Anti-cd22 antibodies and uses thereof
Patent Information
- Application Number
- EP2024716024
- Authority / Receiving Office
- EP · EP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2023-04-20
- Filing Date
- 2024-03-01
- Publication Date
- 2026-01-07
Smart Images

Figure US2024018098_06092024_PF_FP
Abstