTTDHQMLRKCDDCCGGLGRGRCYGPQCLCRGAGAAGG208MCMPCFTTDHQMLRLCDDCCGGLGRGRCYGPQCLCRGAGAAGG209MCNVCFTTDHQMLRRCDDCCGGLGRGRCYGPQCLCRGAGAAGG210MCMPCFTTDHQMLRKCDDCCGGRGRGRCYGPQCLCRGAGAAGG211MCMPCFTTDHQMLRLCDDCCGGRGRGRCYGPQCLCRGAGAAGG212MCMPCFTTDHQMLRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG213MCMPCFTTDHQMLRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG214KCMPCFTTDHQMLRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG215LCLPCFTTDHQLLRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG216KCLPCFTTDHQLLRRCDDCCGGRGRGRCYGPQCLCRGAGAAGG217MCMPCFTTDHQMLR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCRGAGAAGG218MCMPCFTTDHQMLR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG219KCMPCFTTDHQMLR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG220LCLPCFTTDHQLLR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCRGAGAAGG221LCLPCFTTDHQLLR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG222KCLPCFTTDHQLLR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCRGAGAAGG223GCGPCFTTDHQGARKCDDCCGGKGRGKCYGPQCLCR224GCGPCFTTDHQGARACDDCCGGKGRGKCYGPQCLCR225GCGPCFTTDHQGARRCDDCCGGKGRGKCYGPQCLCR226GCGPCFTTDHQGARKCDDCCGGAGRGKCYGPQCLCR227GCGPCFTTDHQGARACDDCCGGAGRGKCYGPQCLCR228GCGPCFTTDHQGARRCDDCCGGAGRGKCYGPQCLCR229GCGPCFTTDHQGARKCDDCCGGRGRGKCYGPQCLCR230GCGPCFTTDHQGARACDDCCGGRGRGKCYGPQCLCR231GCGPCFTTDHQGARRCDDCCGGRGRGKCYGPQCLCR232GCGPCFTTDHQGARKCDDCCGGKGRGACYGPQCLCR233GCGPCFTTDHQGARACDDCCGGKGRGACYGPQCLCR234GCGPCFTTDHQGARRCDDCCGGKGRGACYGPQCLCR235GCGPCFTTDHQGARKCDDCCGGAGRGACYGPQCLCR236GCGPCFTTDHQGARACDDCCGGAGRGACYGPQCLCR237GCGPCFTTDHQGARRCDDCCGGAGRGACYGPQCLCR238GCGPCFTTDHQGARKCDDCCGGRGRGACYGPQCLCR239GCGPCFTTDHQGARACDDCCGGRGRGACYGPQCLCR240GCGPCFTTDHQGARRCDDCCGGRGRGACYGPQCLCR241GCGPCFTTDHQGARKCDDCCGGKGRGRCYGPQCLCR242GCGPCFTTDHQGARACDDCCGGKGRGRCYGPQCLCR243GCGPCFTTDHQGARRCDDCCGGKGRGRCYGPQCLCR244GCGPCFTTDHQGARKCDDCCGGAGRGRCYGPQCLCR245GCGPCFTTDHQGARACDDCCGGAGRGRCYGPQCLCR246GCGPCFTTDHQGARRCDDCCGGAGRGRCYGPQCLCR247GCGPCFTTDHQGARKCDDCCGGRGRGRCYGPQCLCR248GCGPCFTTDHQGARACDDCCGGRGRGRCYGPQCLCR249GCGPCFTTDHQGARRCDDCCGGRGRGRCYGPQCLCR250GCGPCFTTDHQGARRCDDCCGGRGRGRCYGPQCLCR251KCGPCFTTDHQGARRCDDCCGGRGRGRCYGPQCLCR252ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR253KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR254GCGPCFTTDHQGAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR255GCGPCFTTDHQGAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR256KCGPCFTTDHQGAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR257ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR258ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR259KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR260ACAPCFTTDHQAARKCDDCCGGKGRGKCYGPQCLCR261ACAPCFTTDHQAARACDDCCGGKGRGKCYGPQCLCR262ACAPCFTTDHQAARRCDDCCGGKGRGKCYGPQCLCR263ACAPCFTTDHQAARKCDDCCGGAGRGKCYGPQCLCR264ACAPCFTTDHQAARACDDCCGGAGRGKCYGPQCLCR265ACAPCFTTDHQAARRCDDCCGGAGRGKCYGPQCLCR266ACAPCFTTDHQAARKCDDCCGGRGRGKCYGPQCLCR267ACAPCFTTDHQAARACDDCCGGRGRGKCYGPQCLCR268ACAPCFTTDHQAARRCDDCCGGRGRGKCYGPQCLCR269ACAPCFTTDHQAARKCDDCCGGKGRGACYGPQCLCR270ACAPCFTTDHQAARACDDCCGGKGRGACYGPQCLCR271ACAPCFTTDHQAARRCDDCCGGKGRGACYGPQCLCR272ACAPCFTTDHQAARKCDDCCGGAGRGACYGPQCLCR273ACAPCFTTDHQAARACDDCCGGAGRGACYGPQCLCR274ACAPCFTTDHQAARRCDDCCGGAGRGACYGPQCLCR275ACAPCFTTDHQAARKCDDCCGGRGRGACYGPQCLCR276ACAPCFTTDHQAARACDDCCGGRGRGACYGPQCLCR277ACAPCFTTDHQAARRCDDCCGGRGRGACYGPQCLCR278ACAPCFTTDHQAARKCDDCCGGKGRGRCYGPQCLCR279ACAPCFTTDHQAARACDDCCGGKGRGRCYGPQCLCR280ACAPCFTTDHQAARRCDDCCGGKGRGRCYGPQCLCR281ACAPCFTTDHQAARKCDDCCGGAGRGRCYGPQCLCR282ACAPCFTTDHQAARACDDCCGGAGRGRCYGPQCLCR283ACAPCFTTDHQAARRCDDCCGGAGRGRCYGPQCLCR284ACAPCFTTDHQAARKCDDCCGGRGRGRCYGPQCLCR285ACAPCFTTDHQAARACDDCCGGRGRGRCYGPQCLCR286ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR287ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR288KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR289ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR290KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR291ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR292ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR293KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR294ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR295ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR296KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR297ICIPCFTTDHQIARKCDDCCGGKGRGKCYGPQCLCR298ICIPCFTTDHQIARACDDCCGGKGRGKCYGPQCLCR299ICIPCFTTDHQIARRCDDCCGGKGRGKCYGPQCLCR300ICIPCFTTDHQIARKCDDCCGGAGRGKCYGPQCLCR301ICIPCFTTDHQIARACDDCCGGAGRGKCYGPQCLCR302ICIPCFTTDHQIARRCDDCCGGAGRGKCYGPQCLCR303ICIPCFTTDHQIARKCDDCCGGRGRGKCYGPQCLCR304ICIPCFTTDHQIARACDDCCGGRGRGKCYGPQCLCR305ICIPCFTTDHQIARRCDDCCGGRGRGKCYGPQCLCR306ICIPCFTTDHQIARKCDDCCGGKGRGACYGPQCLCR307ICIPCFTTDHQIARACDDCCGGKGRGACYGPQCLCR308ICIPCFTTDHQIARRCDDCCGGKGRGACYGPQCLCR309ICIPCFTTDHQIARKCDDCCGGAGRGACYGPQCLCR310ICIPCFTTDHQIARACDDCCGGAGRGACYGPQCLCR311ICIPCFTTDHQIARRCDDCCGGAGRGACYGPQCLCR312ICIPCFTTDHQIARKCDDCCGGRGRGACYGPQCLCR313ICIPCFTTDHQIARACDDCCGGRGRGACYGPQCLCR314ICIPCFTTDHQIARRCDDCCGGRGRGACYGPQCLCR315ICIPCFTTDHQIARKCDDCCGGKGRGRCYGPQCLCR316ICIPCFTTDHQIARACDDCCGGKGRGRCYGPQCLCR317ICIPCFTTDHQIARRCDDCCGGKGRGRCYGPQCLCR318ICIPCFTTDHQIARKCDDCCGGAGRGRCYGPQCLCR319ICIPCFTTDHQIARACDDCCGGAGRGRCYGPQCLCR320ICIPCFTTDHQIARRCDDCCGGAGRGRCYGPQCLCR321ICIPCFTTDHQIARKCDDCCGGRGRGRCYGPQCLCR322ICIPCFTTDHQIARACDDCCGGRGRGRCYGPQCLCR323ICIPCFTTDHQIARRCDDCCGGRGRGRCYGPQCLCR324ICIPCFTTDHQIARRCDDCCGGRGRGRCYGPQCLCR325KCIPCFTTDHQIARRCDDCCGGRGRGRCYGPQCLCR326ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR327KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR328ICIPCFTTDHQIAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR329ICIPCFTTDHQIAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR330KCIPCFTTDHQIAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR331ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR332ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR333KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR334TCTPCFTTDHQTARKCDDCCGGKGRGKCYGPQCLCR335TCTPCFTTDHQTARACDDCCGGKGRGKCYGPQCLCR336TCTPCFTTDHQTARRCDDCCGGKGRGKCYGPQCLCR337TCTPCFTTDHQTARKCDDCCGGAGRGKCYGPQCLCR338TCTPCFTTDHQTARACDDCCGGAGRGKCYGPQCLCR339TCTPCFTTDHQTARRCDDCCGGAGRGKCYGPQCLCR340TCTPCFTTDHQTARKCDDCCGGRGRGKCYGPQCLCR341TCTPCFTTDHQTARACDDCCGGRGRGKCYGPQCLCR342TCTPCFTTDHQTARRCDDCCGGRGRGKCYGPQCLCR343TCTPCFTTDHQTARKCDDCCGGKGRGACYGPQCLCR344TCTPCFTTDHQTARACDDCCGGKGRGACYGPQCLCR345TCTPCFTTDHQTARRCDDCCGGKGRGACYGPQCLCR346TCTPCFTTDHQTARKCDDCCGGAGRGACYGPQCLCR347TCTPCFTTDHQTARACDDCCGGAGRGACYGPQCLCR348TCTPCFTTDHQTARRCDDCCGGAGRGACYGPQCLCR349TCTPCFTTDHQTARKCDDCCGGRGRGACYGPQCLCR350TCTPCFTTDHQTARACDDCCGGRGRGACYGPQCLCR351TCTPCFTTDHQTARRCDDCCGGRGRGACYGPQCLCR352TCTPCFTTDHQTARKCDDCCGGKGRGRCYGPQCLCR353TCTPCFTTDHQTARACDDCCGGKGRGRCYGPQCLCR354TCTPCFTTDHQTARRCDDCCGGKGRGRCYGPQCLCR355TCTPCFTTDHQTARKCDDCCGGAGRGRCYGPQCLCR356TCTPCFTTDHQTARACDDCCGGAGRGRCYGPQCLCR357TCTPCFTTDHQTARRCDDCCGGAGRGRCYGPQCLCR358TCTPCFTTDHQTARKCDDCCGGRGRGRCYGPQCLCR359TCTPCFTTDHQTARACDDCCGGRGRGRCYGPQCLCR360TCTPCFTTDHQTARRCDDCCGGRGRGRCYGPQCLCR361TCTPCFTTDHQTARRCDDCCGGRGRGRCYGPQCLCR362KCTPCFTTDHQTARRCDDCCGGRGRGRCYGPQCLCR363ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR364KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR365TCTPCFTTDHQTAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR366TCTPCFTTDHQTAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR367KCTPCFTTDHQTAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR368ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR369ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR370KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR371VCVPCFTTDHQVARKCDDCCGGKGRGKCYGPQCLCR372VCVPCFTTDHQVARACDDCCGGKGRGKCYGPQCLCR373VCVPCFTTDHQVARRCDDCCGGKGRGKCYGPQCLCR374VCVPCFTTDHQVARKCDDCCGGAGRGKCYGPQCLCR375VCVPCFTTDHQVARACDDCCGGAGRGKCYGPQCLCR376VCVPCFTTDHQVARRCDDCCGGAGRGKCYGPQCLCR377VCVPCFTTDHQVARKCDDCCGGRGRGKCYGPQCLCR378VCVPCFTTDHQVARACDDCCGGRGRGKCYGPQCLCR379VCVPCFTTDHQVARRCDDCCGGRGRGKCYGPQCLCR380VCVPCFTTDHQVARKCDDCCGGKGRGACYGPQCLCR381VCVPCFTTDHQVARACDDCCGGKGRGACYGPQCLCR382VCVPCFTTDHQVARRCDDCCGGKGRGACYGPQCLCR383VCVPCFTTDHQVARKCDDCCGGAGRGACYGPQCLCR384VCVPCFTTDHQVARACDDCCGGAGRGACYGPQCLCR385VCVPCFTTDHQVARRCDDCCGGAGRGACYGPQCLCR386VCVPCFTTDHQVARKCDDCCGGRGRGACYGPQCLCR387VCVPCFTTDHQVARACDDCCGGRGRGACYGPQCLCR388VCVPCFTTDHQVARRCDDCCGGRGRGACYGPQCLCR389VCVPCFTTDHQVARKCDDCCGGKGRGRCYGPQCLCR390VCVPCFTTDHQVARACDDCCGGKGRGRCYGPQCLCR391VCVPCFTTDHQVARRCDDCCGGKGRGRCYGPQCLCR392VCVPCFTTDHQVARKCDDCCGGAGRGRCYGPQCLCR393VCVPCFTTDHQVARACDDCCGGAGRGRCYGPQCLCR394VCVPCFTTDHQVARRCDDCCGGAGRGRCYGPQCLCR395VCVPCFTTDHQVARKCDDCCGGRGRGRCYGPQCLCR396VCVPCFTTDHQVARACDDCCGGRGRGRCYGPQCLCR397VCVPCFTTDHQVARRCDDCCGGRGRGRCYGPQCLCR398VCVPCFTTDHQVARRCDDCCGGRGRGRCYGPQCLCR399KCVPCFTTDHQVARRCDDCCGGRGRGRCYGPQCLCR400ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR401KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR402VCVPCFTTDHQVAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR403VCVPCFTTDHQVAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR404KCVPCFTTDHQVAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR405ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR406ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR407KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR408LCLPCFTTDHQLARKCDDCCGGKGRGKCYGPQCLCR409LCLPCFTTDHQLARACDDCCGGKGRGKCYGPQCLCR410LCLPCFTTDHQLARRCDDCCGGKGRGKCYGPQCLCR411LCLPCFTTDHQLARKCDDCCGGAGRGKCYGPQCLCR412LCLPCFTTDHQLARACDDCCGGAGRGKCYGPQCLCR413LCLPCFTTDHQLARRCDDCCGGAGRGKCYGPQCLCR414LCLPCFTTDHQLARKCDDCCGGRGRGKCYGPQCLCR415LCLPCFTTDHQLARACDDCCGGRGRGKCYGPQCLCR416LCLPCFTTDHQLARRCDDCCGGRGRGKCYGPQCLCR417LCLPCFTTDHQLARKCDDCCGGKGRGACYGPQCLCR418LCLPCFTTDHQLARACDDCCGGKGRGACYGPQCLCR419LCLPCFTTDHQLARRCDDCCGGKGRGACYGPQCLCR420LCLPCFTTDHQLARKCDDCCGGAGRGACYGPQCLCR421LCLPCFTTDHQLARACDDCCGGAGRGACYGPQCLCR422LCLPCFTTDHQLARRCDDCCGGAGRGACYGPQCLCR423LCLPCFTTDHQLARKCDDCCGGRGRGACYGPQCLCR424LCLPCFTTDHQLARACDDCCGGRGRGACYGPQCLCR425LCLPCFTTDHQLARRCDDCCGGRGRGACYGPQCLCR426LCLPCFTTDHQLARKCDDCCGGKGRGRCYGPQCLCR427LCLPCFTTDHQLARACDDCCGGKGRGRCYGPQCLCR428LCLPCFTTDHQLARRCDDCCGGKGRGRCYGPQCLCR429LCLPCFTTDHQLARKCDDCCGGAGRGRCYGPQCLCR430LCLPCFTTDHQLARACDDCCGGAGRGRCYGPQCLCR431LCLPCFTTDHQLARRCDDCCGGAGRGRCYGPQCLCR432LCLPCFTTDHQLARKCDDCCGGRGRGRCYGPQCLCR433LCLPCFTTDHQLARACDDCCGGRGRGRCYGPQCLCR434LCLPCFTTDHQLARRCDDCCGGRGRGRCYGPQCLCR435LCLPCFTTDHQLARRCDDCCGGRGRGRCYGPQCLCR436KCLPCFTTDHQLARRCDDCCGGRGRGRCYGPQCLCR437ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR438KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR439LCLPCFTTDHQLAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR440LCLPCFTTDHQLAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR441KCLPCFTTDHQLAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR442ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR443ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR444KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR445SCSPCFTTDHQSARKCDDCCGGKGRGKCYGPQCLCR446SCSPCFTTDHQSARACDDCCGGKGRGKCYGPQCLCR447SCSPCFTTDHQSARRCDDCCGGKGRGKCYGPQCLCR448SCSPCFTTDHQSARKCDDCCGGAGRGKCYGPQCLCR449SCSPCFTTDHQSARACDDCCGGAGRGKCYGPQCLCR450SCSPCFTTDHQSARRCDDCCGGAGRGKCYGPQCLCR451SCSPCFTTDHQSARKCDDCCGGRGRGKCYGPQCLCR452SCSPCFTTDHQSARACDDCCGGRGRGKCYGPQCLCR453SCSPCFTTDHQSARRCDDCCGGRGRGKCYGPQCLCR454SCSPCFTTDHQSARKCDDCCGGKGRGACYGPQCLCR455SCSPCFTTDHQSARACDDCCGGKGRGACYGPQCLCR456SCSPCFTTDHQSARRCDDCCGGKGRGACYGPQCLCR457SCSPCFTTDHQSARKCDDCCGGAGRGACYGPQCLCR458SCSPCFTTDHQSARACDDCCGGAGRGACYGPQCLCR459SCSPCFTTDHQSARRCDDCCGGAGRGACYGPQCLCR460SCSPCFTTDHQSARKCDDCCGGRGRGACYGPQCLCR461SCSPCFTTDHQSARACDDCCGGRGRGACYGPQCLCR462SCSPCFTTDHQSARRCDDCCGGRGRGACYGPQCLCR463SCSPCFTTDHQSARKCDDCCGGKGRGRCYGPQCLCR464SCSPCFTTDHQSARACDDCCGGKGRGRCYGPQCLCR465SCSPCFTTDHQSARRCDDCCGGKGRGRCYGPQCLCR466SCSPCFTTDHQSARKCDDCCGGAGRGRCYGPQCLCR467SCSPCFTTDHQSARACDDCCGGAGRGRCYGPQCLCR468SCSPCFTTDHQSARRCDDCCGGAGRGRCYGPQCLCR469SCSPCFTTDHQSARKCDDCCGGRGRGRCYGPQCLCR470SCSPCFTTDHQSARACDDCCGGRGRGRCYGPQCLCR471SCSPCFTTDHQSARRCDDCCGGRGRGRCYGPQCLCR472SCSPCFTTDHQSARRCDDCCGGRGRGRCYGPQCLCR473KCSPCFTTDHQSARRCDDCCGGRGRGRCYGPQCLCR474ACAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR475KCAPCFTTDHQAARRCDDCCGGRGRGRCYGPQCLCR476SCSPCFTTDHQSAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR477SCSPCFTTDHQSAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR478KCSPCFTTDHQSAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR479ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRGKCYGPQCLCR480ACAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR481KCAPCFTTDHQAAR(Cit)CDDCCGG(Cit)GRG(Cit)CYGPQCLCR
[0082] Chlorotoxin conjugates comprise a chlorotoxin and a labeling agent or detectable label. In an embodiment, chlorotoxin is a variant comprising at least
[0083] 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of the natural peptide of chlorotoxin. In another embodiment, the present disclosure provides a chlorotoxin having the following amino acid sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR. In a further embodiment, the present disclosure provides chlorotoxin variants comprising at least
[0084] 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the following amino acid sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR. In another embodiment, the chlorotoxin is a chlorotoxin or variant thereof comprising at least 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the sequence of MCMPCFTTDHQMARXCDDCCGGXGRGXCYGPQCLCR, wherein X is selected from K, A and R. In another embodiment, the chlorotoxin is a chlorotoxin or variant of thereof comprising at least 90% sequence identity to the sequence of MCMPCFTTDHQMARXCDDCCGGXGRGXCYGPQCLCR, wherein X is selected from K, A and R.
[0085] In another embodiment, the compound is BLZ-100 (also referred to herein as Compound 16), which is a chlorotoxin variant comprising the sequence of MCMPCFTTDHQMARXCDDCCGGXGRGXCYGPQCLCR, wherein X15 and X23 are arginine and X27 is lysine conjugated to a cyanine fluorescent label. The peptide can be further cross-linked by four disulfide bonds formed among the cysteine residues present in the sequence.
[0086] In some aspects, the peptide is a variant of the natural peptide of chlorotoxin but retains all eight cysteine residues of the natural peptide, enabling cross-linking by up to four disulfide bonds. Conservation of cysteine residues helps to preserve the secondary structure, charge distribution, isolelectric point (pI) and other features of the natural chlorotoxin peptide because of the disulfide bonds that form between the cysteine residues.
[0087] In some aspects, the chlorotoxin peptide variant retains all eight cysteine residues of the natural peptide and has at least 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with the native chlorotoxin peptide.
[0088] In some aspects, the chlorotoxin peptide variant has eight cysteine residues positioned so that the distances between pairs of cysteines is the same as the distances between pairs of cysteines found in the natural peptide, and the chlorotoxin peptide variant has at least 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with the native chlorotoxin peptide.
[0089] In some aspects, the chlorotoxin peptide variant has eight cysteine residues positioned so that the distances between pairs of cysteines is functionally equivalent or functionally similar to the distances between pairs of cysteines found in the natural peptide, and the chlorotoxin peptide variant has at least 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with the native chlorotoxin peptide.
[0090] In some aspects, the chlorotoxin peptide variant has eight cysteine residues positioned so that the distances between pairs of cysteines allows for secondary structure and isolectric point of the native chlorotoxin peptide to be preserved, and the chlorotoxin peptide variant has at least 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with the native chlorotoxin peptide.
[0091] In some aspects, the chlorotoxin peptide variant has eight cysteine residues positioned so that the distances between pairs of cysteines is sufficient to allow disulfide bonds to form, and the chlorotoxin peptide variant has at least 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with the native chlorotoxin peptide.
[0092] In some aspects, one or more methionines of the chlorotoxin peptide variant are replaced with other amino acids. In some aspects, one or more methionines of the chlorotoxin peptide variant are replaced with other amino acids selected from glycine, alanine, Isoleucine, Threonine, Valine, Leucine, Serine or a combination thereof.
[0093] In some embodiments, the chlorotoxin can be a chlorotoxin variant. Chlorotoxin and chlorotoxin variants have are further described in PCT Patent Application Publication Numbers WO2006115633 and WO201 1 142858.
[0094] In one embodiment, the peptide can have the following formula: H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Xaa-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Xaa-Gly-Arg-Gly-Xaa-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-OH acetate salt (disulfide bonds, air oxidized), wherein Xaa is Arg, Ala, or Lys.
[0095] In another embodiment, the all peptide can have the following formula: H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Xaa-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Xaa-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-OH acetate salt (disulfide bonds, air oxidized), wherein Xaa is Arg, or Ala.
[0096] In another embodiment, the peptide can have the following formula: H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Arg-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Arg-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-OH acetate salt (disulfide bonds, air oxidized).
[0097] In another embodiment, the peptide can have the following formula: H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Arg-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Ala-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-OH acetate salt (disulfide bonds, air oxidized).
[0098] In another embodiment, the peptide can have the following formula: H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Ala-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Arg-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-OH acetate salt (disulfide bonds, air oxidized).
[0099] In another embodiment, the peptide can have the following formula: H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Ala-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Ala-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-OH acetate salt (disulfide bonds, air oxidized).
[0100] In certain embodiments, the chlorotoxin and chlorotoxin variants can be conjugated to moieties, such as detectable labels (e.g., dyes) that can be detected (e.g., visualized) in a subject. In some embodiments, the chlorotoxin and / or chlorotoxin variants can be conjugated to detectable labels to enable tracking of the bio-distribution of a conjugated peptide. The detectable labels can include fluorescent dyes. Non-limiting examples of fluorescent dyes that could be used as a conjugating molecule in the present disclosure include rhodamine, rhodol, fluorescein, thiofluorescein, amino fluorescein, carboxyfluorescein, chlorofluorescein, methylfluorescein, sulfofluorescein, aminorhodol, carboxyrhodol, chlororhodol, methylrhodol, sulforhodol; aminorhodamine, carboxyrhodamine, chlororhodamine, methylrhodamine, sulforhodamine, and thiorhodamine, cyanine, indocarbocyanine, oxacarbocyanine, thiacarbocyanine, merocyanine, a cyanine dye (e.g., cyanine 2, cyanine 3, cyanine 3.5, cyanine 5, cyanine 5.5, cyanine 7), oxadiazole derivatives, pyridyloxazole, nitrobenzoxadiazole, benzoxadiazole, pyrene derivatives, cascade blue, oxazine derivatives, Nile red, Nile blue, cresyl violet, oxazine 170, acridine derivatives, proflavin, acridine orange, acridine yellow, arylmethine derivatives, auramine, xanthene dyes, sulfonated xanthenes dyes, Alexa Fluors (e.g., Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 647, Alexa Fluor 700), crystal violet, malachite green, tetrapyrrole derivatives, porphyrin, phtalocyanine, and bilirubin. Some other example dyes include near-infrared dyes, such as, but not limited to, Cy5.5, indocyanine green (ICG), DyLight 750 or IRdye 800. In some embodiments, near infrared dyes can include cyanine dyes.
[0101] Chemotherapueutics, anti-cancer drugs, and anti-cancer agents, include, but are not limited to: radioisotopes, toxins, enzymes, sensitizing drugs, nucleic acids, including interfering RNAs, antibodies, anti-angiogenic agents, cisplatin, anti-metabolites, mitotic inhibitors, growth factor inhibitors, paclitaxel, temozolomide, topotecan, fluorouracil, vincristine, vinblastine, procarbazine, decarbazine, altretamine, methotrexate, mercaptopurine, thioguanine, fludarabine phosphate, cladribine, pentostatin, cytarabine, azacitidine, etoposide, teniposide, irinotecan, docetaxel, doxorubicin, daunorubicin, dactinomycin, idarubicin, plicamycin, mitomycin, bleomycin, tamoxifen, flutamide, leuprolide, goserelin, aminogluthimide, anastrozole, amsacrine, asparaginase, mitoxantrone, mitotane and amifostine, and their equivalents, as well as photo-ablation.
[0102] As used herein, the terms "about" and "approximately," in reference to a number, is used herein to include numbers that fall within a range of 10%, 5%, or 1% in either direction (greater than or less than) the number unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
[0103] Suitable diagnostic agents include agents that provide for the detection by fluorescence methods as well as methods other than fluorescence imaging. Other suitable diagnostic agents include radiolabels (e.g., radio isotopically labeled compounds) such as 125< I, 14< C, and 31< P, among others; and magnetic resonance imaging agents.
[0104] Suitable targeting agents include antibodies, polypeptides, polysaccharides, and nucleic acids.
[0105] In another aspect of the invention, compositions that include the modified chlorotoxin peptide conjugates are provided. The composition can include a pharmaceutically acceptable carrier or diluent for delivery of the modified chlorotoxin peptide conjugate. Suitable pharmaceutically acceptable carriers or diluents include saline or dextrose for injection.
[0106] In various aspects, the presently described compounds further comprise a detectable label, which can be used for the detection of the peptide-label conjugate and the cancerous cells to which they are bound.
[0107] In various aspects, the presently described compounds further comprise a detectable label, which can be used for the detection of the peptide-label conjugate and the cancerous cells to which they are bound.
[0108] The present compounds have a structure of Formula (III), or a pharmaceutically acceptable salt thereof: wherein: R 1< , R 2< , R 3< , R 4< , R 5< , R 6< , R 7< , R 8< , R 15< , and R 16< are each independently selected from hydrogen, C 1 -C 6 alkyl, C 1 -C 6 alkylene-COOH, sulfonate, -COOH, -SO 2 -NH 2 , or C 1 -C 6 alkoxy; R 9< is sulfonate; L 1< is C 3 -C 6 alkylene; L 2< is C 1 -C 10 alkylene; L 3< is a bond, -O-, -NR 10< -, -NR 10< -C 1 -C 6 alkylene-, -O-NR 10< -, -NR 10< -C 1 -C 6 alkylene- (O-C 1 -C 6 alkylene) n -, -NR 10< -L 4< -, -NR 10< -C 1 -C 6 alkylene-NR 11< -(C (= O)-C 1 -C 6 alkylene-O-) m -, or -NR 10< -C 1 -C 6 alkylene-NR 10< -C 1 -C 6 alkylene-NR 10< -C 1 -C 6 alkylene-; L 4< is a bond, -heterocyclyl-, or -heterocyclyl-C 1 -C 6 alkylene-; R 10< is hydrogen or C 1 -C 6 alkyl; R 11< is hydrogen or C 1 -C 6 alkyl; R 12< and R 13< are independently selected from hydrogen, C 1 -C 6 alkyl, or R 12< and R 13< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring; R 14< is hydrogen or C 1 -C 6 alkylene, -(L 5< )-aryl, -(L 5< )-heteroaryl, -NR 17< R 18< , R 14< and R 19< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring, or R 14< and R 20< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring; L 5< is a bond, C 1 -C 10 alkylene, -O-, or -NR 10< -; R 17< and R 18< are each independently hydrogen or aryl; R 19< and R 20< are independently selected from hydrogen, C 1 -C 6 alkyl, R 14< and R 19< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring, or R 14< and R 20< are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring; n is 0, 1, 2, or 3; m is 0, 1, 2, or 3; p is 0, 1, 2, or 3; q is 0, 1, 2, or 3; and A 4< is a polypeptide having at least 90% sequence identity with MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR or a fragment thereof , wherein the fragment of A 4< comprises at least 25 amino acid residues.
[0109] In certain aspects, R 3< , R 4< , R 5< , and R 6< are each independently C 1 -C 6 alkyl. In some aspects, R 3< , R 4< , R 5< , and R 6< are each independently methyl. In certain aspects, R 1< , R 2< , R 7< , R 8< , R 15< , and R 16< are each independently selected from hydrogen or sulfonate. In further aspects, R 1< , R 2< , R 7< , R 8< , R 15< , and R 16< are each independently hydrogen. In some aspects, R 12< , R 13< , R 14< , R 19< , R 20< are each independently hydrogen.
[0110] In certain aspects, R 12< and R 13< join together along with the atoms to which they are attached to form a six-membered carbocyclic ring. In other aspects, R 12< and R 13< join together along with the atoms to which they are attached to form a five-membered carbocyclic ring. In certain aspects, R 14< and R 19< join together along with the atoms to which they are attached to form a six-membered carbocyclic ring. In some aspects, R 14< and R 20< join together along with the atoms to which they are attached to form a six-membered carbocyclic ring. In certain aspects, L 1< is C 3 -C 6 alkylene. In other aspects, L 1< is C 3 -C 5 alkylene. In still other aspects, L 1< is propylene. In still other aspects, L 1< is butylene. In other aspects, L 1< is pentylene. In some aspects, L 2< is C 3 -C 6 alkylene. In other aspects, L 2< is propylene. In still other aspects, L 2< is butylene. In other aspects, L 2< is pentylene. R 9< is sulfonate. In some aspects, R 14< is hydrogen. In other aspects, R 14< is -(L 5< )-aryl.
[0111] In some aspects, R 1< is hydrogen. In certain aspects, R 2< is hydrogen. In some aspects, R 3< is methyl. In certain aspects, R 4< is methyl. In some aspects, R 5< is methyl. In certain aspects R 6< is methyl. In some aspects, R 7< is hydrogen. In certain aspects, R 8< is hydrogen. In some aspects, R 12< is hydrogen. In certain aspects, R 13< is hydrogen. In some aspects, R 14< is hydrogen. In certain aspects, R 19< is hydrogen. In some aspects, R 20< is hydrogen. In certain aspects, R 10< is hydrogen. In some aspects, R 11< is hydrogen.
[0112] In some aspects, R 17< and R 18< are independently phenyl. In some aspects, L 3< is selected from a bond, -O-, -NR 10< -, -NR 10< -C 1 -C 6 alkylene-, -O-NR 10< -, or -NR 10< -L 4< -. In further aspects, L 3< is a bond.
[0113] In some aspects, L 4< is -heterocyclyl- or -heterocyclyl-C 1 -C 6 alkylene-. In further aspects, L 4< is -piperizinyl-(C 1 -C 6 alkylene)-. In still further aspects, L 4< is
[0114] In some aspects, p is 1. In certain aspects, q is 1.
[0115] In some aspects, the compound has the structure of any one of Formulas (VII), (VIII), (IX), (XI), (XII), or (XIV): or
[0116] In still further aspects, A 4< is a polypeptide having at least 92% sequence identity with MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR or a fragment thereof. In still further aspects, A 4< is a polypeptide having at least 95% sequence identity with MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR or a fragment thereof. In still further aspects, A 4< is a polypeptide having at least 97% sequence identity with MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR or a fragment thereof. In still further aspects, A 4< is a polypeptide having 100% sequence identity with MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR or a fragment thereof. In still further aspects, A 4< is a polypeptide having the sequence MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR or a fragment thereof.
[0117] The fragment of A 4< has a length of at least 25 amino acid residues. In further aspects, the fragment of A 4< has a length of at least 27 amino acid residues. In still further aspects, the fragment of A 4< has a length of at least 29 amino acid residues. In still further aspects, the fragment of A 4< has a length of at least 31 amino acid residues. In still further aspects, the fragment of A 4< has a length of at least 33 amino acid residues.
[0118] The fragment thereof may have the tumor cell binding affinity of native chlorotoxin. The fragment thereof may have the tumor cell binding affinity of native chlorotoxin wherein one of A 1< , A 2< , A 3< , A 4< , or A 5< has a sequence selected from SEQ ID NOS: 1-481.
[0119] In some aspects, the polypeptide comprises at least one lysine amino acid residue. In certain aspects, the polypeptide comprises a single lysine amino acid residue. In some aspects, the polypeptide comprises one, two, or three lysine amino acid residues. In some aspects, the polypeptide comprises a lysine residue at the position corresponding to K-27 of native chlorotoxin. In some aspects, the polypeptide comprises a lysine residue at the position corresponding to K-23 of native chlorotoxin. In some aspects, the polypeptide comprises a lysine residue at the position corresponding to K-15 of native chlorotoxin.
[0120] In some aspects, one or more of the amino acids of the polypeptide is substituted with a non-naturally occurring amino acid residue. In further aspects the non-naturally occurring amino acid residue is a citrulline amino acid residue. In still further aspects, L 3< is attached to A 4< at a citrulline amino acid residue of the polypeptide.
[0121] In some aspects, L 3< is attached to A 4< at a lysine amino acid residue of the polypeptide. In certain aspects, L 3< is attached to A 4< at the N-terminus of the polypeptide. In some aspects, L 3< is attached to A 4< at the C-terminus of the polypeptide. In some aspects, the R 3< is attached to A 1< at a lysine amino acid residue of the peptide, a citrulline amino acid residue of the polypeptide, the N-terminus of the polypeptide, or the C-terminus of the polypeptide. In some aspects, the R 5< is attached to A 2< at a lysine amino acid residue of the polypeptide, a citrulline amino acid residue of the polypeptide, the N-terminus of the polypeptide, or the C-terminus of the polypeptide. In some aspects, the R 9< is attached to A 3< at a lysine amino acid residue of the polypeptide, a citrulline amino acid residue of the polypeptide, the N-terminus of the polypeptide, or the C-terminus of the polypeptide. In some aspects, the aryl is attached to A 5< at a lysine amino acid residue of the polypeptide, a citrulline amino acid residue of the polypeptide, the N-terminus of the polypeptide, or the C-terminus of the polypeptide.
[0122] In some aspects, the compound has the structure of any one of the compounds found in Tables 2-13 that are encompassed by claim 1.
[0123] In some aspects, the compound is conjugated to polyethylene glycol (PEG), hydroxyethyl starch, polyvinyl alcohol, a water soluble polymer, a zwitterionic water soluble polymer, a water soluble poly(amino acid), an albumin derivative, or a fatty acid.
[0124] In some aspects, the polypeptide has an isoelectric point of from 7.5 to 9.0. In some aspects, the polypeptide has an isoelectric point of from 8.0 to 9.0. In some aspects, the polypeptide has an isoelectric point of from 8.5 to 9.0. In some aspects, the polypeptide is basic and has an isoelectric point of greater than 7.5.
[0125] In some aspects, the polypeptide comprises at least eight cysteine amino acid residues. In some aspects, the polypeptide comprises eight cysteine amino acid residues. In some aspects, the polypeptide comprises four disulfide bonds. In some aspects, the polypeptide comprises from six to seven cysteine amino acid residues. In some aspects, the polypeptide comprises three disulfide bonds. In some aspects, the spacing between the cysteine amino acid residues in the polypeptide is essentially the same as in native chlorotoxin. In some aspects, the distribution of charge on the surface of the polypeptide is essentially the same as in native chlorotoxin.
[0126] In some aspects, one or more of the methionine amino acid residues is replaced with an amino acid residue selected from isoleucine, threonine, valine, leucine, serine, glycine, alanine, or a combination thereof.
[0127] In some aspects, the compound is capable of passing across the blood brain barrier. In some aspects, the compound further comprises a therapeutic agent attached to A. In further aspects, the therapeutic agent is a cytotoxic agent.
[0128] The compounds of the invention are as defined in claim 1. Certain compounds are provided below in Tables 2 to 13, including both the peptide portion (indicated by A) and the detectable label portion. Table 2. Compounds.A = MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR (SEQ ID NO: 9) (attached at K-27)No. Structure No. Strucure 1 31 2 32 3 33 4 34 5 35 6 36 7 37 8 38 9 39 10 40 11 41 12 42 13 43 14 44 15 45 16 46 17 47 18 48 19 49 20 50 21 51 22 52 23 53 24 54 25 55 26 56 27 57 28 58 29 59 30 60 Table 3. Compounds. A = MCMPCFTTDHQMARACDDCCGGAGRGKCYGPQCLCR (SEQ ID NO: 5) (attached at K-27)No. Structure No. Strucure 61 91 62 92 63 93 64 94 65 95 66 96 67 97 68 98 69 99 70 100 71 101 72 102 73 103 74 104 75 105 76 106 77 107 78 108 79 109 80 110 81 111 82 112 83 113 84 114 85 115 86 116 87 117 88 118 89 119 90 120 Table 4. Compounds. A = MCMPCFTTDHQMARRCDDCCGGAGRGK CYGPQCLCR (SEQ ID NO: 6) (attached at K-27)No. Structure No. Strucure 121 151 122 152 123 153 124 154 125 155 126 156 127 157 128 158 129 159 130 160 131 161 132 162 133 163 134 164 135 165 136 166 137 167 138 168 139 169 140 170 141 171 142 172 143 173 144 174 145 175 146 176 147 177 148 178 149 179 150 180 Table 5. Compounds. A = MCMPCFTTDHQMARACDDCCGGRGRGK CYGPQCLCR (SEQ ID NO: 8) (attached at K-27)No. Structure No. Strucure 181 211 182 212 183 213 184 214 185 215 186 216 187 217 188 218 189 219 190 220 191 221 192 222 193 223 194 224 195 225 196 226 197 227 198 228 199 229 200 230 201 231 202 232 203 233 204 234 205 235 206 236 207 237 208 238 209 239 210 240 Table 6. Compounds. A = MCMPCFTTDHQMARACDDCCGGK GRGACYGPQCLCR (SEQ ID NO: 11) (attached at K-23)No. Structure No. Strucure 241 271 242 272 243 273 244 274 245 275 246 276 247 277 248 278 249 279 250 280 251 281 252 282 253 283 254 284 255 285 256 286 257 287 258 288 259 289 260 290 261 291 262 292 263 293 264 294 265 295 266 296 267 297 268 298 269 299 270 300 Table 7. Compounds. A = MCMPCFTTDHQMARRCDDCCGGK GRGACYGPQCLCR (SEQ ID NO: 12) (attached at K-23)No. Structure No. Strucure 301 331 302 332 303 333 304 334 305 335 306 336 307 337 308 338 309 339 310 340 311 341 312 342 313 343 314 344 315 345 316 346 317 347 318 348 319 349 320 350 321 351 322 352 323 353 324 354 325 355 326 356 327 357 328 358 329 359 330 360 , Table 8. Compounds. A = MCMPCFTTDHQMARK CDDCCGGAGRGACYGPQCLCR (SEQ ID NO: 13) (attached at K-15)No. Structure No. Strucure 361 391 362 392 363 393 364 394 365 395 366 396 367 397 368 398 369 399 370 400 371 401 372 402 373 403 374 404 375 405 376 406 377 407 378 408 379 409 380 410 381 711 382 712 383 713 384 714 385 715 386 716 387 717 388 718 389 719 390 720 Table 9. Compounds. A = MCMPCFTTDHQMARK CDDCCGGRGRGACYGPQCLCR (SEQ ID NO: 16) (attached at K-15)No. Structure No. Strucure 411 441 412 442 413 443 414 444 415 445 416 446 417 447 418 448 419 449 420 450 421 451 422 452 423 453 424 454 425 455 426 456 427 457 428 458 429 459 430 460 431 461 432 462 433 463 434 464 435 465 436 466 437 467 438 468 439 469 440 470 Table 10. Compounds. A = MCNPCFTTDHQMARACDDCCGGK GRGRCYGPQCLCR (SEQ ID NO: 20) (attached at K-23)No. Structure No. Strucure 471 501 472 502 473 503 474 504 475 505 476 506 477 507 478 508 479 509 480 510 481 511 482 512 483 513 484 514 485 515 486 516 487 517 488 518 489 519 490 520 491 521 492 522 493 523 494 524 495 525 496 526 497 527 498 528 499 529 A = MCMPCFTTDHQMARACDDCCGGK GRGRCYGPQCLCR (SEQ ID NO: 20) (attached at K-23)No. Structure No. Strucure 500 530 Table 11. Compounds. A = MCMPCFTTDHQMARRCDDCCGGK GRGRCYGPQCL (SEQ ID NO: 21) (attached at K-23)No. Structure No. Strucure 531 561 532 562 533 563 534 564 535 565 536 566 537 567 538 568 539 569 540 570 541 571 542 572 543 573 544 574 545 575 546 576 547 577 548 578 549 579 550 580 551 581 552 582 553 583 554 584 555 585 556 586 557 587 558 588 559 589 560 590 Table 12. Compounds. A = MCMPCFTTDHQMARK CDDCCGGAGRGRCYGPQCLC (SEQ ID NO: 22) (attached at K-15)No. Structure No. Strucure 591 621 592 622 593 623 594 624 595 625 596 626 597 627 598 628 599 629 600 630 601 631 602 632 603 633 604 634 605 635 606 636 607 637 608 638 609 639 610 640 611 641 612 642 613 643 614 644 615 645 616 646 617 647 618 648 619 649 620 650 Table 13. Compounds. A = MCMPCFTTDHQMARK CDDCCGGRGRGRCYGPQCLCR (SEQ ID NO: 25) (attached at K-15)No. Structure No. Strucure 651 681 652 682 653 683 654 684 655 685 656 686 657 687 658 688 659 689 660 690 661 691 662 692 663 693 664 694 665 695 666 696 667 697 668 698 669 699 670 700 671 701 672 702 673 703 674 704 675 705 676 706 677 707 678 708 679 709 680 710
[0129] In certain aspects, the presently described peptides are conjugated to moieties, such as detectable labels (e.g., dyes or radiolabels) that are detected (e.g., visualized) in a subject. In some aspects, the chlorotoxin and / or chlorotoxin variants is conjugated to detectable labels to enable tracking of the bio-distribution of a conjugated peptide. The fluorescent moiety is covalently coupled to the chlorotoxin to allow for the visualization of the conjugate by fluorescence imaging, either directly or through a linker as described herein and known to one of ordinary skill in the art.
[0130] In some aspects, the fluorescent label has emission characteristics that are desired for a particular application. For example, the fluorescent label is a fluorescent dye that has a emission wavelength maximum between a range of 500 nm to 1100 nm, between a range of 600 nm to 1000 nm, between a range of 600 to 800 nm, between a range of 650 nm to 850 nm, or between a range of 700 nm to 800 nm. For another example, the fluorescent label is a fluorescent dye that has a emission wavelength maximum between a range of about 500 nm to about 1100 nm, between a range of about 600 nm to about 1000 nm, between a range of about 600 to about 800 nm, between a range of about 650 nm to about 850 nm, or between a range of about 700 nm to about 800 nm. One of ordinary skill in the art will appreciate the various dyes that are used as detectable labels and that have the emission characteristics above.
[0131] Some other examplary dyes include near-infrared dyes, such as, but not limited to, DyLight-680, DyLight-750, VivoTag-750, DyLight-800, IRDye-800, VivoTag-680, Cy5.5, or indocyanine green (ICG). In some aspects, near infrared dyes often include cyanine dyes. Additional non-limiting examples of fluorescent dyes for use as a conjugating molecule in the present disclosure include acradine orange or yellow, Alexa Fluors and any derivative thereof, 7-actinomycin D, 8-anilinonaphthalene-1-sulfonic acid, ATTO dye and any derivative thereof, auramine-rhodamine stain and any derivative thereof, bensantrhone, bimane, 9-10-bis(phenylethynyl)anthracene, 5,12 - bis(phenylethynyl)naththacene, bisbenzimide, brainbow, calcein, carbodyfluorescein and any derivative thereof, 1-chloro-9,10-bis(phenylethynyl)anthracene and any derivative thereof, DAPI, DiOC6, DyLight Fluors and any derivative thereof, epicocconone, ethidium bromide, FlAsH-EDT2, Fluo dye and any derivative thereof, FluoProbe and any derivative thereof, Fluorescein and any derivative thereof, Fura and any derivative thereof, GelGreen and any derivative thereof, GelRed and any derivative thereof, fluorescent proteins and any derivative thereof, m isoform proteins and any derivative thereof such as for example mCherry, hetamethine dye and any derivative thereof, hoeschst stain, iminocoumarin, indian yellow, indo-1 and any derivative thereof, laurdan, lucifer yellow and any derivative thereof, luciferin and any derivative thereof, luciferase and any derivative thereof, mercocyanine and any derivative thereof, nile dyes and any derivative thereof, perylene, phloxine, phyco dye and any derivative thereof, propium iodide, pyranine, rhodamine and any derivative thereof, ribogreen, RoGFP, rubrene, stilbene and any derivative thereof, sulforhodamine and any derivative thereof, SYBR and any derivative thereof, synapto-pHluorin, tetraphenyl butadiene, tetrasodium tris, Texas Red, Titan Yellow, TSQ, umbelliferone, violanthrone, yellow fluroescent protein and YOYO-1. Other Suitable fluorescent dyes include, but are not limited to, fluorescein and fluorescein dyes (e.g., fluorescein isothiocyanine or FITC, naphthofluorescein, 4',5'-dichloro-2',7' -dimethoxyfluorescein, 6-carboxyfluorescein or FAM, etc.), carbocyanine, merocyanine, styryl dyes, oxonol dyes, phycoerythrin, erythrosin, eosin, rhodamine dyes (e.g., carboxytetramethyl-rhodamine or TAMRA, carboxyrhodamine 6G, carboxy-X-rhodamine (ROX), lissamine rhodamine B, rhodamine 6G, rhodamine Green, rhodamine Red, tetramethylrhodamine (TMR), etc.), coumarin and coumarin dyes (e.g., methoxycoumarin, dialkylaminocoumarin, hydroxycoumarin, aminomethylcoumarin (AMCA), etc.), Oregon Green Dyes (e.g., Oregon Green 488, Oregon Green 500, Oregon Green 514., etc.), Texas Red, Texas Red-X, SPECTRUM RED, SPECTRUM GREEN, cyanine dyes (e.g., CY-3, Cy-5, CY-3.5, CY-5.5, etc.), ALEXA FLUOR dyes (e.g., ALEXA FLUOR 350, ALEXA FLUOR 488, ALEXA FLUOR 532, ALEXA FLUOR 546, ALEXA FLUOR 568, ALEXA FLUOR 594, ALEXA FLUOR 633, ALEXA FLUOR 660, ALEXA FLUOR 680, etc.), BODIPY dyes (e.g., BODIPY FL, BODIPY R6G, BODIPY TMR, BODIPY TR, BODIPY 530 / 550, BODIPY 558 / 568, BODIPY 564 / 570, BODIPY 576 / 589, BODIPY 581 / 591, BODIPY 630 / 650, BODIPY 650 / 665, etc.), IRDyes (e.g., IRD40, IRD 700, IRD 800, etc.), and the like. In some aspects, conjugates of the present disclosure comprise other dyes, including but not limited to those provided below in Table 14. Table 14. Exemplary fluorescent reporter molecules with peak absorbance (Abs.) and emission (Em.) wavelengths specifiec (in nanometers).Dye Peak Abs. Peak Em. Dye Peak Abs. Peak Em. Methoxycoumarin360410BFP382448Fluospheres Blue3564127-hydroxy-4-methylcoumarin360449Cascade Blue377420PBFI360420SpectrumBlue405449DyeLight 405400420DiFMU (pH 9.0)357450Cascade Blue400420sgBFP (Super Glow BFP)387450Alexa Fluor 405401421SpectrumBlue400450Alexa Fluor 405401421Cell Trace Calcein Violet401451LysoTracker Blue373422DAPI345455LysoSensor Blue374424NucBlue Fixed Cell Stain345455AMCA345425Pacific Blue405455True Blue365425Pacific Blue4104557-amino-4-methylcoumarin (AMC)351430PO-PRO-1435455PO-PRO-1435455Phorwite AR360430POPO-1434456DyLight 350353432POPO-1434456Uvitex SFC365435TagBFP4024574-methylumbelliferone360440Marina Blue365460CellTrace Calcein Blue373440SITS365460Calcofluor White350440Thioflavin TCN350460Fast Blue360440Monochlorobimane(mBCI)380461LysoSensor Yellow / Blue (p H 8.0)329440Quinine Sulfate349461Acridine362462LysoSensor Yellow / Blue (p H 8.0)329440CellLights CFP434477ECFP434477LysoSensor Yellow / Blue (p H 8.0)329440CFP4344771,8-ANS372480LysoSensor Yellow / Blue (p H 8.0)329440SYTOX Blue444480SYTOX Blue444480Alexa Fluor 350346442Hoechst 33342347483AMCAX353442NucBlue Live Cell Stain347483LIVE / DEAD Fixable Blue D ead Cell Stain344442Thiolyte378483SYTO 45452484Y66H360442SYTO 45452484ABQ344445SYTO 45452484BFP382448SYTO 45452484SYTO 45452484YO-PRO-1491507Hoechst 33258345487GFP488507AmCyan548489YO-PRO-1491507Auramine O445500Premo FUCCI Cell Cycle Sensor (S / G2 / M phases)474509SYTO 9482500SYTO 9482500sgGFP (Super Glow GFP)474509SYTO 9482500wtGFP (wild type GFP, non-UV excitation)475509SYTO 9482500SYTO 9482500YOYO-1491509DiO484501YOYO-1491509DiO484501YOYO-1491509DiO484501YOYO-1491509LysoSensor Green448503YOYO-1491509LysoSensor Green448503HPTS (Solvent Green 7)455510LysoSensor Green448503Nitrobenzoxadiazole465510LysoSensor Green448503S65L484510LysoSensor Green448503LysoTracker Green504511SYTO 13487505S65T488511LysoSensor Green (pH 5)442505LysoTracker Green504511SYTO 13487505LysoTracker Green504511SYTO 13487505MitoTracker Green FM490512SYTO 13487505MitoTracker Green FM490512SYTO 13487505MitoTracker Green FM490512DiO (Vybrant DiO)489506MitoTracker Green FM490512HCS LipidTox Green498506FluoSpheres Yellow-Green501513LIVE / DEAD Fixable Green498506Evans Blue460515LIVE / DEAD Fixable Green498506Evans Blue460515ATTO 465453507rsGFP (red shifted GFP, S65 T)498516CellLights GFP488507CellEvent Caspase-3 / 7 Green488507Cell Tracker Violet BMQC415516Diversa Green-FP484507HCS CellMask Green493516GFP (EGFP)488507Cell Tracker Violet BMQC415516S65C479507Cell Tracker Violet BMQC415516YO-PRO-1491507Cell Tracker Violet BMQC415516GFP488507Cell Tracker Violet BMQC415516YO-PRO-1491507HCS CellMask Green493516GFP4885075-carboxyfluorescein(5-FAM)492518Rhodol Green496523SYTOX Green504523ActinGreen (Alexa Fluor 488 phalloidin)496518Rhodamine Green497523Rhodamine Green497523Alexa Fluor 488496518Rhodamine Green497523Click-iT EdU Alexa Fluor 488496518Neurotrace 500 / 525 Green497524Oregon Green 488498524DyLight+C110 488493518SYBR Safe507524Fluoro-Emerald494518NeuroTrace 500 / 525 Nissl st ain497524Aiexa Fluor 488496518Carboxyfluorescein (5-FAM)492518Oregon Green 488498524Alexa Fluor 488496518NeuroTrace 500 / 525 Nissl st ain497524Carboxyfluorescein (5-FAM)492518CellRox Green485520Oregon Green 488498524FITC (Fluorescein)492520NeuroTrace 500 / 525 Nissl st ain497524Fluor-X494520Rhodamine 110496520NeuroTrace 500 / 525 Nissl st ain497524SYTO 16490520FITC492520Oregon Green 488498524Rhodamine 110496520Dansyl335525SYTO 16490520Fluoro-Jade B480525FITC492520Qdot 525UV525Rhodamine 110496520SYTO 11506525SYTO 16490520Qdot 525UV525SYTO 16490520Qdot 525UV525FITC492520Acridine Orange + DNA500526Rhodamine 110496520LIVE / DEAD Fixable Green498526SYTO 16490520Surf Green EX469526SYBR Green I497521Acridine Orange + DNA500526SYBR Green I497521Acridine Orange + DNA500526SYBR Green I497521Acridine Orange + DNA500526SYBR Green I497521Acridine Orange (+DNA)500526SYBR Green I497521Thiol Tracker Violet405526Quant-iT PicoGreen502522ThiolTracker Violet405526Spectru mgreen498522ThiolTracker Violet405526NucGreen Dead Cell Stain504523Thiol Tracker Violet405526Rhodamine Green497523Acridine Orange (+DNA)500526ThiolTracker Violet405526NBD-X467538SYTO RNASelect503527SYBR Gold495539EYFP514527SYBR Gold495539SYTO RNASelect503527SYBR Gold495539SYTO RNASelect503527SYBR Gold495539SYTO RNASelect503527SYBR Gold495539SYTO RNASelect503527Alexa Fluor 430432540Rhodamine 123507529Auramine460540YFP512529Aurophosphine470540F2N12S405530, 585BCECF499540BODIPY 492 / 515490540F2N12S405530, 585BODIPY 505 / 515502540BODIPY FL502540F2N12S405530, 585BTC464540Calcein494540F2N12S405530, 585Calcium Green-1506540Catskill Green 540482540F2N12S405530, 585CellTracker Green490540CFDA494540F2N12S405530, 585CFP434540Cy2492540F2N12S405530, 585CyQUANT Direct (CyQUANT GR)500540Magnesium Green506530DAF-FM493540NBD Amine450530Emerald Green490540TO-PRO-1515530Fluo-3506540TOTO-1513531Fluo-4494540Oregon Green 514512532H2DCFDA (H2-DCF,DCFR)504540Sodium Green506532Vybrant DyeCycle Green505532Alexa Fluor 430434540pHrodo Green509533Alexa Fluor 430432540NBD-X467538BCECF (pH 5.2)499540NBD-X467538Calcein494540NBD-X467538CellTracker Green CMFDA490540NBD-X467538CFP434540NBD-X467538Cy2492540NBD-X467538CyQUANT Direct500540DAF-FM493540Lucifer yellow428544Fluo-4494540Lucifer Yellow428544Alexa Fluor 430432540Lucifer yellow428544BCECF (pH 5.2)499540Eosin524545Calcein494540JOJO-1529545CellTracker Green CMFDA490540Qdot 545UV545CFP434540Qdot 545UV545Cy2492540Auramine O460550CyQUANT Direct500540Pacific Orange440551Alexa Fluor 430432540Pacific Orange440551BCECF (pH 5.2)499540Pacific Orange440551CFP434540Pacific Orange440551Cy2492540Pacific Orange440551Alexa Fluor 430432540Pacific Orange440551BCECF (pH 5.2)499540mBanana540553Alexa Fluor 430432540ER-Tracker Blue-White DPX371554BCECF (pH 5.2)499540Alexa Fluor 430432540Alexa Fluor 532532554BCECF (pH 5.2)499540FocalCheck Double Orange540555Calcein494540HEX533558CellTracker Green CMFDA490540Fluospheres Orange539560CFP434540mHoneydew478561Cy2492540Vybrant DyeCycle Orange518562CyQUANT Direct500540ActinRed 555 (rhodamin pphalloidin)540565DAF-FM493540Fluo-4494540Alexa Fluor 555555565TET520541CellRox Orange545565TET521542Qdot 565UV565Lucifer Yellow423543Qdot 565UV565Qdot 545UV543DiI (CellTracker Dil)551568Lucifer Yellow423543mOrange548568Lucifer Yellow423543OFP546568Lucifer Yellow423543Bodipy TMR544569Lucifer Yellow423543Cy3552570Lucifer Yellow423543PO-PRO-3539570Lucifer Yellow423543SYTOX Orange567570Lucifer Yellow423543CellMask Orange556571Alexa Fluor 546561572RFP552585POPO-3532573Qdot 585UV585TurboRFP553574Qdot 585UV585Calcium Orange549575DsRed Monomer556586CellTracker Orange547575pHrodo Red559586LIVE / DEAD Fixable Yellow405575Carboxy SNARF-1548587LIVE / DEAD Fixable Yellow405575pHrodo Red559587LIVE / DEAD Fixable Yellow405575SpectrumOrange559588LIVE / DEAD Fixable Yellow405575DsRed2563588LIVE / DEAD Fixable Yellow405575DiA456590LIVE / DEAD Fixable Yellow405575DiA456590DyLight 594562576DiA456590MitoTracker Orange CMTMRos(MitoTracker Orange CM-H2TMRos)551576DiA456590DiA456590DiA456590Phycoerythrin (PE, R-phycoerythrin)567576DiA456590DiA456590Rhod-2551576rhodamine Red-X572591Rhodamine Phalloidin557576CellTrace calcein red-orange575592X-Rhod-1570576LysoTracker Red573592DsRed-Express557579Sulforhodamine 101578593Rhodamine Red560580sulforhodamine 101577593TAMRA565580ROX (6-ROX)568595Tetramethylrhodamine (TRI TC)5555802-dodecylresorufin582595Cy3.5579597dTomato554581Cy 3.5581597DsRed2563582MitoTracker Red CMXRos578597Amplex Ultra Red567582BOBO-3570602Amplex Red571583Ethidium Bromide521602Amplex UltraRed568583X-rhod-1579602Amplex Red570583BOBO-1570602Premo FUCCI Cell Cycle Sensor (G1 phase)555584BOBO-1570602BOBO-1570602TagRFP5555845-ROX577603CellLights RFP552585Alexa Fluor 568578603mTangerine568585Qdot 605UV605Resorufm570585Qdot 605UV605BOBO-3571606FM 143510626Calcium Crimson589608FM 143510626Fluospheres Red microspher es577608FM 143510626FM 143510626ReAsH (TC-ReAsH)593608FM 143510626CellTracker Red585612FM 143510626LIVE / DEAD Fixable Red593613YO-PRO-3612628CellTracker Red CMTPX584613Alexa Fluor 610610629LIVE / DEAD Fixable Red Dead Cell stain595613Magic Red570630CTC Formazan450630DiA (FAST DiA)491613CTC Formazan450630DiA491613YOYO-3612631HCS CellMask Red stain587614Katushka (Turbo FP635)588635HCS LipidTox Red582615mKate588635HCS LipidTOX Red582615SYTO 17620635mCherry587615Di-8 ANEPPS468635Texas Red592615Di-8 ANEPPS468635Ethidium Homodimer-1 (EthD-1)530618Di-8-ANEPPS465635Di-8-ANEPPS465635Propidium Iodide (PI)530618Di-8-ANEPPS465635Alexa Fluor 594590618Di-8-ANEPPS465635Click-iT Alexa Fluor 594590618Di-8-ANEPPS465635DyLight 594593618Di-8-ANEPPS465635SYPRO Ruby450618Di-8-ANEPPS465635SYPRO Ruby450618Nile Red551636SYPRO Ruby450618Nile red (triglyceride)552636SYPRO Ruby450618Nile red (triglyceride)552636SYPRO Ruby450618Nile red (triglyceride)552636SYPRO Ruby450618Fura Red (high Ca2+)436637Bodipy TR-X588621Nile Red phospholipid551638CellTrace BODIPY TR meth yl esther597625SYTO 17619638Bodipy 630 / 650-X625641mRaspberry598625BODIPY 630 / 650X626641Qdot 625UV6257-AAD549644Qdot 625UV625HCS NuclearMask Red624644FM 1-43510626HCS NuclearMask Red622644FM 1-43510626SYTO 59621644SYTO 59622645LIVE / DEAD Fixable Far Red650665Fluospheres Crimson micros pheres620646Cy5648666FluoSpheres crimson micros pheres621646Lysotracker Deep Red647668Alexa Fluor 647650670SYTOX AADvanced dead c ell stain546647Click-iT Alexa Fluor 647650670DiD (Vybrant DiD)645670Alexa Fluor 635634647HCS CellMask Deep Red sta in649670HcRed594649mPlum590649ATTO 647644670SYTO 61619649Fura Red (-Ca2+)473670Alexa Fluor 633631650Fura Red (-Ca2+)473670Acridine Orange + RNA460650Fura Red (-Ca2+)473670Acridine Orange + RNA460650Fura Red (-Ca2+)473670Acridine Orange (+RNA)460650Fura Red (-Ca2+)473670Acridine Orange (+RNA)460650DyLight 649654673HCS LipidTOX Deep Red634652Carboxynaphthofluorescein600674Fura Red (+Ca2+)436655PerCP488675Fura Red (+Ca2+)436655CellMask Deep Red plasma membrane stain658676Fura Red (+Ca2+)436655Fura Red (+Ca2+)436655DRAQ5650680Qdot 655UV655SYTO 60649681Fura Red (+Ca2+)436655SYTO 62650681Fura Red (+Ca2+)436655SYTO 60650681Qdot 655UV655FluoSpheres dark red micros pheres657683FxCycle Far Red641657TO-PRO-3642657ATTO 655663683DDAO648658FluoSpheres Dark Red fluorescent microspheres656683DyLight 633638658SYTOX Red640658NucRed Live 647638686ATTO 635635658Vybrant DyeCycle Ruby638686APC (Allophycocyanin)651660HCS NuclearMask Deep Red635687MitoTracker Deep Red FM641661Cy5.5672690NucRed Dead 647642661Alexa Fluor 660663691TOTO-3642661Alexa Fluor 660663691BODIPY 650 / 665647665Cy5.5678696CellRox Deep Red640665DY-675675699IRDye 700 Phosphoramidite691699Alexa Fluor 700696719ATTO 680680700ATTO 700699719Alexa Fluor 680679702FM 4-64558734HiLyte Fluor 680688702FM 4-64558734Qdot 705 Nanocrystals300702FM 4-64558734Alexa Fluor 680679704FM 4-64558734DyLight 680676705Cy7745766Qdot 705UV705LIVE / DEAD Fixable near-IR750775Qdot 705UV705Quasa 705688706CellVue NIR780743776IRDye 680 NHS Ester683710DyLight 750752778RH 795530712IRDye 800CW774789RH 795530712XenoLight CF770770797RH 795530712Qdot 800UV800RH 795530712Qdot 800UV800RH 795530712Indocyanine Green768807
[0132] In some other aspects, the conjugate compounds include a chemiluminescent compound, colloidal metal, luminescent compound, enzyme, radioisotope, or paramagnetic labels.
[0133] In certain aspects, the conjugates of the present disclosure are conjugated to radioactive isotopes instead of or in addition to other types of detectable agents. Certain isotopes sutable for use in the present compounds include, but not limited to, iodine-131, iodine-125, bismuth-212, bismuth-213, lutetium-177, rhenium-186, rhenium-188, yttrium-90, astatine-211, phosphorus-32 and / or samarium-153. In some aspects, the conjugates of the present disclosure contain one or more atoms having an atomic mass or mass number different from the atomic mass or mass number usually found in nature, including but not limited to hydrogen, carbon, fluorine, phosphorous, copper, gallium, yttrium, technetium, indium, iodine, rhenium, thallium, bismuth, astatine, samarium, and lutetium (for example, 3H , 3< H, 13< C, 14< C, 18< F, 32< P, 35< S, 64< Cu, 67< Ga, 90< Y, 99M< Tc, 111< In, 125< I, 123< I, 131< I, 135< I, 186< Re, 187< Re, 201< Tl, 212< Bi, 211< At, 153< Sm and / or 177< Lu). In other aspects, the conjugates of the present disclosure are labeled with a paramagnetic metal ion that is a good contrast enhancer in Magnetic Resonance Imaging (MRI). Examples of such paramagnetic metal ions include, but are not limited to, gadolinium III (Gd3+), chromium 111 (Cr3+), dysprosium III (Dy3+), iron 111 (Fe3+), manganese II (Mn2+), and ytterbium III (Yb3+). In certain embodiments, the labeling moieties comprises gadolinium III (Gd3+)
[0134] In some aspects, the conjugates of the present disclosure are conjugated to biotin. In addition of extension of half-life, biotin also acts as an affinity handle for retrieval of the peptides from tissues or other locations. In one aspect, the conjugates are conjugated, e.g., to a biotinidase resistant biotin with a PEG linker (e.g., NHS-dPEG4-Biotinidase resistant biotin). In some aspects, fluorescent biotin conjugates that can act both as a detectable label and an affinity handle are used. Non-limiting examples of commercially available fluorescent biotin conjugates include Atto 425-Biotin, Atto 488-Biotin, Atto 520-Biotin, Atto-550 Biotin, Atto 565-Biotin, Atto 590-Biotin, Atto 610-Biotin, Atto 620-Biotin, Atto 655-Biotin, Atto 680-Biotin, Atto 700-Biotin, Atto 725-Biotin, Atto 740-Biotin, fluorescein biotin, biotin-4-fluorescein, biotin-(5-fluorescein) conjugate, and biotin-B-phycoerythrin, alexa fluor 488 biocytin, alexa flour 546, alexa fluor 549, lucifer yellow cadaverine biotin-X, Lucifer yellow biocytin, Oregon green 488 biocytin, biotin-rhodamine and tetramethylrhodamine biocytin.
[0135] Linkers. In some aspects, the peptides of the present disclosure are directly conjugated to a detectable label, such as a dye, fluorescent moiety or the like such that no additional amino acids, carbohydrates, nucleic acids, polymers, organic chains, or the like are added to the chlorotoxin or chlorotoxin variant and / or the dye, fluorescent moiety or the like to comprise the chlorotoxin conjugates described herein. In some other aspects, a linker is used to conjugate the chlorotoxin or chlorotoxin variant is not directly conjugated to a dye, fluorescent moiety or the like such that additional amino acids, carbohydrates, nucleic acids or the like are added to the chlorotoxin or chlorotoxin variant and / or the dye, fluorescent moiety or the like to comprise the chlorotoxin conjugates described herein. A "linker" as used herein refers to at least one compound comprising two functional groups that are capable of reacting specifically with other moieties to form covalent or non-covalent linkages. Such moieties include, but are not limited to, the side groups on natural or non-natural amino acids or peptides which contain such natural or non-natural amino acids. By way of example, a linker has a functional group reactive with a group on a first peptide, and another functional group which is reactive with a group on a second peptide, whereby forming a conjugate that includes the first peptide, the linker and the second peptide. Many procedures and linker molecules for attachment of various compounds to peptides are known. See, e.g., European Patent Application No. 188,256; U.S. Pat. Nos. 4,671,958, 4,659,839, 4,414,148, 4,699,784; 4,680,338; and 4,569,789.
[0136] The term "linkage," as used herein refers to a bond or a chemical moiety formed from a chemical reaction between the functional group of a linker and another molecule. Such bonds include, but are not limited to, covalent linkages and non-covalent bonds, while such chemical moieties include, but are not limited to, esters, carbonates, imines phosphate esters, hydrazones, acetals, orthoesters, peptide linkages, and oligonucleotide linkages. Hydrolytically stable linkages means that the linkages are substantially stable in water and do not react with water at neutral pH values, including but not limited to, under physiological conditions for an extended period of time, perhaps even indefinitely. Hydrolytically unstable or degradable linkages mean that the linkages are degradable in water or in aqueous solutions, including for example, blood. Enzymatically unstable or degradable linkages mean that the linkage is often degraded by one or more enzymes. By way of example, PEG and related polymers include degradable linkages in the polymer backbone or in the linker group between the polymer backbone and one or more of the terminal functional groups of the polymer molecule. Such degradable linkages include, but are not limited to, ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent, wherein such ester groups generally hydrolyze under physiological conditions to release the biologically active agent. Other hydrolytically degradable linkages include but are not limited to carbonate linkages; imine linkages resulted from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; hydrazone linkages which are reaction product of a hydrazide and an aldehyde; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; peptide linkages formed by an amine group, including but not limited to, at an end of a polymer such as PEG, and a carboxyl group of a peptide; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide.
[0137] The conjugates for use in the method described herein is conjugated by using any art-recognized method forming a complex including covalent, ionic, or hydrogen bonding of the ligand to the imaging agent, either directly or indirectly via a linking group such as a linker. The conjugate is typically formed by covalent bonding of the ligand to the imaging agent through the formation of amide, ester or imino bonds between acid, aldehyde, hydroxy, amino, or hydrazo groups on the respective components of the complex or, for example, by the formation of disulfide bonds.
[0138] In addition, structural modifications of a linker portion of the conjugates are contemplated herein. For example, a number of amino acid substitutions are often made to the linker portion of the conjugate, including but not limited to naturally occurring amino acids, as well as those available from conventional synthetic methods. In one aspect, beta, gamma, and longer chain amino acids are used in place of one or more alpha amino acids. In another aspect, the stereochemistry of the chiral centers found in such molecules is selected to form various mixture of optical purity of the entire molecule, or only of a subset of the chiral centers present. In another aspect, the length of the peptide chain included in the linker is shortened or lengthened, either by changing the number of amino acids included therein, or by including more or fewer beta, gamma, or longer chain amino acids. In another aspect, the selection of amino acid side chains in the peptide portion is made to increase or decrease the relative hydrophilicity of the linker portion specifically or of the overall molecule generally.
[0139] Similarly, the length and shape of other chemical fragments of the linkers described herein is often modified. In some aspects, the linker includes an alkylene chain. The alkylene chain often varies in length, or includes branched groups, or includes a cyclic portion, which are in line or spiro relative to the allylene chain. In another aspect, where the linker includes a beta thiol releasable fragment, it is appreciated that other intervening groups connecting the thiol end to the hydroxy or carbonate end are used in place of the ethylene bridge, such as but not limited to optionally substituted benzyl groups, where the hydroxy end is connected at the benzyl carbon and the thiol end is connected through the ortho or para phenyl position, and vice versa.Formulations of Chlorotoxin Conjugates
[0140] In various aspects, the present disclosure provides compositions comprising the above-described compounds and a pharmaceutically acceptable carrier. In some aspects, the composition is formulated for parenteral administration. In further aspects, the composition is formulated for intravenous administration, intramuscular administration, subcutaneous administration, or a combination thereof.
[0141] Certain methods described herein comprise administering to the subject an intravenous pharmaceutical composition comprising a chlorotoxin conjugate, for example, as described herein. Intravenous pharmaceutical compositions of chlorotoxin conjugates include any formulation suitable for administration to a subject via any intravenous method, including a bolus, an infusion which occurs over time or any other intravenous method known in the art. In some aspects, the rate of infusion is such that the dose is administered over a period of less than five minutes, more than five minutes but less than 15 minutes or greater than 15 minutes. In other aspects, the rate of infusion is such that the dose is administered over a period of less than 5 minutes. In other aspects, the rate of infusion is such that the dose is administered over a period of greater than 5 minutes and less than 15 minutes. In some other aspects, the rate of infusion is such that the dose is administered over a period of greater than 15 minutes.
[0142] "Product" or "dosage form" as used herein refers to any solid, semi-solid, lyophilized, aqueous, liquid or frozen formulation or preparation used for administration. Upon administration, the rate of release of an active moiety from a product is often greatly influenced by the excipients and / or product characteristics which make up the product itself. For example, an enteric coat on a tablet is designed to separate that tablet's contents from the stomach contents to prevent, for example, degradation of the stomach which often induces gastrointestinal discomfort or injury. According to the currently accepted conventional understanding, systemic exposure of the active moiety will be relatively insensitive to the small formulation changes.
[0143] As used herein "pharmaceutically acceptable" or "pharmacologically acceptable" includes molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to a subject, as appropriate. "Pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like. The use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients are often also incorporated into the compositions.
[0144] In various aspects, the present compositions comprise a concentration of the compound as an active pharmaceutical ingredient having a concentration of from 1 mg / mL to 40 mg / mL. In further aspects, the concentration of the compound is from 1 mg / mL to 20 mg / mL. In still other aspects, the concentration of the compound is from 4 mg / mL to 10 mg / mL. In additional aspects, the concentration of the compound is from 5 mg / mL to 8 mg / mL. In yet further aspects, concentration of the compound is from 5 mg / mL to 6 mg / mL.
[0145] In some aspects, pharmaceutically acceptable carrier comprises tris, D-mannitol, and a pH of essentially 6.8. In other aspects, the compositions consist essentially of tris, D-mannitol, and a pH of 6.8.
[0146] In some aspects, pharmaceutically acceptable carrier comprises histidine and mannitol. In some aspects, pharmaceutically acceptable carrier comprises histidine and mannitol with polysorbate 20. In some aspects, pharmaceutically acceptable carrier comprises L-histidine, D-mannitol, L-methionine, and a pH of essentially 6.8. In additional aspects, the pharmaceutically acceptable carrier consists essentially of L-histidine, D-mannitol, L-methionine, and a pH of 6.8.
[0147] In some aspects, the pharmaceutically acceptable carrier comprises L-histidine, D-mannitol, polysorbate 20, and a pH of essentially 6.8. In some aspects, the pharmaceutically acceptable carrier comprises L-histidine, D-mannitol, and a pH of essentially 6.8. In some aspects, the pharmaceutically acceptable carrier comprises L-histidine, D-mannitol, polysorbate 20, trehalose, and a pH of essentially 6.8.
[0148] A pharmaceutical composition comprising a chlorotoxin conjugate is formulated according to known methods to prepare pharmaceutically useful compositions, for example, as found in "Excipient Selection in Parenteral Formulation Development" Pramanick et.al., Pharma Times, Vol. 45., No. 3, March 2013.
[0149] In some aspects, the chlorotoxin conjugate is combined with a pharmaceutically acceptable carrier. A composition is said to be a pharmaceutically acceptable carrier if its administration is tolerated by a recipient patient. Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable carrier. Other suitable carriers are well-known to those in the art. See, for example, Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995).
[0150] Formulations for administration of chlorotoxin conjugates are typically provided but are not limited to as liquid, solid or semi-solid products or dosage forms, exemplified by tablets, capsules, pellets, a powder or a lyophilized product. In some aspects, the chlorotoxin conjugate is formulated to comprise no additional materials except for a pharmaceutical carrier. In some other aspects, the chlorotoxin conjugate is formulated such that it comprises a core "matrix material" which encapsulates, binds to, coats or is adjacent to the chlorotoxin conjugate. In some other aspects, the chlorotoxin conjugate and matrix material further comprises a protective coatings. Various formulations are well-known to those in the art. See, for example, Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995).
[0151] Suitable excipients for use with chlorotoxin conjugates are often included in formulations for intravenous use, for example, an injection. Injections are sterile, pyrogenfree solutions or dispersions (emulsions or suspensions) of one or more active ingredients in a suitable vehicle or carrier. Injections that are dispersions should remain sufficiently stable so that, after shaking, a homogeneous dose is withdrawn. More specifically, formulations which include chlorotoxin conjugates and one or more but not limited to suitable excipients, exemplified by matrix materials, binders, lubricants, glidants or disintegrants which aid in modulating the PK profile of administered chlorotoxin conjugates are preferred. In some aspects, compositions comprising chlorotoxin conjugates in combination with one or more suitable excipients and one or more specific product characteristics (such as dissolution or water content) which result in improved pharmacokinetic profiles of chlorotoxin conjugates in vivo. Thus, the in vivo performance of chlorotoxin conjugates dosage forms / products included herein is based upon the composition of the excipients added during manufacturing and / or the final product characteristics generated through specific processing parameters and methods. Other excipients are well-known to those in the art. See, for example, Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995).
[0152] Suitable carriers for intravenous administration include for example but are not limited to physiological saline or phosphate buffered saline (PBS), Tris, and solutions containing solubilizing agents, such as glucose, polyethylene glycol, polypropylene glycol, additional agents such as histidine, dextrose, mannitol and mixtures thereof. In some aspects, carriers for intravenous administration include a mixture of histidine and dextrose, Tris and dextrose or Tris and mannitol. Other carriers are well-known to those in the art. See, for example, Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995).
[0153] The formulation often includes an aqueous vehicle. Aqueous vehicles include, by way of example and without limitation, sodium chloride solution, Ringers solution, isotonic dextrose solution, sterile water solution, dextrose and lactated Ringers solution. Nonaqueous vehicles include, by way of example and without limitation, fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil and peanut oil, benzyl benzoate, castor oil, N,N-dimethylacetamide, ethanol, dehydrated ethanol, glycerin, glycerol, N-methyl-2-pyrrolidone, polyethylene glycol and any derivative thereof, propylene glycol, safflower oil and soybean oil. Other vehicles are well-known to those in the art. See, for example, Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995).
[0154] In some aspects, the composition the pharmaceutically acceptable carrier comprises an osmolyte. In some aspects, the osmolyte comprises a sugar, a sugar alcohol, or a combination thereof.
[0155] In certain aspects, the composition comprises a sugar alcohol selected from sorbitol, inositol, mannitol, xylitol and glycerol, or a combination thereof. In further aspects, the sugar alcohol comprises mannitol. In certain aspects, the composition comprises from 2% to 20% (wt / vol %) mannitol. In some aspects, the composition comprises from 2% to 10% (wt / vol %) mannitol. In further aspects, the composition comprises essentially 5% (wt / vol %) mannitol.
[0156] In other aspects, the composition comprises a sugar. In certain aspects, the sugar is selected from trehalose, lactose, sucrose, glucose, galactose, maltose, mannose, fructose, dextrose, or a combination thereof. In additional aspects, the sugar is selected from trehalose, sucrose, or a combination thereof. In some aspects, the composition comprises from 1% to 40% (wt / vol %) of trehalose, sucrose, or a combination of trehalose and sucrose. In other aspects, the composition comprises from 1% to 20% (wt / vol %) of trehalose, sucrose, or a combination of trehalose and sucrose. In additional aspects, the composition comprises 2% (wt / vol %) of trehalose, sucrose, or a combination of trehalose and sucrose.
[0157] In certain aspects, the composition further comprises an osmolyte selected from glycine, carnitine, ethanolamine, their phosphates, mono sugars, or a combination thereof.
[0158] In some aspects, the present compositions are isotonic. In other aspects, the compositions are essentially isotonic.
[0159] In certain aspects, the ionic strength of the composition is less than 50 mM. In other aspects, the ionic strength of the composition is less than 10 mM.
[0160] Antimicrobial agents in bacteriostatic or fungistatic concentrations are typically added to preparations packaged in multiple dose containers which include by way of example and without limitation, phenols or cresols, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimerosal, benzalkonium chloride and benzethonium chloride. Other antimicrobial agents are well-known to those in the art. See, for example, Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995).
[0161] Buffers include by way of example and without limitation, acetate, ammonium sulfate, ammonium hydroxide, arginine, aspartic acid, benzene sulfonic acid, benzoate sodium, benzoate acid, carbonate, sodium carbonate, carbon dioxide, citrate, diethanolamine, glucono delta lactone, glycine, glycine HCl, histidine, histidine HCl, hydrochloric acid, hydrobromic acid, lysine maleic acid, meglumine, methanesulfonic acid, monoethanolamine, phosphate, sodium phosphate, citrate, succinate sodium, sulfuric acid, tartarate sodium, trmethamine, sodium citrate, hydroxide, sodium hydroxide, Tris base, Tris base -65, Tris acetate, Tris HCl, and Tris HCl-65.
[0162] In various aspects, the pharmaceutically acceptable carrier comprises a buffer. In some aspects, the buffer is selected from tris, HEPES, histidine, ethylene diamine, or a combination thereof. In other aspects, the buffer is selected from tris, histidine, or a combination thereof. In further aspects, the buffer comprises histidine, which is optionally L-histidine. In additional aspects, the composition comprises at least 100 mM histidine. In further aspects, the composition comprises at least 50 mM histidine. In some aspects, the composition comprises at least 20 mM histidine. In additional aspects, the composition comprises 10 to 100 mM histidine. In other aspects, the composition comprises 10 to 20 mM histidine.
[0163] Antioxidants include by way of example and without limitation, sodium bisulfate, acetone sodium bisulfate, argon, ascorbyl palmitate, ascorbate sodium, ascorbate acid, butylated hydroxy anisole, butylated hydroxy toluene, cysteine, cystenate HCl, dithionite sodium, gentistic acid, gentistic acid ethanoloamine, glutamate monosodium, glutathione, formaldehyde solfoxylate sodium, metabisulfite potassium, metabisulfite sodium, methionine, monothioglycerol, nitrogen, propyl gallate, sulfite sodium, tocopherol alpha, alpha tocopherol hydrogen succinate and thioglycolyate sodium.
[0164] In some aspects, the compositions comprise an antioxidant, a free radical scavenger, a quencher, an antioxidant synergist or a combination thereof.
[0165] In some aspects, the antioxidant is selected from methionine, butylated hydroxytoluene, butylated hydroxyanisole, propyl gallate, or a combination thereof. In other aspects, the antioxidant comprises methionine. In further aspects, the antioxidant is L-methionine. In certain aspects, the compositions comprise at least 20 mM methionine. In other aspects, aspects, the compositions comprise at least 10 mM methionine.
[0166] Suspending, emulsifying and / or dispersing agents include by way of example and without limitation, sodium carboxymethylcelluose, hydroxypropyl methylcellulose, Polysorbate 80 (TWEEN ®< 80) and polyvinylpyrrolidone.
[0167] In various aspects, the compositions comprise a surfactant. In certain aspects, the surfactant is selected from polysorbate 20, polysorbate 80, a pluronic, polyoxyethylene sorbitan mono-oleate, polyethylene mono-laureate, N-actylglucoside, or a combination thereof. In certain aspects, the surfactant is polysorbate 20. In further aspects, the compositions comprise from 0.0001% to 0.1% (wt / vol %) polysorbate 20. In additional aspects, the compositions comprise cyclodextrin. In further aspects, the cyclodextrin comprises (2-hydroxypropyl)-β-cyclodextrin.
[0168] A sequestering or chelating agent of metal ions include by way of example and without limitation, calcium disodium EDTA, disodium EDTA, sodium EDTA, calcium versetaminde sodium, calteridol and DPTA. In some aspects, the present compositions comprise a metal chelator. In certain aspects, the metal chelator is selected from EDTA, deferoxamine mesylate, EGTA, fumaric acid, and malic acid, salts thereof, or combinations thereof. In further aspects, the metal chelator comprises EDTA or salts thereof. In certain aspects, the compositions have an EDTA concentration of about 0.1 mg / ml to about 1.0 mg / ml.
[0169] Other isotonic agents, buffers, antioxidants, anesthetics, suspending and dispersing agents, emulsifying agents and chelating agents are well-known to those in the art. See, for example, Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995).
[0170] Pharmaceutical carriers also include, by way of example and without limitation, ethyl alcohol, polyethylene glycol and propylene glycol for water miscible vehicles and sodium hydroxide, hydrochloric acid, citric acid or lactic acid. Other pharmaceutical carriers are well-known to those in the art. See, for example, Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995).
[0171] The chlorotoxin conjugates described herein are often formulated using a variety of parameters including by way of example and without limitation, pH, molarity, % weight / volume, % volume / volume and the like. Other factors considered in the formulation of, stability of, storage of, shipping of chlorotoxin conjugates include by way of example and without limitation, the gas environment, container material, container color, cap material, cap color, presence of additional aspects, such as antioxidants, stabilizers, photoprotective compounds, protectants, sugars, ion chelators, ion donors or the like. Any factor which serves as any one of the above factors known to one of ordinary skill in the art is often used with the chlorotoxin conjugates described herein but not limited as such.
[0172] The preparation of pharmaceutical or pharmacological compositions are known to those of skill in the art in light of the present disclosure. General techniques for formulation and administration are found in "Remington: The Science and Practice of Pharmacy, Twentieth Edition," Lippincott Williams & Wilkins, Philadelphia, Pa. Tablets, capsules, pills, powders, granules, dragees, gels, slurries, ointments, solutions suppositories, injections, inhalants and aerosols are examples of such formulations.
[0173] The chlorotoxin conjugates are often stored at various temperatures, including by way of example and without limitation, freezing, for example at about -20°C, about -70°C, about -100 °C, about -120 °C, about -150 °C, about -200 °C or more than about -200 °C, cold storage, for example at about 10 °C, about 5 °C, about 4 °C, about 2 °C, about 0°C, about -2°C or more than about -5°C, or any other suitable temperature such that the composition remains stable.
[0174] In some aspects, compositions comprising the compounds described herein are stored as lyophilized solids. In some aspects, the present disclosure provides methods for producing the lyophilized composition, the method comprising providing the composition; and lyophilizing the composition, thereby producing the lyophilized composition.
[0175] Using lyophilization, it is possible to store the compounds in a manner that maintains physiological or otherwise optimal pH, isotonicity and stability. Such materials include pH buffers, preservatives, tonicity adjusting agents, anti-oxidants, other polymers (e.g., viscosity adjusting agents or extenders) and excipients to stabilize the labile protein against the stresses of drying and storage of the dried product. Specific illustrative examples of such additives include phosphate, citrate, or borate buffers; thimerosal; sorbic acid; methyl or propyl paraben, and chlorobutanol preservatives; sodium chloride: polyvinyl alcohol, polyvinyl pyrrolidone; mannitol, dextrose, dextran, lactose, sucrose, ethylene diamine tetraacetic acid, and the like. Suitable formulations, known in the art, (Remington's Pharmaceutical Sciences (latest edition), Mack Publishing Company, Easton, Pa.; Arakawa et al. (1990), supra; Carpenter et al. (1991), supra; and Pikal (1990), supra).
[0176] In certain aspects, the pharmaceutically acceptable carrier comprises a reconstitution stabilizer. In other aspects, the reconstitution stabilizer comprises a water-soluble polymer. In additional aspets, the water-soluble polymer is selected from a polaxamer, a polyol, a polyethylene glycol, a polyvinylalcohol, a hydroxyethyl starch, dextran, polyvinylpyrrolidene poly(acrylic acid), or a combination thereof.
[0177] The term "reconstitution stabilizer" means any excipient which is capable of preventing aggregation of a reconstituted protein in an aqueous medium. Excipients possessing the necessary characteristics for the present invention are well-known in the art and generally function by the mechanisms of charge replusion, steric hindrance, hydrophobic binding or specific high-affinity binding to the dried protein. Exemplary excipients include various osmolytes, various salts, water soluble synthetic and natural polymers, surfactants, sulfated polysaccharides, carrier proteins, buffers and the like (Manning et al. (1989), Pharmaceutical Research, 6:903-918; and Paborji, et al. (1994), Pharmaceutical Research, 11:764-771).
[0178] The present compounds and an effective amount of the reconstitution stabilizer are admixed under conditions effective to reduce aggregation of present compounds upon reconstitution with the reconstitution medium (e.g., a solvent and optionally other components such as antibacterials). The reconstitution stabilizer may be admixed with the compouns at a suitable time before, during or after reconstitution; preferably the reconstitution stabilizer will be pre-dissolved in the reconstitution medium. The compound is reconstituted at a temperature which is above the freezing point of the reconstitution medium, but which will not degrade the compound and which will not be deleterious to the reconstitution stabilizer; preferably the temperature will be between about 2 °C to 50 °C. The time taken to mix the reconstitution stabilizer and the dried compound should be for a sufficient period to prepare a suitable admixture; preferably mixing will be for between about 1 to 30 minutes. Generally, the reconstituted formulation is used soon after reconstitution.
[0179] In certain aspects, the present compositions are reconstituted from a lyophilized form. In other aspects, the present disclosure provides methods for producing the reconstituted composition, the method comprising providing a lyophilized composition; and reconstituting the composition with a solution to produce a reconstituted composition. In various aspects, the reconstituting solution comprises water. In some aspects, the reconstituting solution is selected from sterile water, physiological saline solution, glucose solution or other aqueous solvents (e.g., alcohols such as ethyl, n-propyl or isopropyl, butyl alcohol), or a combination thereof, which are capable of dissolving the dried composition and compatible with the selected administration route and which does not negatively interfere with the compound and the reconstitution stabilizers employed.Storage Vessels
[0180] In some aspects, the chlorotoxin conjugates are placed into containers following formulation. Often the containers include by way of example and without limitation, glass, for example amber glass or colorless glass. The containers often include by way of example and without limitation, a plastic, a rubber, a metal, a biodegradable material or the like known to one of skill in the art and are any color, colorless, opaque or clear. In some aspects, the chlorotoxin conjugates are placed into containers which are sealed following formulation. Often the seal is a cap, for example, the cap is a plastic, a rubber, a metal, a biodegradable material, a combination of or the like known to one of skill in the art and are any color, colorless, opaque or clear, sometimes a film. In some aspects, a gas is included in the container, often to enhance stability of the chlorotoxin conjugate or prevent oxygen from contacting the chlorotoxin conjugate. For example, gas includes by way of example and without limitation, an inert gas, such as nitrogen or argon, occasionally a noble gas and is used at any suitable concentration.
[0181] In some aspects the compounds of the present disclosure are stored in a vessel comprising glass, particularly a Type I glass, which has been subjected to a washing or extraction treatment which reduces the level of extractable trivalent and divalent metal ions present in / on the surface of the glass. Such treatments include steeping in (extraction with) hot (preferably at least 90 °C) water or another aqueous medium, e.g. ammonium sulfate solution, or treatment with sulfur dioxide.
[0182] In some aspects, the compounds of the present disclosure are stored in a vessel comprising USP Type 1 borosilicate glass vial with a 13 mm chlorobutyl based stopper with flourotech coating on plug and B2 coating on the top and an aluminum over seal with flip top cap.
[0183] In certain aspects, the compounds of the present disclosure are stored in a foil-lined chamber. In some aspects, the chamber comprises a dry inert atmosphere, preferably nitrogen, and a desiccant or oxygen absorber.
[0184] In various aspects, the present disclosure provides a kit comprising vessel configured to contain a fluid; any of the compounds and compositions described herein; and an elastomeric closure affixed to the vessel.
[0185] In some aspects, the kit further comprises a light shield. In further aspects, the light shield is a physical barrier configured to block at least a portion of the light incident on the vessel from the composition. In still further aspects, the physical barrier comprises an opaque or semi-opaque material.
[0186] In some aspects, the vessel is a glass vial. In further aspects, the glass vial comprises clear or amber glass. In some aspects, the glass vial is an untreated glass container. In certain aspects, the glass vial comprises USP Type I, Type II, Type III, or Type IV glass. In some aspects, the inner portion of the vessel further comprises a silica (SiO 2 ) coating or silicone coating. In some aspects, the untreated glass container is selected from an ampoule, vial, ready-to-use syringe, or carpoule.
[0187] In some aspects, the elastomeric closure is a halobutyl rubber closure. In further aspects, the halobutyl rubber closure is selected from a chlorobutyl rubber closure or a bromobutyl rubber closure. In some aspects, elastomeric closure is coated with Fluorotec, B2, or a combination thereof.
[0188] In some aspects, the kit further comprises an opaque secondary package surrounding the vessel. In certain aspects, the opaque secondary package comprises an opaque box, an opaque aluminum foil pouch, or a combination thereof. In further aspects, the opaque secondary package is configured to block at least 90% of the light incident on the package exterior from the composition. In still further aspects, the opaque secondary package is configured to block at least 95% of the light incident on the package exterior from the composition. In still further aspects, the opaque secondary package is configured to block at least 99% of the light incident on the package exterior from the composition. In still further aspects, the opaque secondary package is configured to block at least 99.9% of the light incident on the package exterior from the composition.
[0189] In some aspects, the vessel comprises a reduced-oxygen environment in contact with the composition. In certain aspects, the vessel comprises an inert gas in contact with the composition.In some aspects, the composition is sparged with an inert gas, thereby producing the reduced-oxygen environment in the vessel. In certain aspects, the inert gas comprises nitrogen or argon.Dosages and Toxicity of Compounds
[0190] The product or dosage form characteristics which result from the processing methods and / or parameters for generating formulations such as powders, lyophilized compositions, and the like include, but are not limited to, density, water content, friability, disintegration, dissolution profile(s), shape, size, weight, uniformity and composition of the particles. These product characteristics are often modulated in a number of ways and affect the final in vitro and / or in vivo performance of the formulations. Product or dosage form characteristics are often a consequence of excipient selection, excipient composition, manufacturing methods applied or a combination of any of these. The combination of excipients as well as product characteristics (including processing methods or processing parameters) of the final dosage form will ultimately determine the pharmacokinetic profile of the active ingredient in vivo. The administered chlorotoxin conjugate formulations described herein are often processed or manufactured under specific conditions such as, for example, mixing methods (including sieve size, rpm, and milling), drying time, conditions, environmental parameters (e.g., temperature and humidity) and combinations thereof) which themselves modulate the pharmacokinetic profile of chlorotoxin compositions in vivo (i.e., increase the average C max or AUC). In order to quantitatively compare one formulation to another, it is customary to measure several of these product or dosage form characteristics. This is also necessary when attempting to duplicate multiple batches.
[0191] Dissolution and drug release from formulations depends on many factors including the solubility and concentration of the active ingredient, the nature and composition of the excipients, content uniformity, water content, product shape and size, porosity, disintegration time and other factors. The release of a drug or active ingredient from a final dosage form in vitro is typically characterized by its dissolution profile under standardized conditions (using United States Pharmacopeia (USP) or similar accepted methods for reference) and at the appropriate pH, often a neutral pH. The dissolution profile shows the amount of drug released over time into the test media under specified conditions. Standard conditions make use of buffers at an appropriate pH in order to best mimic the pH of a subject's blood.
[0192] Typically a therapeutically effective dosage is formulated to contain a dose of at least about 0.1 mg up to about 1.5 mg or more, such as more than 1.5 mg of chlorotoxin conjugate. In some aspects, the effective dosage is formulated to contain a dose of at least about 0.01 mg, about 0.02 mg, about 0.03 mg, about 0.5 mg, about 0.07 mg, about 0.1 mg, about 0.2 mg, about 0.3 mg, about 0.35 mg, about 0.375 mg, about 0.4 mg, about 0.5 mg, about 0.6 mg, about 0.7 mg, about 0.75 mg, about 0.8 mg, about 0.9 mg, about 1 mg, about 1.3 mg, about 1.4 mg, about 1.5 mg, about 1.8 mg, about 1.9 mg, about 2 mg, about 2.4 mg, about 3 mg, about 5 mg, about 6 mg, about 7 mg, about 12 mg, about 18 mg or about 60 mg more of chlorotoxin conjugate. In an exemplary aspect, the dose is 0.1 mg for a mouse, 1 mg for a dog, 0.3 mg for a rat, 0.6 mg for a monkey and 3 mg for a human. The amount of chlorotoxin conjugate administered to a subject is often the total about amount listed herein. In some aspects, the amount of chlorotoxin conjugate administered to a subject is often the about per milligram, gram or kilogram of subject weight for each amount listed herein. In other aspects, the amount of chlorotoxin conjugate administered to a subject is often the about per milliliter or liter of fluid volume for each amount listed herein. In yet other aspects, the amount of chlorotoxin conjugate administered to a subject is often the about per square millimeter, square centimeter or square meter of subject surface body area or subject body area for each amount listed herein.
[0193] As used herein a "dosage regimen" refers to the protocol used to administer an intravenous pharmaceutical formulation comprising chlorotoxin conjugate to a subject. In some aspects, the dosage regimen comprises a dose amount and dosing interval. In some aspects, the dosage regimen further comprises a dosing duration. As used herein "dosing duration" refers to the period of time over which a dose is administered.
[0194] In some aspects, the dose of chlorotoxin conjugate is administered to a subject using either a fixed or a scaling dosing scheme. For example, a fixed dosing scheme includes administration of a bolus or continuous dose of chlorotoxin conjugate to a subject via an intravenous administration route wherein the fixed dose is, for example and without limitation, about 3 mg to about 6 mg and does not account or adjust for a subject's age, weight, height, body mass index, metabolism, or the like. For example, a scaling dosing scheme includes administration of a bolus or continuous dose of chlorotoxin conjugate to a subject via an intravenous administration route wherein the scaled dose is, for example and without limitation, about 3 mg to about 6 mg and accounts or adjusts for a subject's age, weight, height, body mass index, metabolism, or the like. In some aspects, the fixed dose and / or the scaled dose are determined for one subject based upon the dose administered to a different subject wherein the subjects are or are not the same species, for example a mouse and a human or a rat and a human, or a dog and a human or a monkey and a human or a non-human primate and a human. Often in a fixed dose, the same dose or about the same dose is administered to all subjects, for example a mouse and a human or a rat and a human, or a dog and a human or a monkey and a human or a non-human primate and a human. In some aspects, the scaled dose to be administered to a subject is determined from the dose administered to a different subject wherein the subjects are or are not the same species, for example a mouse and a human or a rat and a human, or a dog and a human or a monkey and a human or a non-human primate and a human. The scaled dose is therefore increased from the dose administered to the mouse, rat, dog, monkey or non-human primate to the dose administered to the human based upon the difference between the mouse, rat, dog, monkey or non-human primate and the human on factors such as subject age, weight, height, metabolism, size or the like. In a preferred aspect, the dose is scaled from a rat to a human.
[0195] The compounds and compositions described herein are administered to a subject before surgery, during surgery and / or the excised tissue from the subject is contacted with compositions of the chlorotoxin conjugates. In some aspects, compositions of chlorotoxin conjugates are intravenously administered to a subject about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 9 hours, about 12 hours, about 24 hours, about 36 hours, about 48 hours or about 72 hours before surgery. In some aspects, compositions of chlorotoxin conjugates are intravenously administered to a subject between 0 and 1 hours, between 1 and 2 hours, between 2 and 3 hours, between 3 and 4 hours, between 4 and 5 hours, between 5 and 6 hours, between 6 and 9 hours, between 9 and 12 hours, between 12 and 24 hours, between 24 and 36 hours, between 36 and 48 hours or between 48 and 72 hours (inclusive) before surgery. Tissue or fluid samples are often isolated from a subject prior to administration of a chlorotoxin conjugate, sometimes as a baseline reference. Samples are also isolated from a subject after administration of the compounds of the present disclosure, often less than about 1 minute after, about 2 minutes after, about 3 minutes after, about 4 minutes after, about 5 minutes after, about 6 minutes after, about 7 minutes after, about 8 minutes after, about 9 minutes after, about 10 minutes after, about 11 minutes after, about 12 minutes after, about 13 minutes after, about 14 minutes after, about 15 minutes after, about 20 minutes after, about 30 minutes after, about 40 minutes after, about 50 minutes after, about 60 minutes after, about 1 hour after, about 2 hours after, about 3 hours after, about 4 hours after, about 5 hours after, about 6 hours after, about 12 hours after, about 18 hours after, about 24 hours after, about 36 hours after, about 48 hours after, about 72 hours after, about 96 hours after, about 5 days after, about 7 days after, about 10 days after, about 14 days after, about 21 days after, about 4 weeks after, about 6 weeks after, about 8 weeks after, about 12 weeks after, about 16 weeks after, about 20 weeks after or more than 20 weeks after.Pharmacokinetics
[0196] The methods and compositions described herein relate to pharmacokinetics of intravenous administration of chlorotoxin conjugates to a subject. Pharmacokinetics are often described using models, for example, compartmental or noncompartmental models. Compartmental models include but are not limited to monocompartmental model, the two compartmental model, the multicompartmental model or the like. Models are often divided into different compartments and described by the corresponding scheme. For example, one scheme is the absorption, distribution, metabolism and excretion (ADME) scheme. For another example, another scheme is the liberation, absorption, distribution, metabolism and excretion (LADME) scheme. In some aspects, metabolism and excretion are grouped into one compartment referred to as the elimination compartment. For example, liberation includes liberation of the active portion of the composition from the delivery system, absorption includes absorption of the active portion of the composition by the subject, distribution includes distribution of the composition through the blood plasma and to different tissues, metabolism, which includes metabolism or inactivation of the composition and finally excretion, which includes excretion or elimination of the composition or the products of metabolism of the composition. Often, compositions administered intravenously to a subject are subject to multiphasic absorption including but not limited to aspects of tissue distribution and metabolism / excretion. As such, the decrease in plasma concentration of the composition is often biphasic, including, for example an alpha phase and a beta phase, occasionally a gamma, delta or other phase is observed. In some aspects, the bioavailability of the compositions described herein is absolute bioavailability, often 1 or 100% given intravenous administration.
[0197] Pharmacokinetics includes determining at least one parameter associated with intravenous administration of chlorotoxin conjugates to a subject. In some aspects, parameters include at least the dose (D), dosing interval (τ), area under curve (AUC), maximum concentration (C max ), minimum concentration reached before a subsequent dose is administered (C min ), minimum time (T min ), maximum time to reach C max (T max ), volume of distribution (V d ), back-extrapolated concentration at time 0 (C 0 ), steady state concentration (C ss ), elimination rate constant (k e ), infusion rate (k in ), clearance (CL), bioavailability (f), fluctuation (%PTF) and elimination half-life (T 1 / 2 ). In another aspect, the C max , C 0 . and AUC increase in a dose-dependent manner.
[0198] The compounds described herein have values for at least one of the pharmacokinetic parameters listed herein and known to those of ordinary skill in the art. Often, the values for the pharmacokinetic parameters are recorded, observed, measured, processed, analyzed or the like as data. The pharmacokinetics parameters are any parameters suitable for describing the plasma or serum profiles of chlorotoxin conjugates described herein. For example, the pharmacokinetics profile are often obtained at a time after dosing of, for example, about zero minutes, about 1 minute, about 2 minutes, about 3 minutes, about 4 minutes, about 5 minutes, about 6 minutes, about 7 minutes, about 8 minutes, about 9 minutes, about 10 minutes, about 11 minutes, about 12 minutes, about 13 minutes, about 14 minutes, about 15 minutes, about 16 minutes, about 17 minutes, about 18 minutes, about 19 minutes, about 20 minutes, about 21 minutes, about 22 minutes, about 23 minutes, about 24 minutes, about 25 minutes, about 26 minutes, about 27 minutes, about 28 minutes, about 29 minutes, about 30 minutes, about 31 minutes, about 32 minutes, about 33 minutes, about 34 minutes, about 35 minutes, about 36 minutes, about 37 minutes, about 38 minutes, about 39 minutes, about 40 minutes, about 41 minutes, about 42 minutes, about 43 minutes, about 44 minutes, about 45 minutes, about 46 minutes, about 47 minutes, about 48 minutes, about 49 minutes, about 50 minutes, about 51 minutes, about 52 minutes, about 53 minutes, about 54 minutes, about 55 minutes, about 56 minutes, about 57 minutes, about 58 minutes, about 59 minutes, about 60 minutes, about zero hours, about 0.5 hours, about 1 hour, about 1.5 hours, about 2 hours, about 2.5 hours, about 3 hours, about 3.5 hours, about 4 hours, about 4.5 hours, about 5 hours, about 5.5 hours, about 6 hours, about 6.5 hours, about 7 hours, about 7.5 hours, about 8 hours, about 8.5 hours, about 9 hours, about 9.5 hours, about 10 hours, about 10.5 hours, about 11 hours, about 11.5 hours, about 12 hours, about 12.5 hours, about 13 hours, about 13.5 hours, about 14 hours, about 14.5 hours, about 15 hours, about 15.5 hours, about 16 hours, about 16.5 hours, about 17 hours, about 17.5 hours, about 18 hours, about 18.5 hours, about 19 hours, about 19.5 hours, about 20 hours, about 20.5 hours, about 21 hours, about 21.5 hours, about 22 hours, about 22.5 hours, about 23 hours, about 23.5 hours, or about 24 hours.
[0199] The pharmacokinetics parameters are any parameters suitable for describing the plasma or serum profiles of chlorotoxin conjugates described herein. In some aspects, the dose (D) includes by way of example but is not limited to, about 0.01 mg, about 0.02 mg, about 0.03 mg, about 0.5 mg, about 0.07 mg, about 0.1 mg, about 0.2 mg, about 0.3 mg, about 0.35 mg, about 0.375 mg, about 0.4 mg, about 0.5 mg, about 0.6 mg, about 0.7 mg, about 0.75 mg, about 0.8 mg, about 0.9 mg, about 1 mg, about 1.3 mg, about 1.4 mg, about 1.5 mg, about 1.8 mg, about 1.9 mg, about 2 mg, about 2.4 mg, about 3 mg, about 5 mg, about 6 mg, about 7 mg, about 12 mg, about 18 mg or about 60 mg more of chlorotoxin conjugate. In some aspects, the dosing interval (τ) includes by way of example but is not limited to, about 12 hours, about 24 hours, about 36 hours, about 48 hours or about 72 hours before surgery.
[0200] The pharmacokinetics parameters are any parameters suitable for describing the plasma or serum profiles of chlorotoxin conjugates described herein. In some aspects, the area under curve (AUC) includes by way of example but is not limited to, not less than about 50 hr*ng / mL, not less than about 75 hr*ng / mL, not less than about 100 hr*ng / mL, not less than about 125 hr*ng / mL, not less than about 150 hr*ng / mL, not less than about 175 hr*ng / mL, not less than about 200 hr*ng / mL, not less than about 250 hr*ng / mL, not less than about 300 hr*ng / mL, not less than about 350 hr*ng / mL, not less than about 400 hr*ng / mL, not less than about 500 hr*ng / mL, not less than about 600 hr*ng / mL, not less than about 700 hr*ng / mL, not less than about 800 hr*ng / mL, not less than about 900 hr*ng / mL, not less than about 1000 hr*ng / mL, not less than about 2000 hr*ng / mL, not less than about 3000 hr*ng / mL, not less than about 4000 hr*ng / mL, not less than about 5000 hr*ng / mL, not less than about 6000 hr*ng / mL, not less than about 7000 hr*ng / mL, not less than about 8000 hr*ng / mL, not less than about 9000 hr*ng / mL, not less than about 10000 hr*ng / mL, not less than about 11000 hr*ng / mL, not less than about 12000 hr*ng / mL, not less than about 13000 hr*ng / mL, not less than about 14000 hr*ng / mL, not less than about 15000 hr*ng / mL, not less than about 16000 hr*ng / mL, not less than about 17000 hr*ng / mL, not less than about 18000 hr*ng / mL, not less than about 19000 hr*ng / mL, not less than about 20000 hr*ng / mL, not less than about 21000 hr*ng / mL, not less than about 22000 hr*ng / mL, not less than about 23000 hr*ng / mL, not less than about 24000 hr*ng / mL, not less than about 25000 hr*ng / mL, not less than about 26000 hr*ng / mL, not less than about 27000 hr*ng / mL, not less than about 28000 hr*ng / mL, not less than about 29000 hr*ng / mL, not less than about 30000 hr*ng / mL, not less than about 31000 hr*ng / mL, not less than about 32000 hr*ng / mL, not less than about 33000 hr*ng / mL, not less than about 34000 hr*ng / mL, not less than about 35000 hr*ng / mL, not less than about 40000 hr*ng / mL not less than about 45000 hr*ng / mL not less than about 50000 hr*ng / mL not less than about 55000 hr*ng / mL not less than about 60000 hr*ng / mL not less than about 65000 hr*ng / mL not less than about 70000 hr*ng / mL not less than about 75000 hr*ng / mL not less than about 80000 hr*ng / mL not less than about 85000 hr*ng / mL not less than about 90000 hr*ng / mL not less than about 95000 hr*ng / mL not less than about 100000 hr*ng / mL not less than about 125000 hr*ng / mL not less than about 150000 hr*ng / mL not less than about 175000 hr*ng / mL not less than about 200000 hr*ng / mL not less than about 250000 hr*ng / mL not less than about 300000 hr*ng / mL not less than about 350000 hr*ng / mL not less than about 400000 hr*ng / mL not less than about 450000 hr*ng / mL not less than about 500000 hr*ng / mL not less than about 550000 hr*ng / mL not less than about 600000 hr*ng / mL not less than about 650000 hr*ng / mL not less than about 700000 hr*ng / mL not less than about 750000 hr*ng / mL not less than about 800000 hr*ng / mL not less than about 850000 hr*ng / mL not less than about 900000 hr*ng / mL not less than about 950000 hr*ng / mL not less than about 1000000 hr*ng / mL not less than about 1100000 hr*ng / mL not less than about 1200000 hr*ng / mL not less than about 1300000 hr*ng / mL not less than about 1400000 hr*ng / mL not less than about 1500000 hr*ng / mL not less than about 1600000 hr*ng / mL not less than about 1700000 hr*ng / mL not less than about 1800000 hr*ng / mL not less than about 1900000 hr*ng / mL not less than about 2000000 hr*ng / mL or any other AUC appropriate for describing a pharmacokinetic profile of a chlorotoxin conjugate described herein.
[0201] The AUC of a chlorotoxin described herein by way of example can be, but is not limited to, about 1,000 hr*ng / mL to about 1,250 hr*ng / mL; about 1,250 hr*ng / mL to about 1,500 hr*ng / mL; about 1,500 hr*ng / mL to about 1,750 hr*ng / mL; about 1,750 hr*ng / mL to about 2,000 hr*ng / mL; about 2,000 hr*ng / mL to about 2,500 hr*ng / mL; about 2,500 hr*ng / mL to about 3,000 hr*ng / mL; about 3,000 hr*ng / mL to about 3,500 hr*ng / mL; about 3,500 hr*ng / mL to about 4,000 hr*ng / mL; about 4,000 hr*ng / mL to about 4,500 hr*ng / mL; about 4,500 hr*ng / mL to about 5,000 hr*ng / mL; about 5,000 hr*ng / mL to about 5,500 hr*ng / mL; about 5,500 hr*ng / mL to about 6,000 hr*ng / mL; about 6,000 hr*ng / mL to about 6,500 hr*ng / mL; about 6,500 hr*ng / mL to about 7,000 hr*ng / mL; about 7,000 hr*ng / mL to about 7,500 hr*ng / mL; about 7,500 hr*ng / mL to about 8,000 hr*ng / mL; about 8,000 hr*ng / mL to about 8,500 hr*ng / mL; about 8,500 hr*ng / mL to about 9,000 hr*ng / mL; about 9,000 hr*ng / mL to about 9,500 hr*ng / mL; about 9,500 hr*ng / mL to about 10,000 hr*ng / mL; about 10,000 hr*ng / mL to about 20,000 hr*ng / mL; about 20,000 hr*ng / mL to about 30,000 hr*ng / mL; about 30,000 hr*ng / mL to about 40,000 hr*ng / mL; about 40,000 hr*ng / mL to about 50,000 hr*ng / mL; about 50,000 hr*ng / mL to about 60,000 hr*ng / mL; about 60,000 hr*ng / mL to about 70,000 hr*ng / mL; about 70,000 hr*ng / mL to about 80,000 hr*ng / mL; about 80,000 hr*ng / mL to about 90,000 hr*ng / mL; about 90,000 hr*ng / mL to about 100,000 hr*ng / mL; about 100,000 hr*ng / mL to about 150,000 hr*ng / mL; about 150,000 hr*ng / mL to about 200,000 hr*ng / mL; about 200,000 hr*ng / mL to about 250,000 hr*ng / mL; about 250,000 hr*ng / mL to about 300,000 hr*ng / mL; about 300,000 hr*ng / mL to about 350,000 hr*ng / mL; about 350,000 hr*ng / mL to about 400,000 hr*ng / mL; about 400,000 hr*ng / mL to about 450,000 hr*ng / mL; about 450,000 hr*ng / mL to about 500,000 hr*ng / mL; about 500,000 hr*ng / mL to about 550,000 hr*ng / mL; about 550,000 hr*ng / mL to about 600,000 hr*ng / mL; about 600,000 hr*ng / mL to about 650,000 hr*ng / mL; about 650,000 hr*ng / mL to about 700,000 hr*ng / mL; about 700,000 hr*ng / mL to about 750,000 hr*ng / mL; about 750,000 hr*ng / mL to about 800,000 hr*ng / mL; about 800,000 hr*ng / mL to about 850,000 hr*ng / mL; about 850,000 hr*ng / mL to about 900,000 hr*ng / mL; about 900,000 hr*ng / mL to about 950,000 hr*ng / mL; about 950,000 hr*ng / mL to about 1,000,000 hr*ng / mL; about 1,000,000 hr*ng / mL to about 1,100,000 hr*ng / mL; about 1,100,000 hr*ng / mL to about 1,200,000 hr*ng / mL; about 1,200,000 hr*ng / mL to about 1,300,000 hr*ng / mL; about 1,300,000 hr*ng / mL to about 1,400,000 hr*ng / mL; about 1,40,000 hr*ng / mL to about 1,500,000 hr*ng / mL; or about 1,50,000 hr*ng / mL to about 2,000,000 hr*ng / mL.
[0202] The pharmacokinetic parameters is any parameters suitable for describing a chlorotoxin conjugate described herein. The C max includes by way of example but is not limited to not less than about 1 ng / mL; not less than about 5 ng / mL; not less than about 10 ng / mL; not less than about 15 ng / mL; not less than about 20 ng / mL; not less than about 25 ng / mL; not less than about 50 ng / mL; not less than about 75 ng / mL; not less than about 100 ng / mL; not less than about 200 ng / mL; not less than about 300 ng / mL; not less than about 400 ng / mL; not less than about 500 ng / mL; not less than about 600 ng / mL; not less than about 700 ng / mL; not less than about 800 ng / mL; not less than about 900 ng / mL; not less than about 1000 ng / mL; not less than about 1250 ng / mL; not less than about 1500 ng / mL; not less than about 1750 ng / mL; not less than about 2000 ng / mL; not less than about 2100 ng / mL; not less than about 2200 ng / mL; not less than about 2300 ng / mL; not less than about 2400 ng / mL; not less than about 2500 ng / mL; not less than about 2600 ng / mL; not less than about 2700 ng / mL; not less than about 2800 ng / mL; not less than about 2900 ng / mL; not less than about 3000 ng / mL; not less than about 3100 ng / mL; not less than about 32000 ng / mL; not less than about 3300 ng / mL; not less than about 3400 ng / mL; not less than about 3500 ng / mL; not less than about 3600 ng / mL; not less than about 3700 ng / mL; not less than about 3800 ng / mL; not less than about 3900 ng / mL; not less than about 4000 ng / mL; not less than about 4500 ng / mL; not less than about 5000 ng / mL; not less than about 5500 ng / mL; not less than about 6000 ng / mL; not less than about 6500 ng / mL; not less than about 2700 ng / mL; not less than about 7500 ng / mL; not less than about 8000 ng / mL; not less than about 8500 ng / mL; not less than about 9000 ng / mL; not less than about 9500 ng / mL; not less than about 10000 ng / mL; not less than about 11000 ng / mL; not less than about 12000 ng / mL; not less than about 13000 ng / mL; not less than about 14000ng / mL; not less than about 15000 ng / mL; not less than about 16000 ng / mL; not less than about 17000 ng / mL; not less than about 18000 ng / mL; not less than about 19000 ng / mL; not less than about 20000 ng / mL; not less than about 25000 ng / mL; not less than about 30000 ng / mL; not less than about 35000 ng / mL; not less than about 40000 ng / mL; not less than about 45000 ng / mL; not less than about 50000 ng / mL; not less than about 55000 ng / mL; not less than about 60000 ng / mL; not less than about 65000ng / mL; not less than about 70000 ng / mL; not less than about 750000 ng / mL; not less than about 80000 ng / mL; not less than about 85000 ng / mL; not less than about 90000 ng / mL; not less than about 95000 ng / mL; not less than about 100000 ng / mL; or any other C max appropriate for describing a pharmacokinetic profile of a chlorotoxin conjugate described herein. The C max is, for example, about 1 ng / mL to about 100,000 ng / mL; about 1 ng / mL to about 95,00 ng / mL; about 1 ng / mL to about 90,000 ng / mL; about 1 ng / mL to about 8500 ng / mL; about 1 ng / mL to about 80000 ng / mL; about 1 ng / mL to about 7500 ng / mL; about 1 ng / mL to about 70,000 ng / mL; about 1 ng / mL to about 65 00 ng / mL; about 1 ng / mL to about 60,000 ng / mL; about 1 ng / mL to about 55000 ng / mL; about 1 ng / mL to about 50000 ng / mL; about 1 ng / mL to about 40000 ng / mL; about 1 ng / mL to about 30000 ng / mL; about 1 ng / mL to about 20000 ng / mL; about 1 ng / mL to about 10000 ng / mL; about 1 ng / mL to about 5000 ng / mL; about 1 ng / mL to about 1000 ng / mL; about 1 ng / mL to about 500 ng / mL; about 1 ng / mL to about 500 ng / mL; about 1 ng / mL to about 1000 ng / mL; about 1 ng / mL to about 5000 ng / mL; about 10000 ng / mL to about 5,000 ng / mL; about 10 ng / mL to about 7,000 ng / mL; about 10 ng / mL to about 10,000 ng / mL; about 10 ng / mL to about 10,500 ng / mL; about 10 ng / mL to about 100,000 ng / mL; about 10 ng / mL to about 90000 ng / mL; about 10 ng / mL to about 80000 ng / mL; about 10 ng / mL to about 70000 ng / mL; about 10 ng / mL to about 60000 ng / mL; about 10 ng / mL to about 50000 ng / mL; about 10 ng / mL to about 40000 ng / mL; about 10 ng / mL to about 30000 ng / mL; about 10 ng / mL to about 20000 ng / mL; about 10 ng / mL to about 10000 ng / mL; about 10 ng / mL to about 5000 ng / mL; about 25000 ng / mL to about 50000 ng / mL; about 250 ng / mL to about 10000 ng / mL; about 500 ng / mL to about 50000 ng / mL; about 50 ng / mL to about 10000 ng / mL; about 100 ng / mL to about 50000 ng / mL; about 100 ng / mL to about 40000 ng / mL; about 100 ng / mL to about 30000 ng / mL; or about 100 ng / mL to about 20000 ng / mL.
[0203] The plasma concentration of a chlorotoxin conjugate described herein includes by way of example but is not limited to, not less than about 1 ng / mL, not less than about 2 ng / mL, not less than about 3 ng / mL, not less than about 4 ng / mL, not less than about 5 ng / mL, not less than about 6 ng / mL, not less than about 7 ng / mL, not less than about 8 ng / mL, not less than about 9 ng / mL, not less than about 10 ng / mL, not less than about 11 ng / mL, not less than about 12 ng / mL, not less than about 13 ng / mL, not less than about 14 ng / mL, not less than about 15 ng / mL, not less than about 16 ng / mL, not less than about 17 ng / mL, not less than about 18 ng / mL, not less than about 19 ng / mL, not less than about 20 ng / mL, not less than about 21 ng / mL, not less than about 22 ng / mL, not less than about 23 ng / mL, not less than about 24 ng / mL, not less than about 25 ng / mL, not less than about 26 ng / mL, not less than about 27 ng / mL, not less than about 28 ng / mL, not less than about 29 ng / mL, not less than about 30 ng / mL, not less than about 31 ng / mL, not less than about 32 ng / mL, not less than about 33 ng / mL, not less than about 34 ng / mL, not less than about 35 ng / mL, not less than about 36 ng / mL, not less than about 37 ng / mL, not less than about 38 ng / mL, not less than about 39 ng / mL, not less than about 40 ng / mL, not less than about 41 ng / mL, not less than about 42 ng / mL, not less than about 43 ng / mL, not less than about 44 ng / mL, not less than about 45 ng / mL, not less than about 46 ng / mL, not less than about 47 ng / mL, not less than about 48 ng / mL, not less than about 49 ng / mL, not less than about 50 ng / mL, not less than about 51 ng / mL, not less than about 52 ng / mL, not less than about 53 ng / mL, not less than about 54 ng / mL, not less than about 55 ng / mL, not less than about 56 ng / mL, not less than about 57 ng / mL, not less than about 58 ng / mL, not less than about 59 ng / mL, not less than about 60 ng / mL, not less than about 61 ng / mL, not less than about 62 ng / mL, not less than about 63 ng / mL, not less than about 64 ng / mL, not less than about 65 ng / mL, not less than about 66 ng / mL, not less than about 67 ng / mL, not less than about 68 ng / mL, not less than about 69 ng / mL, not less than about 70 ng / mL, not less than about 71 ng / mL, not less than about 72 ng / mL, not less than about 73 ng / mL, not less than about 74 ng / mL, not less than about 75 ng / mL, not less than about 76 ng / mL, not less than about 77 ng / mL, not less than about 78 ng / mL, not less than about 79 ng / mL, not less than about 80 ng / mL, not less than about 81 ng / mL, not less than about 82 ng / mL, not less than about 83 ng / mL, not less than about 84 ng / mL, not less than about 85 ng / mL, not less than about 86 ng / mL, not less than about 87 ng / mL, not less than about 88 ng / mL, not less than about 89 ng / mL, not less than about 90 ng / mL, not less than about 91 ng / mL, not less than about 92 ng / mL, not less than about 93 ng / mL, not less than about 94 ng / mL, not less than about 95 ng / mL, not less than about 96 ng / mL, not less than about 97 ng / mL, not less than about 98 ng / mL, not less than about 99 ng / mL, not less than about 100 ng / mL, not less than about 105 ng / mL, not less than about 110 ng / mL, not less than about 115 ng / mL, not less than about 120 ng / mL, not less than about 125 ng / mL, not less than about 130 ng / mL, not less than about 135 ng / mL, not less than about 140 ng / mL, not less than about 145 ng / mL, not less than about 150 ng / mL, not less than about 155 ng / mL, not less than about 160 ng / mL, not less than about 165 ng / mL, not less than about 170 ng / mL, not less than about 175 ng / mL, not less than about 180 ng / mL, not less than about 185 ng / mL, not less than about 190 ng / mL, not less than about 195 ng / mL, not less than about 200 ng / mL, not less than about 205 ng / mL, not less than about 210 ng / mL, not less than about 215 ng / mL, not less than about 220 ng / mL, not less than about 225 ng / mL, not less than about 230 ng / mL, not less than about 235 ng / mL, not less than about 240 ng / mL, not less than about 245 ng / mL, not less than about 250 ng / mL, or any other plasma concentration of a chlorotoxin conjugate described herein.
[0204] The plasma concentration includes by way of example but is not limited to, about 1 ng / mL to about 2ng / mL; about 1 ng / mL to about 5 ng / mL; about 5 ng / mL to about 10 ng / mL; about 10 ng / mL to about 25 ng / mL; about 25 ng / mL to about 50 ng / mL; about 50 ng / mL to about 75 ng / mL; about 75 ng / mL to about 100 ng / mL; about 100 ng / mL to about 150 ng / mL; about 100 ng / mL to about 200 ng / mL about 150 ng / mL to about 200 ng / mL; about 200 ng / mL to about 250 ng / mL; about 250 ng / mL to about 300 ng / mL; about 300 ng / mL to about 350 ng / mL; about 350 ng / mL to about 400 ng / mL; about 400 ng / mL to about 450 ng / mL; about 450 ng / mL to about 500 ng / mL; about 500 ng / mL to about 600 ng / mL; about 600 ng / mL to about 700 ng / mL; about 700 ng / mL to about 800 ng / mL; about 800 ng / mL to about 900 ng / mL; about 900 ng / mL to about 1,000 ng / mL; about 1,000 ng / mL to about 1,100 ng / mL; about 1,100 ng / mL to about 1,200 ng / mL; about 1,200 ng / mL to about 1,300 ng / mL; about 1,300 ng / mL to about 1,400 ng / mL; about 1,400 ng / mL to about 1,500 ng / mL; about 1,500 ng / mL to about 1,600 ng / mL; about 1,600 ng / mL to about 1,700 ng / mL; about 1,700 ng / mL to about 1,800 ng / mL; about 1,800 ng / mL to about 1,900 ng / mL; about 1,900 ng / mL to about 2,000 ng / mL; about 2,000 ng / mL to about 3,000 ng / mL; about 3,000 ng / mL to about 4,000 ng / mL; about 4,000 ng / mL to about 5,000 ng / mL; about 5,000 ng / mL to about 6,000 ng / mL; about 6,000 ng / mL to about 7,000 ng / mL; about 7,000 ng / mL to about 8,000 ng / mL; about 8,000 ng / mL to about 9,000 ng / mL; or about 9,000 ng / mL to about 10,000 ng / mL.
[0205] The T max of a chlorotoxin conjugate described herein includes by way of example but is not limited to, not greater than about 0.5 minutes, not greater than about 1 minutes, not greater than about 1.5 minutes, not greater than about 2 minutes, not greater than about 2.5 minutes, not greater than about 3 minutes, not greater than about 3.5 minutes, not greater than about 4 minutes, not greater than about 4.5 minutes, not greater than about 5 minutes, or any other T max appropriate for describing a pharmacokinetic profile of a chlorotoxin conjugate described herein. The T max further includes by way of example but is not limited to about 0.1 minutes to about 24 minutes; about 0.1 minutes to about 0.5 minutes; about 0.5 minutes to about 1 minute; about 1 minute to about 1.5 minutes; about 1.5 minutes to about 2 minute; about 2 minutes to about 2.5 minutes; about 2.5 minutes to about 3 minutes; about 3 minutes to about 3.5 minutes; about 3.5 minutes to about 4 minutes; about 4 minutes to about 4.5 minutes; about 4.5 minutes to about 5 minutes; about 5 minutes to about 5.5 minutes; about 5.5 minutes to about 6 minutes; about 6 minutes to about 6.5 minutes; about 6.5 minutes to about 7 minutes; about 7 minutes to about 7.5 minutes; about 7.5 minutes to about 8 minutes; about 8 minutes to about 8.5 minutes; about 8.5 minutes to about 9 minutes; about 9 minutes to about 9.5 minutes; about 9.5 minutes to about 10 minutes; about 10 minutes to about 10.5 minutes; about 10.5 minutes to about 11 minutes; about 11 minutes to about 11.5 minutes; about 11.5 minutes to about 12 minutes; about 12 minutes to about 12.5 minutes; about 12.5 minutes to about 13 minutes; about 13 minutes to about 13.5 minutes; about 13.5 minutes to about 14 minutes; about 14 minutes to about 14.5 minutes; about 14.5 minutes to about 15 minutes; about 15 minutes to about 15.5 minutes; about 15.5 minutes to about 16 minutes; about 16 minutes to about 16.5 minutes; about 16.5 minutes to about 17 minutes; about 17 minutes to about 17.5 minutes; about 17.5 minutes to about 18 minutes; about 18 minutes to about 18.5 minutes; about 18.5 minutes to about 19 minutes; about 19 minutes to about 19.5 minutes; about 19.5 minutes to about 20 minutes; about 20 minutes to about 20.5 minutes; about 20.5 minutes to about 21 minutes; about 21 minutes to about 21.5 minutes; about 21.5 minutes to about 22 minutes; about 22 minutes to about 22.5 minutes; about 22.5 minutes to about 23 minutes; about 23 minutes to about 23.5 minutes; about 23.5 minutes to about 24 minutes; about 24 minutes to about 25 minutes; about 25 minutes to about 25.5 minutes; about 25.5 minutes to about 26 minutes; about 26 minutes to about 26.5 minutes; about 26.5 minutes to about 27 minutes; about 27 minutes to about 28 minutes; about 28 minutes to about 28.5 minutes; about 28.5 minutes to about 29 minutes; about 29 minutes to about 29.5 minutes; about 29.5 minutes to about 30 minutes; about 30 minutes to about 31 minutes; about 31 minutes to about 31.5 minutes; about 31.5 minutes to about 32 minutes; about 32 minutes to about 32.5 minutes; about 32.5 minutes to about 33 minutes; about 33 minutes to about 34 minutes; about 34 minutes to about 35 minutes; about 35 minutes to about 36 minutes; about 36 minutes to about 37 minutes; about 37 minutes to about 38 minutes; about 38 minutes to about 39 minutes; about 39 minutes to about 40 minutes; about 40 minutes to about 41 minutes; about 41 minutes to about 42 minutes; about 42 minutes to about 43 minutes; about 43 minutes to about 44 minutes; about 45 minutes to about 46 minutes; about 46 minutes to about 47 minutes; about 47 minutes to about 48 minutes; about 48 minutes to about 49 minutes; about 49 minutes to about 50 minutes; about 50 minutes to about 51 minutes; about 51 minutes to about 52 minutes; about 52 minutes to about 53 minutes; about 53 minutes to about 55 minutes; about 55 minutes to about 56 minutes; about 56 minutes to about 57 minutes; about 57 minutes to about 58 minutes; about 58 minutes to about 59 minutes; about 59 minutes to about 60 minutes; or any other T max of a chlorotoxin conjugate described herein of a chlorotoxin conjugate described herein.
[0206] The T max of a chlorotoxin conjugate described herein includes by way of example but is not limited to, not greater than about 0.5 hours, not greater than about 1 hours, not greater than about 1.5 hours, not greater than about 2 hours, not greater than about 2.5 hours, not greater than about 3 hours, not greater than about 3.5 hours, not greater than about 4 hours, not greater than about 4.5 hours, not greater than about 5 hours, or any other T max appropriate for describing a pharmacokinetic profile of a chlorotoxin conjugate described herein. The T max further includes by way of example but is not limited to about 0.1 hours to about 24 hours; about 0.1 hours to about 0.5 hours; about 0.5 hours to about 1 hour; about 1 hour to about 1.5 hours; about 1.5 hours to about 2 hour; about 2 hours to about 2.5 hours; about 2.5 hours to about 3 hours; about 3 hours to about 3.5 hours; about 3.5 hours to about 4 hours; about 4 hours to about 4.5 hours; about 4.5 hours to about 5 hours; about 5 hours to about 5.5 hours; about 5.5 hours to about 6 hours; about 6 hours to about 6.5 hours; about 6.5 hours to about 7 hours; about 7 hours to about 7.5 hours; about 7.5 hours to about 8 hours; about 8 hours to about 8.5 hours; about 8.5 hours to about 9 hours; about 9 hours to about 9.5 hours; about 9.5 hours to about 10 hours; about 10 hours to about 10.5 hours; about 10.5 hours to about 11 hours; about 11 hours to about 11.5 hours; about 11.5 hours to about 12 hours; about 12 hours to about 12.5 hours; about 12.5 hours to about 13 hours; about 13 hours to about 13.5 hours; about 13.5 hours to about 14 hours; about 14 hours to about 14.5 hours; about 14.5 hours to about 15 hours; about 15 hours to about 15.5 hours; about 15.5 hours to about 16 hours; about 16 hours to about 16.5 hours; about 16.5 hours to about 17 hours; about 17 hours to about 17.5 hours; about 17.5 hours to about 18 hours; about 18 hours to about 18.5 hours; about 18.5 hours to about 19 hours; about 19 hours to about 19.5 hours; about 19.5 hours to about 20 hours; about 20 hours to about 20.5 hours; about 20.5 hours to about 21 hours; about 21 hours to about 21.5 hours; about 21.5 hours to about 22 hours; about 22 hours to about 22.5 hours; about 22.5 hours to about 23 hours; about 23 hours to about 23.5 hours; about 23.5 hours to about 24 hours; about 24 hours to about 25 hours; about 25 hours to about 25.5 hours; about 25.5 hours to about 26 hours; about 26 hours to about 26.5 hours; about 26.5 hours to about 27 hours; about 27 hours to about 28 hours; about 28 hours to about 28.5 hours; about 28.5 hours to about 29 hours; about 29 hours to about 29.5 hours; about 29.5 hours to about 30 hours; about 30 hours to about 31 hours; about 31 hours to about 31.5 hours; about 31.5 hours to about 32 hours; about 32 hours to about 32.5 hours; about 32.5 hours to about 33 hours; about 33 hours to about 34 hours; about 34 hours to about 35 hours; about 35 hours to about 36 hours; about 36 hours to about 37 hours; about 37 hours to about 38 hours; about 38 hours to about 39 hours; about 39 hours to about 40 hours; about 40 hours to about 41 hours; about 41 hours to about 42 hours; about 42 hours to about 43 hours; about 43 hours to about 44 hours; about 45 hours to about 46 hours; about 46 hours to about 47 hours; about 47 hours to about 48 hours; about 48 hours to about 49 hours; about 49 hours to about 50 hours; about 50 hours to about 51 hours; about 51 hours to about 52 hours; about 52 hours to about 53 hours; about 53 hours to about 55 hours; about 55 hours to about 56 hours; about 56 hours to about 57 hours; about 57 hours to about 58 hours; about 58 hours to about 59 hours; about 59 hours to about 60 hours; about 60 hours to about 61 hours; about 61 hours to about 62 hours; about 62 hours to about 63 hours; about 63 hours to about 64 hours; about 64 hours to about 66 hours; about 66 hours to about 67 hours; about 67 hours to about 68 hours; about 68 hours to about 69 hours; about 69 hours to about 70 hours; about 70 hours to about 71 hours; about 71 hours to about 72 hours; about 72 hours to about 73 hours; about 73 hours to about 74 hours; about 774hours to about 75 hours; about 75 hours to about 77 hours; about 77 hours to about 78 hours; about 78 hours to about 79 hours; about79 hours to about 80 hours; about 80 hours to about 81 hours; about 81 hours to about 82 hours; about 82 hours to about 83 hours; about 83 hours to about 84 hours; about 84 hours to about 85 hours; about 85 hours to about 87 hours; about 87 hours to about 88 hours; about 88 hours to about 89 hours; about 89 hours to about 90 hours; about 90 hours to about 91 hours; about 91 hours to about 92 hours; about 92 hours to about 93 hours; about 93 hours to about 94 hours; about 94 hours to about 95 hours; about 95 hours to about 97 hours; about 97 hours to about 99 hours; about 99 hours to about 100 hours; or any other T max of a chlorotoxin conjugate described herein of a chlorotoxin conjugate described herein.
[0207] In some aspects, the chlorotoxin conjugates distribute into the subject tissues. For example, distribution into the tissues is often rapid compared to the elimination phase. In some aspects, the chlorotoxin conjugates are eliminated from the subject tissues. For example, elimination from the subject tissues is often slow compared to the distribution phase. Often the kidney is important in the clearance and elimination of the chlorotoxin conjugates, often contributing to the elimination phase.
[0208] The pharmacokinetics parameters are any parameters suitable for describing the plasma profiles of chlorotoxin conjugates described herein and are often associated with a curve. As described elsewhere herein, dose is either scaled or fixed, said scaled dose useful for scaling the dose from one subject to another wherein the subjects are the same species, different species, same sex or different sex. The phases of the curve are often representative of data obtained from at least one subject, sometimes more than one subject, and the phases of the curve and / or data of the curve is often scaled in a manner similar to the manner in which doses are scaled.
[0209] In some aspects, the curve is plotted on a graph, often a graph with an x-axis and a y-axis referred to for example as an x-y plot, a scatter plot or the like. Each axis of the graph has units, the y-axis often having units of time, for example in hours, and x-axis often having units of concentration, for example as ng / mL, of a chlorotoxin conjugate described herein present in a subject sample as described herein and are representative of a single measurement, a mean, an average, or any other suitable mathematical calculation performed on a set of data. When a suitable mathematical calculation is performed, a statistic is also calculated, for example, a standard error, standard error of the mean, standard deviation, standard deviation of the mean, or any other suitable statistic useful for the described disclosure.
[0210] In some aspects, the curve has phases, for example, distribution phase, metabolism phase and elimination phase. In some aspects, the distribution phase begins at time of about 0 hours and extends until a time of about 0.01 hours, about 0.02 hours, about 0.03 hours, about 0.04 hours, about 0.05 hours, about 0.06 hours, about 0.07 hours, about 0.08 hours, about 0.09 hours, about 0.11 hours, about 0.12 hours, about 0.13 hours, about 0.14 hours, about 0.15 hours, about 0.16 hours, about 0.17 hours, about 0.18 hours, about 0.19 hours, about 0.20 hours, 0.21 hours, about 0.22 hours, about 0.23 hours, about 0.24 hours, about 0.25 hours, about 0.26 hours, about 0.27 hours, about 0.28 hours, about 0.29 hours, about 0.30 hours, about 0.31 hours, about 0.32 hours, about 0.33 hours, about 0.34 hours, about 0.35 hours, about 0.36 hours, about 0.37 hours, about 0.38 hours, about 0.39 hours, about 0.40 hours, about 0.41 hours, about 0.42 hours, about 0.43 hours, about 0.44 hours, about 0.45 hours, about 0.46 hours, about 0.47 hours, about 0.48 hours, about 0.49 hours, about 0.50 hours, about 0.51 hours, about 0.52 hours, about 0.53 hours, about 0.54 hours, about 0.55 hours, about 0.56 hours, about 0.57 hours, about 0.58 hours, about 0.59 hours, about 0.60 hours, about 0.61 hours, about 0.62 hours, about 0.63 hours, about 0.64 hours, about 0.65 hours, about 0.66 hours, about 0.67 hours, about 0.68 hours, about 0.69 hours, about 0.70 hours, about 0.71 hours, about 0.72 hours, about 0.73 hours, about 0.74 hours, about 0.75 hours, about 0.76 hours, about 0.77 hours, about 0.78 hours, about 0.79 hours, about 0.80 hours, about 0.81 hours, about 0.82 hours, about 0.83 hours, about 0.84 hours, about 0.85 hours, about 0.86 hours, about 0.87 hours, about 0.88 hours, about 0.89 hours, about 0.90 hours, about 0.91 hours, about 0.92 hours, about 0.93 hours, about 0.94 hours, about 0.95 hours, about 0.96 hours, about 0.97 hours, about 0.98 hours, about 0.99 hours, about 1.00 hours, about 1.01 hours, about 1.02 hours, about 1.03 hours, about 1.04 hours, about 1.05 hours, about 1.06 hours, about 1.07 hours, about 1.08 hours, about 1.09 hours, about 1.11 hours, about 1.12 hours, about 1.13 hours, about 1.14 hours, about 1.15 hours, about 1.16 hours, about 1.17 hours, about 1.18 hours, about 1.19 hours, about 1.20 hours, 1.21 hours, about 1.22 hours, about 1.23 hours, about 1.24 hours, about 1.25 hours, about 1.26 hours, about 1.27 hours, about 1.28 hours, about 1.29 hours, about 1.30 hours, about 1.31 hours, about 1.32 hours, about 1.33 hours, about 1.34 hours, about 1.35 hours, about 1.36 hours, about 1.37 hours, about 1.38 hours, about 1.39 hours, about 1.40 hours, about 1.41 hours, about 1.42 hours, about 1.43 hours, about 1.44 hours, about 1.45 hours, about 1.46 hours, about 1.47 hours, about 1.48 hours, about 1.49 hours, about 1.50 hours, about 1.51 hours, about 1.52 hours, about 1.53 hours, about 1.54 hours, about 1.55 hours, about 1.56 hours, about 1.57 hours, about 1.58 hours, about 1.59 hours, about 1.60 hours, about 1.61 hours, about 1.62 hours, about 1.63 hours, about 1.64 hours, about 1.65 hours, about 1.66 hours, about 1.67 hours, about 1.68 hours, about 1.69 hours, about 1.70 hours, about 1.71 hours, about 1.72 hours, about 1.73 hours, about 1.74 hours, about 1.75 hours, about 1.76 hours, about 1.77 hours, about 1.78 hours, about 1.79 hours, about 1.80 hours, about 1.81 hours, about 1.82 hours, about 1.83 hours, about 1.84 hours, about 1.85 hours, about 1.86 hours, about 1.87 hours, about 1.88 hours, about 1.89 hours, about 1.90 hours, about 1.91 hours, about 1.92 hours, about 1.93 hours, about 1.94 hours, about 1.95 hours, about 1.96 hours, about 1.97 hours, about 1.98 hours, about 1.99 hours, about 2.00 hours, about 2.20 hours, about 2.40 hours, about 2.60 hours, about 2.80 hours, about 3.00 hours, about 4.20 hours, about 4.40 hours, about 4.60 hours, about 4.80 hours, about 5.00 hours, about 5.20 hours, about 5.40 hours, about 5.60 hours, about 5.80 hours, about 6.00 hours, about 6.20 hours, about 6.40 hours, about 6.60 hours, about 6.80 hours, about 7.00 hours, about 7.20 hours, about 7.40 hours, about 7.60 hours, about 7.80 hours, about 8.00 hours, about 8.20 hours, about 8.40 hours, about 8.60 hours, about 8.80 hours, about 9.00 hours, about 9.20 hours, about 9.40 hours, about 9.60 hours, about 9.80 hours, about 10.00 hours or more than about 10.00 hours.
[0211] In some aspects, the metabolism phase begins at time of about 0.5 hours and extends until a time of about about 0.50 hours, about 0.51 hours, about 0.52 hours, about 0.53 hours, about 0.54 hours, about 0.55 hours, about 0.56 hours, about 0.57 hours, about 0.58 hours, about 0.59 hours, about 0.60 hours, about 0.61 hours, about 0.62 hours, about 0.63 hours, about 0.64 hours, about 0.65 hours, about 0.66 hours, about 0.67 hours, about 0.68 hours, about 0.69 hours, about 0.70 hours, about 0.71 hours, about 0.72 hours, about 0.73 hours, about 0.74 hours, about 0.75 hours, about 0.76 hours, about 0.77 hours, about 0.78 hours, about 0.79 hours, about 0.80 hours, about 0.81 hours, about 0.82 hours, about 0.83 hours, about 0.84 hours, about 0.85 hours, about 0.86 hours, about 0.87 hours, about 0.88 hours, about 0.89 hours, about 0.90 hours, about 0.91 hours, about 0.92 hours, about 0.93 hours, about 0.94 hours, about 0.95 hours, about 0.96 hours, about 0.97 hours, about 0.98 hours, about 0.99 hours, about 1.00 hours, about 1.01 hours, about 1.02 hours, about 1.03 hours, about 1.04 hours, about 1.05 hours, about 1.06 hours, about 1.07 hours, about 1.08 hours, about 1.09 hours, about 1.11 hours, about 1.12 hours, about 1.13 hours, about 1.14 hours, about 1.15 hours, about 1.16 hours, about 1.17 hours, about 1.18 hours, about 1.19 hours, about 1.20 hours, 1.21 hours, about 1.22 hours, about 1.23 hours, about 1.24 hours, about 1.25 hours, about 1.26 hours, about 1.27 hours, about 1.28 hours, about 1.29 hours, about 1.30 hours, about 1.31 hours, about 1.32 hours, about 1.33 hours, about 1.34 hours, about 1.35 hours, about 1.36 hours, about 1.37 hours, about 1.38 hours, about 1.39 hours, about 1.40 hours, about 1.41 hours, about 1.42 hours, about 1.43 hours, about 1.44 hours, about 1.45 hours, about 1.46 hours, about 1.47 hours, about 1.48 hours, about 1.49 hours, about 1.50 hours, about 1.51 hours, about 1.52 hours, about 1.53 hours, about 1.54 hours, about 1.55 hours, about 1.56 hours, about 1.57 hours, about 1.58 hours, about 1.59 hours, about 1.60 hours, about 1.61 hours, about 1.62 hours, about 1.63 hours, about 1.64 hours, about 1.65 hours, about 1.66 hours, about 1.67 hours, about 1.68 hours, about 1.69 hours, about 1.70 hours, about 1.71 hours, about 1.72 hours, about 1.73 hours, about 1.74 hours, about 1.75 hours, about 1.76 hours, about 1.77 hours, about 1.78 hours, about 1.79 hours, about 1.80 hours, about 1.81 hours, about 1.82 hours, about 1.83 hours, about 1.84 hours, about 1.85 hours, about 1.86 hours, about 1.87 hours, about 1.88 hours, about 1.89 hours, about 1.90 hours, about 1.91 hours, about 1.92 hours, about 1.93 hours, about 1.94 hours, about 1.95 hours, about 1.96 hours, about 1.97 hours, about 1.98 hours, about 1.99 hours, about 2.00 hours, about 2.20 hours, about 2.40 hours, about 2.60 hours, about 2.80 hours, about 3.00 hours, about 4.20 hours, about 4.40 hours, about 4.60 hours, about 4.80 hours, about 5.00 hours, about 5.20 hours, about 5.40 hours, about 5.60 hours, about 5.80 hours, about 6.00 hours, about 6.20 hours, about 6.40 hours, about 6.60 hours, about 6.80 hours, about 7.00 hours, about 7.20 hours, about 7.40 hours, about 7.60 hours, about 7.80 hours, about 8.00 hours, about 8.20 hours, about 8.40 hours, about 8.60 hours, about 8.80 hours, about 9.00 hours, about 9.20 hours, about 9.40 hours, about 9.60 hours, about 9.80 hours, about 10.00 hours, about 10.20 hours, about 10.40 hours, about 10.60 hours, about 10.80 hours, about 12.00 hours, about 12.20 hours, about 12.40 hours, about 12.60 hours, about 12.80 hours, about 14.00 hours, about 14.20 hours, about 14.40 hours, about 14.60 hours, about 14.80 hours, about 16.00 hours, about 16.20 hours, about 16.40 hours, about 16.60 hours, about 16.80 hours, about 18.00 hours, about 18.20 hours, about 18.40 hours, about 18.60 hours, about 18.80 hours, about 20.00 hours, about 20.20 hours, about 20.40 hours, about 20.60 hours, about 20.80 hours, about 22.00 hours, about 22.20 hours, about 22.40 hours, about 22.60 hours, about 22.80 hours, about 24.00 hours, about 24.20 hours, about 24.40 hours, about 24.60 hours, about 24.80 hours, about 26.00 hours, about 26.20 hours, about 26.40 hours, about 26.60 hours, about 26.80 hours, about 28.00 hours, about 28.20 hours, about 28.40 hours, about 28.60 hours, about 28.80 hours, about 30 hours or more than about 30.00 hours.
[0212] In some aspects, the elimination phase begins at time of about 2 hours and extends until a time of about 2.00 hours, about 2.20 hours, about 2.40 hours, about 2.60 hours, about 2.80 hours, about 3.00 hours, about 4.20 hours, about 4.40 hours, about 4.60 hours, about 4.80 hours, about 5.00 hours, about 5.20 hours, about 5.40 hours, about 5.60 hours, about 5.80 hours, about 6.00 hours, about 6.20 hours, about 6.40 hours, about 6.60 hours, about 6.80 hours, about 7.00 hours, about 7.20 hours, about 7.40 hours, about 7.60 hours, about 7.80 hours, about 8.00 hours, about 8.20 hours, about 8.40 hours, about 8.60 hours, about 8.80 hours, about 9.00 hours, about 9.20 hours, about 9.40 hours, about 9.60 hours, about 9.80 hours, about 10.00 hours, about 10.20 hours, about 10.40 hours, about 10.60 hours, about 10.80 hours, about 12.00 hours, about 12.20 hours, about 12.40 hours, about 12.60 hours, about 12.80 hours, about 14.00 hours, about 14.20 hours, about 14.40 hours, about 14.60 hours, about 14.80 hours, about 16.00 hours, about 16.20 hours, about 16.40 hours, about 16.60 hours, about 16.80 hours, about 18.00 hours, about 18.20 hours, about 18.40 hours, about 18.60 hours, about 18.80 hours, about 20.00 hours, about 20.20 hours, about 20.40 hours, about 20.60 hours, about 20.80 hours, about 22.00 hours, about 22.20 hours, about 22.40 hours, about 22.60 hours, about 22.80 hours, about 24.00 hours, about 24.20 hours, about 24.40 hours, about 24.60 hours, about 24.80 hours, about 26.00 hours, about 26.20 hours, about 26.40 hours, about 26.60 hours, about 26.80 hours, about 28.00 hours, about 28.20 hours, about 28.40 hours, about 28.60 hours, about 28.80 hours, about 30.00 hours, about 30.20 hours, about 30.40 hours, about 30.60 hours, about 30.80 hours, about 32.00 hours, about 32.20 hours, about 32.40 hours, about 32.60 hours, about 32.80 hours, about 34.00 hours, about 34.20 hours, about 34.40 hours, about 34.60 hours, about 34.80 hours, about 36.00 hours, about 36.20 hours, about 36.40 hours, about 36.60 hours, about 36.80 hours, about 38.00 hours, about 38.20 hours, about 38.40 hours, about 38.60 hours, about 38.80 hours, about 40.00 hours, about 40.20 hours, about 40.40 hours, about 40.60 hours, about 40.80 hours, about 42.00 hours, about 42.20 hours, about 42.40 hours, about 42.60 hours, about 42.80 hours, about 44.00 hours, about 44.20 hours, about 44.40 hours, about 44.60 hours, about 44.80 hours, about 46.00 hours, about 46.20 hours, about 46.40 hours, about 46.60 hours, about 46.80 hours, about 48.00 hours, about 48.20 hours, about 48.40 hours, about 48.60 hours, about 48.80 hours, about 50.00 hours, about 50.20 hours, about 50.40 hours, about 50.60 hours, about 50.80 hours, about 52.00 hours, about 52.20 hours, about 52.40 hours, about 52.60 hours, about 52.80 hours, about 54.00 hours, about 54.20 hours, about 54.40 hours, about 54.60 hours, about 54.80 hours, about 56.00 hours, about 56.20 hours, about 56.40 hours, about 56.60 hours, about 56.80 hours, about 58.00 hours, about 58.20 hours, about 58.40 hours, about 58.60 hours, about 58.80 hours, about 60.00 hours, about 60.20 hours, about 60.40 hours, about 60.60 hours, about 60.80 hours, about 62.00 hours, about 62.20 hours, about 62.40 hours, about 62.60 hours, about 62.80 hours, about 64.00 hours, about 64.20 hours, about 64.40 hours, about 64.60 hours, about 64.80 hours, about 66.00 hours, about 66.20 hours, about 66.40 hours, about 66.60 hours, about 66.80 hours, about 68.00 hours, about 68.20 hours, about 68.40 hours, about 68.60 hours, about 68.80 hours, about 70.00 hours, about 70.20 hours, about 70.40 hours, about 70.60 hours, about 70.80 hours, about 72.00 hours, about 72.20 hours, about 72.40 hours, about 72.60 hours, about 72.80 hours, about 74.00 hours, about 74.20 hours, about 74.40 hours, about 74.60 hours, about 74.80 hours, about 76.00 hours, about 76.20 hours, about 76.40 hours, about 76.60 hours, about 76.80 hours, about 78.00 hours, about 78.20 hours, about 78.40 hours, about 78.60 hours, about 78.80 hours, about 80.00 hours, about 80.20 hours, about 80.40 hours, about 80.60 hours, about 80.80 hours, about 82.00 hours, about 82.20 hours, about 82.40 hours, about 82.60 hours, about 82.80 hours, about 84.00 hours, about 84.20 hours, about 84.40 hours, about 84.60 hours, about 84.80 hours, about 86.00 hours, about 86.20 hours, about 86.40 hours, about 86.60 hours, about 86.80 hours, about 88.00 hours, about 88.20 hours, about 88.40 hours, about 88.60 hours, about 88.80 hours, about 90.00 hours or about more than 90.00 hours.
[0213] In some aspects, a single fixed bolus dose intravenous chlorotoxin conjugate often results in mean serum concentrations measurable up to about 12 hours post-dose, about 24 hours post-dose, up to about 36 hours post-dose, up to about 48 hours post-dose or more than about 48 hours post-dose. Often, for subjects such as rats, C max and C 0 parameters increase in about a dose-proportional manner. In some aspects, the AUC 0-t parameter, for subjects such as rats, is about dose-proportional at less than about a 1 mg dose levels, and increases in a greater than dose-proportional manner at greater than about 1 mg dose levels. Often there is no effect of gender on any PK parameters for subjects such as rats. In some aspects, PK parameters are predictive in rats of a human subject.
[0214] In some aspects, a single fixed bolus dose intravenous chlorotoxin conjugate often results in mean serum concentrations measurable up to about 12 hours post-dose, about 24 hours post-dose, up to about 36 hours post-dose, up to about 48 hours post-dose or more than about 48 hours post-dose. Often, for subjects such as rats, C max and C 0 parameters increase in about a dose-proportional manner. In some aspects, the AUC 0-t parameter, for subjects such as monkeys, is greater than dose-proportional manner at greater than about 1 mg dose levels for example such that chlorotoxin conjugates exhibit reduced clearance at higher doses in monkeys. Often there is an effect of gender on PK parameters for subjects such as monkeys, for example, the C 0 and AUC are about 5 to about 30% higher in females relative to males.
[0215] As used herein, two pharmacokinetic profiles are "about equivalent" if they are defined by at least one parameter that is about equivalent between the two profiles. Non-limiting examples of such parameters include the area under plasma concentration over time curve (AUC) and the maximal plasma concentration reached following administration of a dose (C max ).
[0216] In some aspects two pharmacokinetic parameters are about equivalent if the lower value is greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95%, greater than 96%, greater than 97%, greater than 98%, or greater than 99% of the higher value.
[0217] The pharmacokinetic profiles of two dosage regimens are compared by determining the average pharmacokinetic profile in a population of subjects receiving the first dosage regimen, determining the average pharmacokinetic profile in a population of subjects receiving the second dosage regimen, and then comparing those two population dosage regimens. In some aspects, a population of subjects is one subject. In other aspects, a population of subjects is more than one subject, for example, two subjects, three subjects, four subjects, five subjects, six subjects, seven subjects, eight subjects, nine subjects, ten subjects, 11 subjects, 12 subjects, 13 subjects, 14 subjects, 15 subjects, 20 subjects, 25 subjects, 30 subjects, 35 subjects, 40 subjects, 45 subjects, 50 subjects, or more than 50 subjects.
[0218] In various aspects, the present disclosure provides a claimed compound for use in a method of administering to a human subject, the method comprising: intravenously administering to the human subject a dose of from 1 mg to 30 mg of the compound; and producing in the human subject an average maximum compound blood plasma concentration (average C max ) of at least from 110 ng / mL to 240 ng / mL per each 1 mg dosage of the compound administered.
[0219] In various aspects, the present disclosure provides a claimed compound for use in a method of detecting a cancer cell in a human subject, the method comprising: intravenously administering to the human subject a dose of from 1 mg to 30 mg of the compound; producing in the human subject an average maximum compound blood plasma concentration (average C max ) of at least from 110 ng / mL to 240 ng / mL per each 1 mg dosage of the compound administered; and detecting the presence or absence of the detectable label in the human subject, wherein the presence of the detectable label indicates the presence of the cancer cell.
[0220] In various aspects, the present disclosure provides a claimed compound for use in a method of diagnosing cancer in a human subject, the method comprising: intravenously administering to the human subject a dose of from 1 mg to 30 mg of the compound; producing in the human subject an average maximum compound blood plasma concentration (average C max ) of at least from 110 ng / mL to 240 ng / mL per each 1 mg dosage of the compound administered; and detecting the presence of absence of the detectable label in the human subject, wherein the presence of the detectable label indicates a diagnosis of cancer.
[0221] In various aspects, the present disclosure provides a claimed compound for use in a method of treating cancer in a human subject, the method comprising: intravenously administering to the human subject a dose of from 1 mg to 30 mg of the compound conjugated to a therapeutic agent; producing in the human subject an average maximum compound blood plasma concentration (average C max ) of at least from 110 ng / mL to 240 ng / mL per each 1 mg dosage of the compound administered; and reducing or improving a symptom or condition associated with cancer in the human subject. In some aspects, the human subject is in need thereof. In some aspects, the methods comprise administering a therapeutically effectie dose of the compound to the human subject.
[0222] In various aspects, the present disclosure provides a claimed compound for use in a method of administering to a human subject, the method comprising: administering to the human subject a dose of from 1 mg to 30 mg of the compound; and producing in the human subject pharmacokinetic profile of FIG. 27.
[0223] In some aspects, the average time (average T max ) at which the average C max is reached is at 5 ± 4 minutes following administration of the compound. In some aspects, the average time (average T 75 ) at which the average compound blood plasma concentration reaches 75% of the average C max (average C 75 ) is reached is at 8 ± 5 minutes following administration of the compound. In some aspects, the average time (average T 50 ) at which the average compound blood plasma concentration reaches 50% of the average C max (average C 50 ) is reached is at 20 ± 8 minutes following administration of the compound. In some aspects, the average time (average T 25 ) at which the average compound blood plasma concentration reaches 25% of the average C max (average C 25 ) is reached is at 30 ± 12 minutes following administration of the compound.
[0224] In some aspects, the methods further comprise producing in the human subject an average chlorotoxin polypeptide plasma area under the curve (average AUC) of from 50 hr*ng / mL to 120 hr*ng / mL per each 1 mg dosage of chlorotoxin polypeptide administered.
[0225] In some aspects, the methods further comprise producing in the human subject an average chlorotoxin polypeptide plasma area under the curve (average AUC) of from 60 hr*ng / mL to 110 hr*ng / mL per each 1 mg dosage of chlorotoxin polypeptide administered.
[0226] In some aspects, 75% of the average AUC occurs within 40 ± 15 minutes after administering the compound. In some aspects, 50% of the average AUC occurs within 21 ± 8 minutes after administering the compound. In some aspects, 25% of the average AUC occurs within 9 ± 5 minutes after administering the compound.
[0227] In various aspects, the present disclosure provides a claimed compound for use in a method for detecting a cancer cell in a subject, the method comprising administering the compound of the present disclosure; and detecting the presence or absence of the compound in the subject, wherein the presence of the compound indicates the presence of a cancer cell.
[0228] In some aspects, the method further comprises administering the compound as a part of a composition.
[0229] In some aspects, the cancer is selected from glioma, astrocytoma, medulloblastoma, choroids plexus carcinoma, ependymoma, brain tumor, neuroblastoma, adenocarcinoma, basal cell carcinoma, squamous cell carcinoma, head and neck cancer, lung cancer, breast cancer, intestinal cancer, pancreatic cancer, liver cancer, kidney cancer, sarcoma, osteosarcoma, rhabdomyosarcoma, Ewing's sarcoma, carcinoma, melanoma, ovarian cancer, cervical cancer, lymphoma, thyroid cancer, anal cancer, colo-rectal cancer, endometrial cancer, germ cell tumor, laryngeal cancer, multiple myeloma, prostate cancer, retinoblastoma, gastric cancer, testicular cancer, or Wilm's tumor. In some aspects, the cancer is selected from glioma, medulloblastoma, sarcoma, breast cancer, lung cancer, prostate cancer, or intestinal cancer. In some aspects, the cancer cell expresses a site to which native chlorotoxin binds.
[0230] In some aspects, the method comprises detecting the compound by fluorescence imaging.
[0231] In some aspects, the method further comprises differentiating a focus of a cancer that expresses a site to which native chlorotoxin binds from non-neoplastic tissue.
[0232] In some aspects, the method further comprises surgically removing from the subject a cancer cell that is detected.
[0233] In some aspects, the method further comprises determining the location of a cancer cell in the subject before surgically removing the cancer cell from the subject, during surgical removal of the cancer cell from the subject, after removing the cancer cell from the subject, or a combination thereof.
[0234] In various aspects, the present disclosure provides a claimed compound for use in a method of administering the compound to a subject, the method comprising administering a therapeutically effectie amount of the compound to the subject.
[0235] In some aspects, the subject is in need thereof.
[0236] In some aspects, a therapeutically effectie amount is a dosage sufficient for the detection of a cancer cell in the subject. In some aspects, the dosage is from 0.1 mg to 100 mg. In some aspects, dosage is from 1 mg to 30 mg. In some aspects, the dosage is from 3 mg to 30 mg.
[0237] In various aspects, the present disclosure provides a claimed compound for use in a method of treating a subject in need thereof, the method comprising administering to the subject the compound further comprising a therapeutic agent in an amount sufficient to treat cancer in the subject. In certain aspects, the therapeutic agent is a cytotoxic agent.
[0238] In some aspects, the cancer is selected from glioma, astrocytoma, medulloblastoma, choroids plexus carcinoma, ependymoma, brain tumor, neuroblastoma, head and neck cancer, lung cancer, breast cancer, intestinal cancer, pancreatic cancer, liver cancer, kidney cancer, sarcoma, osteosarcoma, rhabdomyosarcoma, Ewing's sarcoma, carcinoma, melanoma, ovarian cancer, cervical cancer, lymphoma, thyroid cancer, anal cancer, colo-rectal cancer, endometrial cancer, germ cell tumor, laryngeal cancer, multiple myeloma, prostate cancer, retinoblastoma, gastric cancer, testicular cancer, or Wilm's tumor. In some aspects, the cancer cell is selected from glioma, medulloblastoma, sarcoma, prostate cancer, or intestinal cancer. In certain aspects, the cancer cell expresses a site to which native chlorotoxin binds. In further aspects, the binding is selective.
[0239] In some aspects, the compound is administered parenterally. In other aspects, the compound is administered intravenously. In still other aspects, the compound is administered subcutaneously.Methods for Analysis to Generate Pharmacokinetic Profiles
[0240] In some aspects, samples are analyzed to obtain parameters useful to determine a pharmacokinetic profile. Often the samples are diluted, for example, using a buffer or pharmaceutically acceptable carrier as defined herein.
[0241] Pharmacokinetic standard curves are often generated using a chlorotoxin conjugate, serum and a pharmaceutical carrier as described herein. The proportion of each chlorotoxin conjugate, concentrated source of sample (for example serum, urine, etc.) and pharmaceutical carrier often differs, for example, the concentration of compound of the present disclosure is often between about10 µg / mL and about 4 ng / mL. Often the standard curve is used to calculate the concentration of the compound in the sample.
[0242] In some aspects, pharmacokinetic parameters, or pharmacokinetic data are analyzed using standard pharmacokinetic data analysis methods, including concentration of chlorotoxin conjugates versus time. For example, a software program, such as Phoenix WinNonlin 6.3 is used to analyze pharmacokinetics data. In some aspects, the pharmacokinetic data analysis uses standard noncompartmental methods of intravenous bolus, intravenous infusion, or extravascular input as appropriate. In other aspects, the pharmacokinetic data analysis uses nonstandard noncompartmental methods of intravenous bolus, intravenous infusion, or extravascular input as appropriate. Often, the data are analyzed by the mean serum concentration versus time. The data are also analyzed by individual subject followed by group summary statistics.
[0243] Pharmacokinetic profiles of the compositions described herein are often obtained using at least one, sometimes more than one bioanalytical method. In some aspects, bioanalytical methods include the addition of chemicals to a sample containing a composition of which the pharmacokinetic profile is desired. Addition of the chemical to the sample often comprises performing a chemical technique to measure the concentration of a composition or a metabolite thereof in a sample or, sometimes, in a biological matrix. For example, microscale thermophoresis, mass spectrometry often including liquid chromatorgraph and a triple quadropole mass spectrometer, tandem mass spectrometry, high sensitivity mass spectrometry for microdosing studeies and the like are often performed.
[0244] The disclosure further describes a compound or composition as claimed for use in a method of administration to a subject, often methods include intravenous administration of a chlorotoxin conjugate composition to a subject. In some aspects, the method of administering a chlorotoxin polypeptide to a subject comprises intravenously administering a dose of from 0.8 to 25 mg of the chlorotoxin polypeptide to the subject; producing in the subject an average chlorotoxin polypeptide plasma area under the curve (average AUC) of from 50 to 120 per each 1 mg dosage of chlorotoxin polypeptide administered; and producing in the subject an average maximum chlorotoxin peptide blood plasma concentration (average C max ) of at least from 110 to 240 per each 1 mg dosage of chlorotoxin peptide administered. In some aspects, the chlorotoxin polypeptide is conjugated to a fluorescent agent.
[0245] The disclosure further describes a composition as claimed for use in a method of treating and / or detecting cancer with the composition following administration to a subject or contacting tumor tissue isolated from a subject, often the methods include intravenous administration of a chlorotoxin conjugate composition to a subject, in vivo contact of a tumor tissue or ex vivo contact of a tumor tissue from a subject. In some aspects, the method treating and / or detecting cancer with chlorotoxin conjugate compositions following administration to a subject or contacting tumor tissue isolated from a subject, often the methods include intravenous administration of a chlorotoxin conjugate composition to a subject, in vivo contact of a tumor tissue or ex vivo contact of a tumor tissue from a subject comprises intravenously administering a dose of from 0.8 to 25 mg of the chlorotoxin polypeptide to the subject; producing in the subject an average chlorotoxin polypeptide plasma area under the curve (average AUC) of from 50 to 120 per each 1 mg dosage of chlorotoxin polypeptide administered; and producing in the subject an average maximum chlorotoxin peptide blood plasma concentration (average C max ) of at least from 110 to 240 per each 1 mg dosage of chlorotoxin peptide administered. In some aspects, the chlorotoxin polypeptide is conjugated to a fluorescent agent.
[0246] The disclosure further describes compositions of chlorotoxin conjugates as claimed, often the chlorotoxin conjugate composition comprises a physiologically effective amount of the chlorotoxin conjugate, wherein intravenous administration of the composition to a subject produces in the subject: an average chlorotoxin polypeptide plasma area under the curve (average AUC) of from 50 to 120 per each 1 mg dosage of chlorotoxin polypeptide administered; and an average maximum chlorotoxin peptide blood plasma concentration (average C max ) of at least from 110 to 240 per each 1 mg dosage of chlorotoxin peptide administered. In some aspects, the chlorotoxin polypeptide is conjugated to a fluorescent agent.Activity of Chlorotoxin Conjugates
[0247] The present disclosure provides, but is not limited to, methods for intraoperative imaging and resection of tumors with chlorotoxin conjugates detectable by fluorescence imaging that allows for intraoperative visualization of cancerous tissues, compositions that include the chlorotoxin conjugate, and methods for using the chlorotoxin conjugate. The chlorotoxin is a targeting agent that directs the conjugate to a tissue of interest. In one aspect, the chlorotoxin conjugate of the disclosure includes one or more labeling agents. In a further aspect, the labeling agent comprises a fluorescent moiety (e.g., red or near infrared emitting fluorescent moieties) covalently coupled to the chlorotoxin. In another aspect, the labeling agent comprises a radionuclide.
[0248] The chlorotoxin conjugates described herein are often used for detection and treatment of, for example imaging, resection of, diagnosis of and treatment of tumors. In some aspects, tumors amenable to detection with a chlorotoxin conjugate of the present disclosure include, but are not limited to: adenocarcinoma, fibrosarcoma, hemangiosarcoma, mastocytoma, squamous cell carcinoma, chondrosarcoma, adenosquamous carcinoma, hemangiopericytoma, follicular carcinoma, meningioma, mucosal squamous cell cancer, glioma, sarcomas, such as soft-tissue sarcomas or the like. Soft-tissue sarcomas amenable to detection with a chlorotoxin conjugate of the present disclosure include, but are not limited to: fat tissue tumors, liposarcomas, muscle tissue tumors including smooth muscle sarcomas and leiomyosarcomas, skeletal muscle sarcomas, rhabdomyosarcomas, peripheral nerve tumors, fibrous tissue tumors, myxofibrosarcomas, fibromatosis, joint tissue tumors, tumors of blood vessels and lymph vessels, angiosarcomas, tumors of peripheral nerves such as malignant peripheral nerve sheath tumors, malignant schwannomas, neurofibrosarcomas, fibrosarcomas, synovial sarcomas, malignant fibrous histiocytoma (MFH) hemangiosarcomas, lymphangiosarcomas, gastrointestinal stromal tumors, alveolar soft part sarcoma, dermatofibrosarcoma protuberans (DFSP), desmoplastic small round cell tumour, epithelioid sarcoma, extra skeletal myxoid chondrosarcoma, and giant cell fibroblastoma (GCF).
[0249] The chlorotoxin conjugates described herein can be used for detection and treatment of tumors present in any organ and in any anatomical location, including but not limited to, breast, lung, brain, colon, rectum, prostate, head, neck, stomach, anus, and / or vaginal tissues, for example. Tumors of any grade or stage known to one of skill in the art, including low-grade tumors, are often detected by the chlorotoxin conjugates described herein. In some aspects, tumor detection includes imaging, resection, diagnostics and treatment.
[0250] In certain aspects, the present compounds are capable of passing across the blood brain barrier. Passing across the blood brain barrier is advantageous when detecting or treating a cancer cell in the brain, such as for example, a glioma cell or a brain tumor.
[0251] In some aspects, the dose of chlorotoxin conjugate is administered such that a threshold amount of chlorotoxin conjugate is achieved in the subject. For example, the threshold amount often depends upon the patient's age, weight, height, sex, general medical condition and previous medical history. For another example, the threshold amount does not depend upon the patient's age, weight, height, sex, general medical condition and previous medical history.
[0252] Other dosage forms is devised by those skilled in the art, as shown, for example, by Ansel and Popovich, Pharmaceutical Dosage Forms and Drug Delivery Systems, 5th Edition (Lea & Febiger 1990), Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995), and by Ranade and Hollinger, Drug Delivery Systems (CRC Press 1996).
[0253] As an illustration, pharmaceutical compositions are often supplied as a kit comprising a container that comprises a chlorotoxin conjugate. Chlorotoxin conjugates are often provided in the form of an injectable solution for single or multiple doses, or as a sterile powder that will be reconstituted before injection. Alternatively, such a kit often includes a dry-powder disperser, liquid aerosol generator, or nebulizer for administration of a therapeutic conjugate. Such a kit further comprises written information on indications and usage of the pharmaceutical composition.Methods of Tumor Prevention, Detection and Treatment
[0254] Subjects include, but are not limited to humans, non-human primates, monkeys, cows, dogs, rabbits, pigs, guinea pigs, rats, mice and zebrafish.
[0255] A sample includes any sample isolated from a subject, for example but not limited to, blood, serum, plasma, circulating cells, urine, saliva, and / or tissue removed from the body such as in a biopsy. Samples are often prepared using methods known to those of ordinary skill in the art, for example, blood samples are collected and incubated at room temperature for about 0.5 hours up to 2 hours prior to centrifugation, serum removal and storage at at least about 20 °C, but more often -70 °C.
[0256] Additional tests are often performed using samples from subjects, including complete blood counts, serum chemistry profiles and urinalysis.
[0257] The present disclosure provides a compound as claimed for use in methods for treating a disease or condition treatable by administering chlorotoxin. In one embodiment, the method includes administering an effective amount of a modified chlorotoxin peptide of the invention to a subject in need thereof.
[0258] The term "effective amount," as used herein, refers to a sufficient amount of an agent or a compound being administered which will relieve to some extent one or more of the symptoms of the disease or condition being treated. The result can be reduction and / or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system. Compositions containing such agents or compounds can be administered for prophylactic, enhancing, and / or therapeutic treatments. An appropriate "effective" amount in any individual case may be determined using techniques, such as a dose escalation study.
[0259] In one embodiment, the invention provides a compound as claimed for use in a method for treating a cancer that expresses chlorotoxin binding sites in a patient, comprising administering to a patient in need thereof an effective amount of a chlorotoxin variant of the invention.
[0260] In one embodiment, the invention provides a compound as claimed for use in a method for treating a cancer that expresses chlorotoxin binding sites, comprising administering to a patient in need thereof an effective amount of a pharmaceutical composition comprising a chlorotoxin variant of the invention and a pharmaceutically acceptable carrier.
[0261] In one embodiment, the invention provides a compound as claimed for use in a method for treating a tumor expressing chlorotoxin binding sites, comprising administering to a patient in need thereof an effective amount of a chlorotoxin variant of the invention.
[0262] In one embodiment, the invention provides a compound as claimed for use in a method for inhibiting invasive activity of cells that express chlorotoxin binding sites, comprising administering an effective amount of a chlorotoxin variant to cells that express chlorotoxin binding sites
[0263] The methods of treatment of the invention are applicable to human and animal subjects in need of such treatment.
[0264] Virtually every type of malignant cancer expressing chlorotoxin binding sites can be treated by the chlorotoxin variants and conjugates of the invention. These malignant cancers include gliomas, astrocytomas, medulloblastomas, choroid plexus carcinomas, ependymomas, meningioma, glioblastoma, ganglioma, pheochromocytoma, and metastatic brain tumors, other brain tumors, neuroblastoma, head and neck cancer, non-small cell lung cancer, small cell lung cancer, breast cancer, intestinal cancer, pancreatic cancer, colon cancer, liver cancer, kidney cancer, skin cancer, sarcomas (over 30 types), osteosarcoma, rhabdomyosarcoma, Ewing's sarcoma, carcinomas, melanomas, ovarian cancer, cervical cancer, lymphoma, thyroid cancer, anal cancer, colo-rectal cancer, endometrial cancer, germ cell tumors, laryngeal cancer, multiple myeloma, prostate cancer, retinoblastoma, gastric cancer, testicular cancer, and Wilm's tumor.
[0265] In certain aspects, the chlorotoxin conjugate is administered to an individual having or suspected of having a tumor, such that the conjugate binds specifically to the tumor. Such methods are useful in reducing the likelihood that the individual will develop a tumor, that one or more tumors in the individual will increase in size, that one or more tumors in the individual will metastasize, and / or that the cancer will progress by some other measure. As used herein, the term "metastasis" refers to the spread of tumor cells from one organ or tissue to another location, and also refers to tumor tissue that forms in a new location as a result of metastasis.
[0266] In some aspects, the chlorotoxin conjugate is useful for the treatment and / or diagnosis of neuroectodermal tumors such as gliomas, medulloblastomas, neuroblastomas, pheochromocytomas, melanomas, peripheral primitive neuroectodermal tumors, small cell carcinoma of the lung, Ewing's sarcoma, and metastatic tumors in the brain. In some aspects, the chlorotoxin conjugate is useful for the treatment and / or diagnosis of brain tumors, including but not limited to, glioma, including glioblastoma multiforme, anaplastic astrocytomas, low grade gliomas, pliocytic astrocytomas, oligodendrogliomas, gangliomas, meningiomas, and ependymomas.
[0267] In other aspects, the compounds of the present disclosure are used to detect and / or treat soft-tissue sarcomas. Soft-tissue sarcomas are a group of malignant tumors that form in fat, muscles, nerves, joints, and blood vessels. In 2012, it was estimated that approximately 11,280 Americans would be diagnosed with soft-tissue sarcomas and approximately 3,900 would be expected to die from soft-tissue sarcomas. Soft tissue and bone sarcoma incidence rates have increased slightly over the past 30 years; however, soft-tissue sarcoma is more deadly, possibly because the lack of specific symptoms at early disease stages may lead to delays in diagnosis.
[0268] Moreover, certain inherited disorders and past treatment with radiation therapy can increase the risk of soft-tissue sarcoma. No modifiable risk factors for sarcoma have been identified. Standard treatments for soft-tissue sarcoma include surgery, chemotherapy, and radiation therapy.
[0269] Since symptoms of soft-tissue sarcomas often do not appear until the disease is advanced, only about 50% of soft-tissue sarcomas are found in the early stages, before they have spread.
[0270] The present invention provides such methods of detection, imaging, visualization, analysis and treatment for these and other uses that should be apparent to those skilled in the art from the teachings herein.
[0271] The present invention is based in part upon the identification by the inventors that soft-tissue sarcomas have a high level of uptake of the conjugate compared to other tumors or normal tissues and are particularly well-suited for detection by means of administering a chlorotoxin conjugated to a labeling agent for detection, visualization, imaging, or analysis. Such visualization can be during or related to surgical (intraoperative) resection or during or related to initial identification of the sarcoma or during or related to monitoring of the sarcoma relevant to treatment.
[0272] Real-time intraoperative visualization of solid tumors enables more complete resection while sparing surrounding normal tissue. Improvement in intraoperative tumor visualization would be of benefit for any resectable solid tumor, as it would enable surgeons to better determine the extent of local invasion as well as the presence of metastatic spread in nearby lymph nodes and fatty tissue. This kind of information would be helpful in making surgical decisions, for example, decisions regarding which patients would respond well to limb-sparing approaches in the treatment of sarcomas.
[0273] For brain tumors this is of paramount importance, since removal of additional tissue can unnecessarily increase cognitive and functional impairment, yet being too conservative in the amount of resection may leave tumor tissue behind.
[0274] Surgeons who specialize in human breast cancer surgery have indicated that precise margins are less important in this indication, and the surgical approach is generally a wide excision with 0.2 - 1 cm margins on all sides. It is difficult for surgeons to obtain wide margins using only white light and preoperative imaging information. In 20-50% of breast cancer surgeries, failure to obtain clean margins leads to second surgeries.
[0275] The present invention shows that soft-tissue sarcomas are particularly identifiable when bound by a chlorotoxin conjugate, which can be effectively used to detect these sarcomas, especially during or related to surgery and intraoperative resection. For example, the chlorotoxin conjugate can be used alone or on combination with other detection agents, to detect, image, visualize, or analyze the tumor in advance of, during, or following anti-tumor treatments, which can include surgery and surgical resection, chemotherapy, radiation therapy, and immunotherapy. In addition, the chlorotoxin conjugate can be used alone or with other detection agents for follow-up monitoring post treatment as well as for general monitoring for full-body screening.
[0276] Low-grade tumors generally tend to be slow growing, slower to spread, and often have better prognosis than higher-grade tumors, making them more curable with surgical resection than high-grade tumors, which may need more systemic treatment. The inventors show that use of a chlorotoxin conjugated to a labeling agent can be particularly effective in detection, imaging, visualization, or analysis of low-grade tumors, such as meningiomas, allowing their complete resection before they metastasize or spread.
[0277] Intraoperative resection of tumor types may vary depending on the anatomic location and type of tumor. For example, when a tumor is located in brain tissue, the surgeon is likely to require perfect or near perfect specificity between a tumor imaging or detection agent and the tumor tissue so that only diseased tissue is resected. On the other hand, when the tumor is located in a tissue where wider margins are generally resected, such as breast or mammary cancer or colon cancer, or in cancers where the tumor is likely to spread locally, such as squamous cell carcinoma, it would be advantageous for a surgeon to be able to use a tumor imaging or detection agent to identify peritumoral tissue that is likely to become tumor tissue.
[0278] Soft-tissue sarcomas can develop from soft tissues like fat, muscle, nerves, fibrous tissues, blood vessels, or deep skin tissues. They can be found in any part of the body. Most of them develop in the arms or legs. They can also be found in the trunk, head and neck area, internal organs, and the area in back of the abdominal cavity (known as the retroperitoneum).
[0279] Soft-tissue sarcomas that may be amenable to detection with a chlorotoxin conjugate of the present invention include, but are not limited to: fat tissue tumors, muscle tissue tumors, skeletal muscle sarcomas, rhabdomyosarcomas, peripheral nerve tumors, fibrous tissue tumors, myxofibrosarcomas, fibromatosis, joint tissue tumors, tumors of blood vessels and lymph vessels, angiosarcomas, gastrointestinal stromal tumors, alveolar soft part sarcoma, dermatofibrosarcoma protuberans (DFSP), desmoplastic small round cell tumour, epithelioid sarcoma, extra skeletal myxoid chondrosarcoma, and giant cell fibroblastoma (GCF).
[0280] Sarcomas that start in the body's fat cells are called liposarcomas. They can grow anywhere in the body and most commonly affect people aged 50-65 years. Some grow very slowly, taking many years to develop, whereas others grow more quickly.
[0281] Muscle tissue sarcomas include smooth muscle sarcomas and skeletal muscle sarcomas. Smooth muscle forms the walls of internal organs such as the stomach, intestine, womb (uterus), and blood vessels. The muscle causes these organs to contract, which happens without our control. Smooth muscle is also called involuntary muscle. Sarcomas that develop in smooth muscle are called leiomyosarcomas. They are one of the more common types of sarcoma and can occur anywhere in the body, especially in the back of the abdominal area (retroperitoneum). Leiomyosarcomas are less often found in the deep, soft tissues of the legs or arms. They tend to occur in adults, particularly in the elderly. Skeletal muscles are the active muscles in our arms and legs or other parts of the body that we control. They are voluntary muscles and sometimes called striated muscles because the cells look stripy when examined under a microscope.
[0282] Sarcomas that grow in the voluntary muscles of the body are called rhabdomyosarcomas. They are found mostly in the head and neck, but also in organs such as the bladder, vagina and the arms or legs. Rhabdomyosarcomas are more commonly diagnosed in children than in adults.
[0283] Peripheral nerve tumors can be found in the peripheral nervous system, which consists of all the nerves that run throughout the body. Sarcomas of the peripheral nerves develop in the cells that cover the nerves. They're known as malignant peripheral nerve sheath tumors (MPNST) and can occur anywhere in the body. There are different types of MPNSTs, including malignant schwannomas and neurofibrosarcomas. They most commonly occur in people who have a rare genetic disorder called neurofibromatosis (von Recklinghausen's disease).
[0284] Fibrous tissue tumors occur in tissues that join muscles to bones. This tissue is made up of cells called fibrocytes. A sarcoma of the fibrous tissue is called a fibrosarcoma. They are most commonly found on the arms, legs or trunk, but can occur deeper in the body. They can occur at any age but are more commonly seen in people aged 20-60 years. Most people first notice them as a painless, firm lump.
[0285] Soft-tissue sarcomas that develop very close to the body's joints are known as synovial sarcomas. They commonly develop near, but not inside, joints such as the knee or elbow, but they can occur in any part of the body. They usually appear as hard lumps and are more common in children and young adults.
[0286] Blood and lymph vessel tumors include sarcomas that start from the cells that make up the walls of blood or lymph vessels and are called angiosarcomas. Haemangiosarcomas develop from blood vessels and lymphangiosarcomas develop from the lymph vessels.
[0287] Angiosarcomas are sarcomas that sometimes occur in a part of the body that has been treated with radiotherapy many years before.
[0288] Gastrointestinal stromal tumors (GIST) are soft-tissue sarcomas that develop in nerve cells in the walls of the digestive system.
[0289] The inventors have also identified that low-grade tumors can be detected with a chlorotoxin conjugated to a labeling agent. This is particularly useful since low-grade tumors have a better prognosis if they can be fully resected.
[0290] In addition, the invention is based in part on the identification by the inventors of an optimal dose for tumor imaging in dogs of at least about 0.8 mg / m 2< . One skilled in the art will recognize that dosage for the chlorotoxin conjugate will be determined based on the amount of conjugate administered and the amount of time after administration after which the imaging is performed. In some aspects the optimal dose for tumor imaging is in the range of about 0.85 mg / m 2< to about 1.2 mg / m 2< , or in the range of about 0.9 to about 1.1 mg / m 2< . At doses up to 0.9 mg / m 2< , signal in gross tumor samples increases as a function of dose. At doses above 0.9 mg / m 2< , the correlation between signal and dose is lost, suggesting that in this model system the signal in tumor is maximal above this dose. However, it is recognized that in other cases more conjugate can be administered with acceptable imaging. Thus, in some aspects, the amount of chlorotoxin conjugate that can be administered can be in the range of about 1.3 mg / m 2< to about 2.5 mg / m 2< , or in the range of about 2.6 mg / m 2< to about 3.5 mg / m 2< , or in the range of about 3.6 mg / m 2< to about 4.5 mg / m 2< , or in the range of about 4.6 mg / m 2< to about 5.5 mg / m 2< , or upwards of 5.5 mg / m 2< .Imaging Methods
[0291] In a further aspect of the invention, methods of using the chlorotoxin conjugates are provided. In one embodiment, the invention provides a method for imaging a tissue imagable by chlorotoxin. In the method, a tissue imagable by chlorotoxin is contacted with a chlorotoxin conjugate. In one embodiment, the imaging method is a fluorescence imaging method. Representative methods for making and using fluorescent chlorotoxin conjugates are described in U.S. Patent Application Publication No. 20080279780 Al, Fluorescent Chlorotoxin Conjugate and Method for Intra-Operative Visualization of Cancer, and in U.S. Patent Application Publication No. 20130195760, Chlorotoxin Variants, Conjugates, And Methods For Their Use.
[0292] In many cases, chlorotoxin conjugates can be administered to human and animal subjects, such as with a pharmaceutically acceptable carrier. In some aspects, the composition includes a pharmacologically effective amount of a modified chlorotoxin conjugate. An effective amount can be routinely determined by established procedures. An effective amount is an amount sufficient to occupy chlorotoxin binding sites in cancer cells, but low enough to minimize non-specific binding to non-neoplastic tissues. An effective amount optimizes signal-to-noise ratio for intra-operative imaging.
[0293] The disclosure provides methods for detecting a tissue using the chlorotoxin conjugates. The chlorotoxin conjugates of the invention target and are bound by chlorotoxin binding sites. It will be appreciated that chlorotoxin binding sites may take two forms: sites that bind chlorotoxin and sites that bind the chlorotoxin conjugates of the invention. It will be appreciated that chlorotoxin binding sites may be distinct from chlorotoxin conjugate binding sites.
[0294] In some aspects, a method for differentiating foci of cancers that express chlorotoxin binding sites from non-neoplastic tissue is provided. The method includes contacting a tissue of interest with a chlorotoxin conjugate having affinity and specificity for cells that express chlorotoxin binding sites, wherein the chlorotoxin conjugate comprises one or more red or near infrared emitting fluorescent moieties covalently coupled to a chlorotoxin, and measuring the level of binding of the chlorotoxin conjugate, wherein an elevated level of binding, relative to normal tissue, is indicative that the tissue is neoplastic.
[0295] In some aspects, a method for detecting cancers that express chlorotoxin binding sites is provided. The method includes the steps of contacting a tissue of interest with a chlorotoxin conjugate having affinity and specificity for cells that express chlorotoxin binding sites, wherein the chlorotoxin conjugate comprises one or more red or near infrared emitting fluorescent moieties covalently coupled to a chlorotoxin, and measuring the level of binding of the chlorotoxin conjugate, wherein an elevated level of binding, relative to normal tissue, is indicative that the tissue is neoplastic.
[0296] In some aspects, a compound as claimed for use in a method for determining the location of cancer cells that express chlorotoxin binding sites in a patient intra-operatively is provided. The method includes the steps of administering a pharmaceutical composition to a patient, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and an amount of a chlorotoxin conjugate sufficient to image cancer cells that express chlorotoxin binding sites in vivo, wherein the chlorotoxin conjugate comprises one or more red or near infrared emitting fluorescent moieties covalently coupled to a chlorotoxin, measuring the level of binding of the chlorotoxin conjugate by fluorescence imaging to determine the location of cancer cells that express chlorotoxin binding sites, wherein an elevated level of binding, relative to normal tissue, is indicative of the presence of cancer cells that express chlorotoxin binding sites; and surgically removing from the patient at least some cells that express chlorotoxin binding sites located by fluorescence imaging.
[0297] Imaging methods for detection of cancer foci disclosed herein are applicable to mouse and other animal models of cancer as well as to veterinary practice.
[0298] The present invention provides a compound as claimed for use in methods for intraoperative imaging and resection of tumors with chlorotoxin conjugates detectable by fluorescence imaging that allows for intraoperative visualization of cancerous tissues, compositions that include the chlorotoxin conjugate, and methods for using the chlorotoxin conjugate. The chlorotoxin is a targeting agent that directs the conjugate to a tissue of interest. In one embodiment, the chlorotoxin conjugate of the invention includes one or more labeling agents. In a further embodiment, the labeling agent comprises a fluorescent moiety (e.g., red or near infrared emitting fluorescent moieties) covalently coupled to the chlorotoxin. In another embodiment, the labeling agent comprises a radionuclide.
[0299] As used herein, the term "red or near infrared emitting fluorescent moiety" refers to a fluorescent moiety having a fluorescence emission maximum greater than about 600 nm.
[0300] In certain embodiments of the chlorotoxin conjugate, the fluorescent moieties are derived from fluorescent compounds characterized by emission wavelength maxima greater than about 600 nm to avoid autofluorescence, emission that travels through millimeters to one centimeter of tissue / blood / fluids, emission that is not absorbed by hemoglobin, other blood components, or proteins in human or animal tissue. In some aspects, the emission wavelength maximum is greater than 600 nm, greater than 650 nm, greater than 700 nm, greater than 750 nm, greater than 800 nm, greater than 850 nm, greater than 900 nm, or greater than 950 nm.
[0301] The fluorescent moiety is covalently coupled to the chlorotoxin to allow for the visualization of the conjugate by fluorescence imaging. The fluorescent moiety is derived from a fluorescent compound. Suitable fluorescent compounds are those that can be covalently coupled to a chlorotoxin without substantially adversely affecting the targeting and binding function of the chlorotoxin conjugate. Similarly, suitable fluorescent compounds retain their fluorescent properties after conjugation to the chlorotoxin.
[0302] Generally, the dosage of administered chlorotoxin conjugates may vary depending upon such factors as the patient's age, weight, height, sex, general medical condition and previous medical history. Typically, it is desirable to provide the recipient with a dosage of chlorotoxin conjugated to a chemotherapeutic, an anti-cancer agent, or an anti-cancer drug that is effective to achieve inhibition, shrinkage, killing, minimization, or prevention of metastasis. In many cases, it is desirable to provide the recipient with a dosage of a chlorotoxin conjugate that is in the range of from about 3 mg to about 6 mg, although a lower or higher dosage also may be administered as circumstances dictate.
[0303] Administration of a chlorotoxin conjugate to a subject can be topical, inhalant, intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, intrapleural, intrathecal, by perfusion through a regional catheter, or by direct intralesional injection. When administering conjugates by injection, the administration may be by continuous infusion or by single or multiple boluses.
[0304] Additional routes of administration include oral, mucosal-membrane, pulmonary, and transcutaneous. Oral delivery is suitable for polyester microspheres, zein microspheres, proteinoid microspheres, polycyanoacrylate microspheres, and lipid-based systems (see, for example, DiBase and Morrel, "Oral Delivery of Microencapsulated Proteins," in Protein Delivery: Physical Systems, Sanders and Hendren (eds.), pages 255-288 (Plenum Press 1997)). The feasibility of an intranasal delivery is exemplified by such a mode of insulin administration (see, for example, Hinchcliffe and Ilium, Adv. Drug Deliv. Rev. 35:199 (1999)). Dry or liquid particles comprising a chlorotoxin conjugate can be prepared and inhaled with the aid of dry-powder dispersers, liquid aerosol generators, or nebulizers (e.g., Pettit and Gombotz, TIBTECH 16:343 (1998); Patton et al., Adv. Drug Deliv. Rev. 35:235 (1999)). This approach is illustrated by the AERX diabetes management system, which is a hand-held electronic inhaler that delivers aerosolized insulin into the lungs. Transdermal delivery using electroporation provides another means to administer a chlorotoxin conjugate.
[0305] A pharmaceutical composition comprising a chlorotoxin conjugate can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the conjugate is combined with a pharmaceutically acceptable carrier. A composition is said to be a "pharmaceutically acceptable carrier" if its administration can be tolerated by a recipient patient. Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable carrier. Other suitable carriers are well-known to those in the art. See, for example, Gennaro (ed.), Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company 1995).
[0306] A pharmaceutical composition comprising a chlorotoxin conjugate can be furnished in liquid form, in an aerosol, or in solid form. Liquid forms, are illustrated by injectable solutions, aerosols, droplets, topological solutions and oral suspensions. Exemplary solid forms include capsules, tablets, and controlled-release forms. The latter form is illustrated by miniosmotic pumps and implants (Bremer et al., Pharm. Biotechnol. 10:239 (1997); Ranade, "Implants in Drug Delivery," in Drug Delivery Systems, Ranade and Hollinger (eds.), pages 95-123 (CRC Press 1995); Bremer et al., "Protein Delivery with Infusion Pumps," in Protein Delivery: Physical Systems, Sanders and Hendren (eds.), pages 239-254 (Plenum Press 1997); Yewey et al., "Delivery of Proteins from a Controlled Release Injectable Implant," in Protein Delivery Physical Systems, Sanders and Hendren (eds.), pages 93-117 (Plenum Press 1997)). Other solid forms include creams, pastes, other topological applications, and the like.
[0307] Other dosage forms can be devised by those skilled in the art, as shown, for example, by Ansel and Popovich, Pharmaceutical Dosage Forms and Drug Delivery Systems, 5.sup.th Edition (Lea & Febiger 1990), Gennaro (ed.), Remington's Pharmaceutical Sciences, 19.sup.th Edition (Mack Publishing Company 1995), and by Ranade and Hollinger, Drug Delivery Systems (CRC Press 1996).
[0308] As an illustration, pharmaceutical compositions may be supplied as a kit comprising a container that comprises a chlorotoxin conjugate. Therapeutic conjugates can be provided in the form of an injectable solution for single or multiple doses, or as a sterile powder that will be reconstituted before injection. Alternatively, such a kit can include a dry-powder disperser, liquid aerosol generator, or nebulizer for administration of a therapeutic conjugate. Such a kit may further comprise written information on indications and usage of the pharmaceutical composition.
[0309] The present disclosure is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and accompanying figures.
[0310] All features discussed in connection with any aspect or embodiment herein can be readily adapted for use in other aspects and embodiments herein. The use of different terms or reference numerals for similar features in different embodiments does not necessarily imply differences other than those expressly set forth. Accordingly, the present invention is intended to be described solely by reference to the appended claims, and not limited to the embodiments disclosed herein.
[0311] Unless otherwise specified, the presently described methods and processes can be performed in any order. For example, a method describing steps (a), (b), and (c) can be performed with step (a) first, followed by step (b), and then step (c). Or, the method can be performed in a different order such as, for example, with step (b) first followed by step (c) and then step (a). Furthermore, those steps can be performed simultaneously or separately unless otherwise specified with particularity.
[0312] The particulars shown herein are by way of example and for purposes of illustrative discussion of the preferred embodiments of the present invention only and are presented in the cause of providing what is believed to be the most useful and readily understood description of the principles and conceptual aspects of various embodiments of the invention. In this regard, no attempt is made to show structural details of the invention in more detail than is necessary for the fundamental understanding of the invention, the description taken with the drawings and / or examples making apparent to those skilled in the art how the several forms of the invention may be embodied in practice.
[0313] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range, and any other stated or intervening value in that stated range, is encompassed within the disclosure provided herein. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure provided herein.
[0314] All features discussed in connection with an aspect or embodiment herein can be readily adapted for use in other aspects and embodiments herein. The use of different terms or reference numerals for similar features in different embodiments does not necessarily imply differences other than those expressly set forth. Accordingly, the present invention is intended to be described solely by reference to the appended claims, and not limited to the embodiments disclosed herein.
[0315] It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims be covered thereby.EXAMPLES
[0316] The invention is further illustrated by the following non-limiting examples.EXAMPLE 1 Stability of Compound 16 with Ammonium Acetate Salt
[0317] A = MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR (K-27 is point of attachment)
[0318] This example demonstrates the production and stability of Compound 16 under various pH and temperature storage conditions over time.
[0319] The peptide portion of Compound 16 is a targeting peptide (modified chlorotoxin) conjugated to the fluorescent dye. The targeting peptide binds selectively to cancerous cells and the dye portion facilitates detection via imaging. The peptide is a 36 amino acid modified chlorotoxin (having a sequence of H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Arg-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Arg-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-OH) wherein two of three lysine amino acids in native chlorotoxin are substituted with arginine (K15R and K23R) to facilitate the subsequent conjugation with a fluorophore to the single remaining lysine (K27) residue resulting in a mono-labeled fluorescent active pharmaceutical ingredient.
[0320] Methods and Results: Product solutions were stored at ≤ 8 °C during manufacturing. All analysis utilized the in-process HPLC method PR to determine the stability of the product in the different buffers.
[0321] Dye Conjugation: 500 mg of the peptide portion of Compound 16:(TFA salt), (net peptide content 76.7, net peptide 384 mg, 0.095mmol) were dissolved in a solution of sodium bicarbonate. DMSO and 140 mg of ICG-Sulfo-ATT dissolved in dried DMSO (net dye 126 mg 0.152mmol, 1.6 eq. based on a product activity of 90%) were added, resulting in a final reaction volume of approximately 200mL. The reaction was followed by RP-HPLC and considered completed after 3 hours, with ~ 3.4% un-reacted Compound 16 remaining.
[0322] Ammonium Bicarbonate Purification: The reaction solution was filtered and then diluted with 400mL of water. The solution was loaded on an RP-HPLC column equilibrated with 0.1M ammonium bicarbonate, and the product recovered by applying a linear gradient of acetonitrile.
[0323] The product eluted as a single peak. Fractions were collected and analyzed by analytical HPLC. During analysis the fractions were stored at ≤ 8°C protected from light.
[0324] The purity, estimated concentration, and estimated amount of product in each fraction are reported in Table 15. The estimation was based on the peak area observed during release analysis of a solution of the product at a concentration of 1 mg / mL in water. Table 15: Ammonium Bicarbonate Purification Part IFraction Number Purity (%) Concentration ( mg / mL) Amount ( mg) 6-1-35.480.00250.16-1-473.360.09704.86-1-598.671.263863.26-1-698.963.0056150.36-1-795.592.0464102.36-1-892.161.062253.16-1-981.870.395919.86-1-1066.560.07033.5Total product recovery in fractions 3 to 10303Product recovery in main pool (fractions 5 to 8)282
[0325] The main pool (fractions 6-1-5 to 6-1-8, purity 97%) was combined and transferred to the salt exchange step. Samples of the main pool were analyzed for a period of 5 day of storage protected from light at ≤ 8°C. The material was stable under these conditions.
[0326] Ammonium Acetate Salt Exchange: The primary purification main pool solution (~ 200mL) was diluted with 100mL of water and loaded on an RP-HPLC column equilibrated with 0.1M ammonium bicarbonate. Following loading of the sample, the column was equilibrated with 4 bed volumes of 0.1M ammonium acetate adjusted to pH 7.6 with ammonium hydroxide. Finally the column was equilibrated with 0.01M ammonium acetate pH 7.6 and the product was recovered by applying a linear gradient of 0.01M ammonium acetate pH 7.6 in 75% Acetonitrile.
[0327] The product eluted as a single peak at approximately 39% acetonitrile concentration. The fractions were collected and analyzed by analytical HPLC. During analysis, the fractions were stored at < 8°C protected from light.
[0328] The purity, estimated concentration, and estimated amount of product in each fraction are reported in Table 16. The estimation was based on the peak area observed during release analysis of a solution of the product at a concentration of 1 mg / mL in water. Table 16: Ammonium Bicarbonate Purification Part IIFraction Number Purity (%) Concentration (mg / mL) Amount ( mg) 7-1-179.10.0200841.07-1-298.61.11528555.87-1-399.01.80441490.27-1-498.11.19846459.97-1-594.80.42501721.37-1-684.20.1011135.17-1-765.40.0372111.97-1-855.50.0211731.1Total product recovery in fractions 3 to 10236Product recovery in main pool (fractions 5 to 8)232
[0329] The main pool (fractions 7-1-2 to 7-1-6, purity 97.2%) were combined and transferred to lyophilization. Samples of the main pool were analyzed for a period of 5 day of storage protected from light at ≤ 8°C. The material was stable under these conditions. Dilution with a volume equal to approximately half the main pool volume provided a stable solution without the presence of a precipitate. This dilution was utilized at the preparative scale.
[0330] Lyophilization: The main pool at stage 7 was diluted with 100mL of water and lyophilized over a period of 4 days using a bottle lyophilizer. There was no problem with solubility after dilution as had been observed with the ammonium bicarbonate main pool; a sample was diluted to 15% acetonitrile without any observed precipitation. During lyophilization, the product formed a stable self-supporting cake.
[0331] Reconstitution: The product was readily soluble in water at 1, 5 and 10 mg / mL. Water was selected as the reconstitution solution. Additionally, an LC-MS analysis was performed on the final material.
[0332] A sample of the main pool of Stage 6 (ammonium bicarbonate purification) was stored without dilution at ≤ 8°C for 5 days protected from light. The sample was analyzed daily. Results are reported in Table 17. The results indicate a low level of instability. Table 17: Stage 6 Main Pool StabilityTime point (hour) Purity (%) 096.62696.44896.47296.310595.719195.4
[0333] A sample of the main pool of Stage 7 (ammonium acetate purification) was stored without dilution at ≤ 8°C for 5 days protected from light. The sample was analyzed daily. Results are reported in Table 18. The results indicate a low level of instability. Table 18: Stage 7 Main Pool StabilityTime point (hour) Purity (%) Zero97.82697.64897.47997.19196.861096.4
[0334] An optimized and scalable conjugation procedure for production of Compound 16 for GMP manufacturing was developed. Two different dye reagents were evaluated: ICG-Sulfo-NHS ester and ICG-Sulfo-ATT (both resulting in Compound 16). Design of Experiments (DOE) studies was prepared.
[0335] After conjugation of Compound 16, the crude peptide conjugate was purified by RP-HPLC with a TFA and acetonitrile gradient elution. Fractions were characterized for purity with a RP-HPLC assay, pooled and desalted into acetate by HPLC prior to lyophilization to bulk conjugate product.
[0336] Compound 16 was stable for up to 14 days at pH 7.5 and 8.5 when stored in the dark at 4°C in 10mM Tris, 5% Dextrose and is sensitive to low pH and temperatures above 4°C.EXAMPLE 2 Evaluation of the Stability of Compound 16 in Various Buffers and at Various pHs
[0337] A = MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR (K-27 is point of attachment)
[0338] This example shows the stability of Compound 16 with respect to pH and provides an evaluation of the use of alternative buffers and various excipients and configurations.
[0339] This example further shows that various classes of excipients protect Compound 16 from thermal, photo, oxidative and freeze / thaw stress.
[0340] In some cases, formulations were stored in microcentrifuge tubes with an air atmosphere and assayed after 2d and 5d at 40°C in the dark, after 3d at room remperature (rt) in the dark (dk) or in ambient light (lt), and after 3X freeze thaw (F / T) between -20°C and room temperature in the dark. Formulations were evaluated by visual examination, centrifugation, RP-HPLC, concentration by A 786 , pH, and SDS-PAGE.
[0341] In some cases, the timepoints were 4, 7, and 14 days at room temperature with evaluation by visual examination, centrifugation, RP-HPLC, concentration by A 786 , pH, and SDS-PAGE. Where extra material remained, additional stressing conditions were evaluated for further information. The formulations were contained in microcentrifugation tubes in an air environment.
[0342] Methods: The following stock solutions were prepared and passed through a 0.2 µm filter (Table 19). Dialysis buffers were prepared immediately before use by combining a stock from Table 19 with sparged water (sparged by bubbling with argon for 15 min - 3h). Table 19: Stock Buffer SolutionsBuffer Molarity pH Tris 0.57.0, 7.5, 8.0, 8.5His 0.255.5, 6.5, 7.0maleic acid 0.57.0HEPES 0.57.0EDA 0.57.0acetic 0.54.5
[0343] Compound 16 was prepared at 3 mg / mL in water (see concentration by A 786 below). Slide-a-lyzer cassettes were pre-soaked in water, then the Compound 16 was dispensed into the cassettes (~11 mL for formulation 1, ~5 mL for formulations 2-6, ~2.7 mL for formulations 7-12). The cassettes were placed into beakers containing 550 mL of the corresponding formulation buffer. Samples were formulated by dialyzing with stirring in the dark at room temperature (on a multiposition stir plate, covered with a box covered with aluminum foil). Dialysis buffer was changed after 1 h, again after 1.25 h, and allowed to continue overnight.
[0344] For some formulations, the formulation was placed in a fresh tube and combined with additional sterile 0.25M or 0.5M buffer stock to yield a new formulation with 30 mM concentration of buffer. All formulations were then dispensed into 1.5mL microcentrifuge tubes, 0.5mL per tube.
[0345] The designed stability timepoints were 4, 7, and 14 days at room temperature. Where extra material remained, additional testing was performed. One tube of each formulation was assayed immediately ("t0"). For additional information, remaining material from these t0 tubes was then frozen at -20°C, then thawed at 5 °C, and assayed for pH and concentration ("1x F / T"). Other tubes were incubated in the dark at room temperature (approximately 22-23°C). A tube was removed and assayed at 4, 7, and 14d room temperature (rt) ("4d rt", "7d rt", "14d rt"). For additional information, after the 7d room temperature sample was assayed, the remaining material was placed at room temperature in the light for one day and then assayed again ("7+1d light"). These tubes were placed on their sides on the benchtop. Stability samples were assayed by visual inspection, centrifugation, RP-HPLC, A 786 , pH, and, in some cases, SDS-PAGE.
[0346] Samples were examined visually for clarity, color, and visible particulates. They were then mixed, withdrawn into glass Pasteur pipets, and examined again. Samples were centrifuged ~10,000 rpm for ~2 min. Samples were then examined visually for any visible pellet.
[0347] Samples were analyzed by RP-HPLC using the Zorbax_10 method. Table 20: Tested Formulations#Composition pH 1,(1B)10, (30) mM Tris7.02,(2B)10, (30) mM His7.0310 mM maleic acid7.04, (4B)10, (30) mM EDA7.06, (6B)10, (30) mM HEPES7.0710 mM acetic4.5810 mM His5.5910 mM His6.51010 mM Tris7.51110 mM Tris8.01210 mM Tris8.5
[0348] 100µl of sample was placed in an HPLC vial insert, placed in an amber HPLC vial, and held at 2-8 °C before the 2 µl injection. The formulation buffer was injected twice at the beginning of each run, and a matched formulation buffer blank was run each time before injection of a sample in a new buffer.
[0349] The spectrophotometer was blanked with matching formulation buffer. Concentration was calculated using the extinction coefficient. The pH was measured using a calibrated micro pH electrode.
[0350] Samples were prepared per the manufacturer's recommendations and then heated at 70 °C for 10 min. 2 µg in 10 µL was loaded onto the SDS-PAGE gels and then run at 200V for approximately 35 min. After electrophoresis, the gels were washed in water for 5 min at room temperature, 3 times. Then they were stained at room temperature for 1.5 h, destained in water overnight, and then destained again with water and imaged on the same day.
[0351] Results. Formulations were produced by dialyzing a stock of Compound 16 at 3 mg / mL in water into various buffers. The formulations were then dispensed into microcentrifuge tubes, in air, and stored in the dark at room temperature for up to 14 days. The results from visual examination of the formulations are given in Table 21. Table 21: Visual Inspection. C = clear; G = emerald green; N = essentially no visible particles; F = very few particles or fibers visible; nt = not tested.Formulation Visual Days at rt # Composition pH 0 4 7 14 7+1d light 110 mM tris7.0CGNCGNCGNCGNCGN210 mM His7.0CGNCGNCGFCGNCGF2B30 mM His7.0CGFCGFCGFCGNnt310 mM maleic acid7.0insolublentntntnt410 mM EDA7.0CGNCGFCGNCGFCGN610 mM HEPES7.0CGFCGNCGNCGNCGN6B30 mM HEPES7.0CGNCGFCGFCGNNt710 mM acetic4.5CGNCGFCGNCGNCGN810 mM His5.5CGNCGNCGNCGNCGN910 mM His6.5CGFCGNCGNCGNCGN1010 mM tris7.5CGFCGFCGNCGFnt1110 mM tris8.0CGNCGNCGNCGNCGF1210 mM tris8.5CGFCGFCGFCGFCGF
[0352] The results after centrifugation are provided in Table 22. The pH measurements are given in Table 23. Table 22: Pellet Analysis after Centrifugation. N = no pellet; P = pellet.Formulation Centrifugation Days at rt #Composition pH 7 14 7+1d light 110 mM tris7.0NNN210 mM His7.0NNN410 mM EDA7.0NNN610 mM HEPES7.0NNN6B30 MM HEPES7.0NNnt710 mM acetic4.5NNN810mM His5.5NNN910mM His6.5NNN1010mM tris7.5PPnt1110mM tris8.0PPP1210mM tris8.5PPP Table 23: pH stability analysis. Formulation pH Days at rt F / T # Composition pH 4 7 14 1X F / T Buffer alone 110 mM tris7.07.06.86.86.97.0210 mM His7.06.96.86.96.86.92B30 mM His7.06.96.86.96.8nt410 mM EDA7.06.66.66.66.66.7610 mM HEPES7.07.06.97.07.06.96B30 MM HEPES7.07.06.96.96.9nt710 mM acetic4.54.64.64.64.64.5810mM His5.55.45.35.45.35.4910mM His6.56.46.46.46.46.41010mM tris7.57.47.37.47.47.41110mM tris8.07.97.87.97.87.91210mM tris8.58.38.38.38.38.4
[0353] The % main peak by RP-H PLC is given in Table 24. Stability drops off rapidly at pH ≤6.5. Table 24: % Main Peak by RP-HPLC; Δ light v dark = (7+1d light) - (7d dark).Formulation % Main peak Days at rt #Composition pH 0 4 7 14 110 mM tris7.097.9%96.8%95.5%93.5%210 mM His7.098.0%96.1%94.8%90.3%2B30 mM His7.097.7%96.2%94.7%91.9%410 mM EDA7.098.3%97.1%96.2%94.6%610 mM HEPES7.097.0%96.6%94.2%91.0%6B30 mM HEPES7.097.6%96.2%94.9%92.6%710 mM acetic4.592.6%64.8%47.4%21.6%810mM His5.597.1%90.9%87.1%75.8%910mM His6.597.8%95.7%94.2%90.9%1010mM tris7.597.7%96.7%96.0%94.0%1110mM tris8.097.7%97.2%96.6%93.4%1210mM tris8.597.9%95.5%93.9%91.7%
[0354] FIG. 1 shows SDS-PAGE analysis of the formulations after 14 days at room temperature. FIGS. 1A and 1B show SDS-PAGE analysis of, from left to right, (molecular weight marker) MWM, 1, 2, 2B, 4, 6, 6B, 9, 10 and reference. FIG. 1A was performed with a reducing agent and FIG. 1B was performed without a reducing agent. FIG. 1C shows SDS-PAGE analysis of, from left to right, 7, 8, 11, 12, reference and MWM (no reducing agent). (Reference = Pilot Lot, Sublot #2. MWM: 188k, 98k, 62k, 49k, 38k, 28k, 17k, 14k, 6k, 3k. Arrow points to a higher molecular weight species.
[0355] Compound 16 was formulated by additional means. Stocks were prepared and the pH of some stocks was adjusted to near 6.8 to avoid pH shift upon addition to formulations (Table 25). All stocks were 0.2µm filtered except BHT, BHA, propyl gallate, and polysorbates. Polysorbate and Nal stocks were stored with an argon blanket. His, Met, Nal, polysorbate, BHT, BHA, and propyl gallate stocks were stored in the dark. Table 25: Stock Buffer SolutionsComponent mM pH Tris5007.5His2507.5NaCl4000Met200~6.8EDTA200~6.8Glv200~6.8Component w / v% Solvent Mannitol10%H 2 OSucrose20%H 2 OTrehalose*2H2O22%H 2 OBHT2.50%10% H2O in EtOHBHA2.50%50% EtOH / H 2 OPropvl gallate2.50%25% EtOH in H 2 OPS8010%H 2 OPS2010%H 2 ONal20%H 2 OHPCD40%H 2 OCaptisol40%H 2 O
[0356] Compound 16 was prepared at 10 mg / mL in argon-sparged water. The Compound 16 stock was combined with buffer stock, osmolyte stock, and water to make parent stocks A-E containing Compound 16 (Table 26). The pH of each soluble parent stock was adjusted (from starting values of 6.6-6.7) to 6.8 with 0.1N NaOH. Table 26: Parent Stock FormulationsParent Stocks Parent Stock composition mLs: Total mLBuffer mM BufferOsmolyte[OsmolytelBuffer stockOsmolyte stockCmpd 16 stock (10 mg / mL)H2OA4.50Tris 11.7mannitol5.8%0.1052.6251.5750.195B24.15His 11.7mannitol5.8%1.12714.0888.4530.483C2.4His 11.7sucrose11.1%0.1121.3300.8400.118D2.4His 11.7trehalose12.3%0.1121.3360.8400.112E0.1His 11.7NaCL (mM)163.30.0050.0040.0350.056
[0357] The final formulations were then created by combining the parent stocks with other excipient stocks and water. The formulations were passed through 0.2pm sterile syringe filters. 0.4mL of Formulations 1, 3, 4, and 5 were reserved for "t0" analysis.
[0358] Two 0.3mL tubes were placed in a dark 40 °C incubator for analysis after 2d and 5d. The 2d samples were assayed after 40h (1.7d). One 0.3mL tube was subjected to "3X F / T." 1X F / T comprised freezing the material at -20 °C for at least 8h, thawing the material at room temperature (rt) in the dark (~1h), then gently mixing, inverting, and spinning to bring the material back to the bottom of the tube. This cycle was performed a total of three times. The remaining 0.3mL tube was reserved at 5 °C. One of the 0.5 mL tubes was placed in the dark at room temperature and the other 0.5 mL tube was placed in the light at room temperature. For light exposure, the tubes were placed on their side and exposed to ambient light. A volume of 0.5 mL was chosen for light exposure, as previous work had shown 0.3mL samples are prone to precipitation and degradation after light exposure in this configuration.
[0359] Stability samples were assayed by visual inspection, centrifugation, RP-HPLC, A 786 , pH, and, in some cases, SDS-PAGE. Samples were held in the dark at 5 °C when not in use. Samples were examined visually for clarity, color, and visible particulates. Samples were inverted three times and examined again. Samples were gently mixed, then centrifuged ~10,000 rpm for ~2 min. Samples were examined visually for a pellet. Remaining assays were performed on the supernatant.
[0360] Samples were prepared per the manufacturer's recommendations and then heated at 70°C for 10 min. 2.5µg in 10µL was loaded onto the SDS-PAGE gels and then run at 165 - 200V. After electrophoresis, the gels were washed in water for 5 min at room temperature, 3 times. Gels were stained at room temperature for 1h, destained in water overnight, and then destained again with water and imaged on the same day.
[0361] Formulations were produced by dissolving Compound 16 at 10 mg / mL in water, diluting into the buffer and osmolyte, adjusting the pH, adding final additives and water as needed (Table 27). Table 27: Formulations Tested at 3 mg / mL Compound 16 at pH 6.8# Buffer Osmolyte [Osm] Other [Other] Parameter examined 110 mM Trismannitol5%--Buffer310 mM Hismannitol5%--Buffer410 mM Hissucrose9.5%--Osmolyte510 mM Histrehalose10.5%--Osmolyte610 mM HisNaCl140 mM--Ionic strength710 mM Hismannitol5%NaCl10 mMIonic strength810 mM Hismannitol5%Met10 mMAntioxidant910 mM Hismannitol5%BHT0.01%Antioxidant1010 mM Hismannitol5%BHA0.01%Antioxidant1110 mM Hismannitol5%propyl gallate0.01%Antioxidant1210 mM Hismannitol5%EDTA1 mMAntioxidant synergist (metal chelator)1510 mM Hismannitol5%Gly20 mMAmino acid1610 mM Hismannitol5%PS800.02%Surfactant1710 mM Hismannitol5%PS200.02%Surfactant1910 mM Hismannitol5%HPCD5%Cyclodextrin
[0362] Formulations #6 (140mM NaCI), #12 (1mM EDTA) and #18 (0.2% Nal) had immediate gross precipitation and were discarded. In all other formulations, the material was clear, green, and had no significant visible particle formation at all timepoints tested (Table 28). Table 28: Visual Inspection. C = clear; G = emerald green; N = essentially no visible particles; F = very few particles or fibers visible; P = pellet, nt = not tested.Formulation Visual # Buffer Osmolvte Other [Other] t0 2d 40C 5d 40C 3d rt dk 3d rt lt 3X FT 1Trismannitol--CGFCGNCGFCGNCGNCGN3Hismannitol--CGNCGNCGNCGNCGNCGN4Hissucrose--CGNCGNCGNCGNCGNCGN5Histrehalose--CGNCGNCGNCGNCGNCGN6His140 mM NaCl--insolublentntntntnt7HismannitolNaCl10 mMntCGNntntntCGN8HismannitolMet10 mMntCGNCGNCGNCGNCGN9HismannitolBHT0.01%ntCGNCGNCGNCGNCGN10HismannitolBHA0.01%ntCGNCGNCGNCGNCGN11Hismannitolpropyl gallate0.01%ntCGNCGNCGNCGNCGN12HismannitolEDTA1 mMinsolublentntntntnt15HismannitolGly20 mMntCGNCGNCGFCGNCGN16HismannitolPS800.02%ntCGNCGNCGFCGNCGN17HismannitolPS200.02%ntCGNCGNCGNCGNCGN19HismannitolHPCD5%ntCGNCGNCGNCGNCGN
[0363] All samples were at pH 6.8 + / - 0.1 (Table 29). Table 29: pHFormulation pH # Buffer Osmolyte Other [Other] t0 2d 40C 5d 40C 3d rt dk 3d rt lt 3X FT 1Trismannitol--6.86.86.86.96.86.93Hismannitol--6.86.86.86.96.86.84Hissucrose--6.86.86.86.96.86.95Histrehalose--6.86.86.86.86.86.87HismannitolNaCl10 mMnt6.8ntntnt6.88HismannitolMet10 mMnt6.86.86.86.86.89HismannitolBHT0.01%nt6.86.86.86.86.810HismannitolBHA0.01%nt6.86.86.86.86.811Hismannitolpropyl gallate0.01%nt6.86.76.96.86.815HismannitolGly20 mMnt6.86.86.86.86.816HismannitolPS800.02%nt6.86.86.96.86.817HismannitolPS200.02%nt6.86.86.86.86.819HismannitolHPCD5%nt6.86.86.86.86.8
[0364] The % main peak by RP-HPLC is given in Table 30. Table 30: % Main Peak by RP-HPLC. Δ light vs. dark = % main peak after 3d room temperature in the light minus % main peak after 3d room temperature in the dark.Formulation % Main Peak # Buffer Osmolyte Other [Other] t0 2d 40C 5d 40C 3d rt lt 3X FT 1Trismannitol--97.5%93.9%85.1%73.9%97.4%3Hismannitol--98.5%94.0%86.1%92.6%98.6%7HismannitolNaCl10 mMnt95.3%ntnt98.3%8HismannitolMet10 mMnt94.3%87.5%93.0%98.6%9HismannitolBHT0.01%nt94.1%83.4%91.2%98.7%10HismannitolBHA0.01%nt93.9%84.9%91.1%98.3%11Hismannitolpropyl gallate0.01%nt88.7%72.7%89.7%98.2%15HismannitolGly20 mMnt94.4%83.9%90.9%97.7%16Hismanni...
Claims
1. A compound having the structure of Formula (III), or a pharmaceutically acceptable salt thereof: wherein: R1, R2, R3, R4, R5, R6, R7, R8 , R15, and R16 are each independently selected from hydrogen, C1-C6 alkyl, C1-C6 alkylene-COOH, sulfonate, -COOH, -SO2-NH2, or C1-C6 alkoxy; R9 is sulfonate; L1 is C3-C6 alkylene; L2 is C1-C10 alkylene; L3 is a bond, -O-, -NR10-, -NR10-C1-C6 alkylene-, -O-NR10-, -NR10-C1-C6 alkylene- (O-C1-C6 alkylene)n-, -NR10-L4-, -NR10-C1-C6 alkylene-NR11- (C (= O) -C1-C6 alkylene-O-)m-, or -NR10-C1-C6 alkylene--NR10-C1-C6 alkylene--NR10-C1-C6 alkylene-; L4 is a bond, -heterocyclyl-, or -heterocyclyl-C1-C6 alkylene-; R10 is hydrogen or C1-C6 alkyl; R11 is hydrogen or C1-C6 alkyl; R12 and R13 are independently selected from hydrogen, C1-C6 alkyl, or R12 and R13 are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring; R14 is hydrogen or C1-C6 alkylene, -(L5)-aryl, -(L5)-heteroaryl, -NR17 R18, R14 and R19 are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring, or R14 and R20 are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring; L5 is a bond, C1-C10 alkylene, -O-, or -NR10-; R17 and R18 are each independently hydrogen or aryl; R19 and R20 are independently selected from hydrogen, C1-C6 alkyl, R14 and R19 are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring, or R14 and R20 are joined together along with the other atoms to which they are attached to form a 5-membered or 6-membered carbocyclic or heterocyclic ring; n is 0, 1, 2, or 3; m is 0, 1, 2, or 3; p is 0, 1, 2, or 3; q is 0, 1, 2, or 3; and A4 is a polypeptide having at least 90% sequence identity with SEQ ID NO: 9 or a fragment thereof, wherein the fragment of A4 comprises at least 25 amino acid residues.
2. The compound of claim 1, wherein: R3, R4, R5, and R6 are each independently methyl; R1, R2, R7, R8, R15, and R16 are each independently hydrogen; R10 is hydrogen; and R12, R13, R14, R19, and R20 are each independently hydrogen; wherein: L1 is butylene and L2 is pentylene; or combinations thereof.
3. The compound of any one of claims 1 or 2 having the structure of any one of Formulas (VII), (VIII), (IX), (XI), (XIII), or (XIV):
4. The compound of any one of claims 1-3, wherein: the polypeptide comprises an isoelectric point of greater than 7.5 and three or four disulfide bonds; a lysine is replaced with a nonnaturally occurring amino acid; the fragment of A4 comprises at least 31 amino acid residues; one or more methionine residues of the polypeptide is replaced with an amino acid residue selected from isoleucine, threonine, valine, leucine, serine, glycine, alanine, or a combination thereof; the polypeptide comprises a lysine residue at the position corresponding to K-27 of native chlorotoxin, K-23 of native chlorotoxin, K-15 of native chlorotoxin, or a combination thereof; or combinations thereof.
5. The compound of any one of claims 1-4, wherein L3 is attached to A4 at a lysine amino acid residue of the polypeptide.
6. The compound of any one of claims 1-5, wherein the compound is conjugated to polyethylene glycol (PEG), hydroxyethyl starch, polyvinyl alcohol, a water soluble polymer, a zwitterionic water soluble polymer, a water soluble poly(amino acid), an albumin, or a fatty acid.
7. The compound of any one of claims 1-6, further comprising a therapeutic agent attached to A4, wherein the therapeutic agent is selected from a radioisotope, toxin, cytotoxic agent, enzyme, sensitizing drug, nucleic acid, interfering RNA, antibody, anti-angiogenic agent, cisplatin, anti-metabolite, mitotic inhibitor, growth factor inhibitor, paclitaxel, temozolomide, topotecan, fluorouracil, vincristine, vinblastine, procarbazine, dacarbazine, altretamine, methotrexate, mercaptopurine, thioguanine, fludarabine phosphate, cladribine, pentostatin, cytarabine, azacitidine, etoposide, teniposide, irinotecan, docetaxel, doxorubicin, daunorubicin, dactinomycin, idarubicin, plicamycin, mitomycin, bleomycin, tamoxifen, flutamide, leuprolide, goserelin, aminogluthimide, anastrozole, amsacrine, asparaginase, mitoxantrone, mitotane, amifostine , or a combination thereof.
8. A compound according to any one of claims 1-7 further comprising a therapeutic agent for use in a method of treating a subject in need thereof, the method comprising administering to the subject the compound according to any one of claims 1-7 further comprising the therapeutic agent in an amount sufficient to treat cancer in the subject wherein the cancer is selected from glioma, astrocytoma, medulloblastoma, choroids plexus carcinoma, ependymoma, neuroblastoma, carcinoma, head and neck cancer, lung cancer, small cell lung cancer, non-small cell lung cancer, breast cancer, intestinal cancer, pancreatic cancer, liver cancer, kidney cancer, sarcoma, osteosarcoma, rhabdomyosarcoma, Ewing's sarcoma, gastrointestinal stromal tumors, melanoma, ovarian cancer, cervical cancer, lymphoma, thyroid cancer, anal cancer, colorectal cancer, endometrial cancer, laryngeal cancer, multiple myeloma, prostate cancer, retinoblastoma, gastric cancer, testicular cancer, or Wilm's tumor.
9. A compound according to any one of claims 1-7 for use in a method of diagnosis in vivo of cancer, the method comprising: administering to a subject the compound according to any one of claims 1-7; and detecting the presence or absence of the compound according to any one of claims 1-7 in a tissue or cell, wherein the presence of said compound in the tissue or cell indicates the presence of a cancerous tissue or cancer cell.
10. The compound for use according to claim 9, further comprising surgically removing from the subject the cancerous tissue or cancer cell that is detected.
11. An ex vivo method for detecting a cancerous tissue or cancer cell, the method comprising: detecting the presence or absence of a compound according to any one of claims 1-7 in an ex vivo tissue or cell that has been obtained from a subject that has been administered the compound, wherein the presence of the compound in the tissue or cell indicates the presence of a cancerous tissue or cancer cell.
12. The compound for use according to claim 9 or 10, or the ex vivo method according to claim 11, wherein the detecting comprises fluorescence imaging.
13. A composition comprising the compound of any one of claims 1-7 and a pharmaceutically acceptable carrier.
14. The composition of claim 13, wherein the composition is formulated for intravenous administration, intravenous bolus administration, intravenous infusion administration, intramuscular administration, subcutaneous administration, intraperitoneal administration, oral administration, topical administration, transdermal administration using electroporation, intralesional administration, or a combination thereof , and / or wherein: the composition comprises a pH from 6 to 7.5; the ionic strength of the composition is less than 50 mM; the composition is stored as a lyophilized solid; or combinations thereof.
15. The composition of claim 13 or 14, further comprising: a buffer, wherein the buffer is selected from histidine, tris, HEPES, ethylene diamine, or a combination thereof; a sugar alcohol; 10 to 100 mM histidine; 2% to 10% (wt / vol %) mannitol; or combinations thereof.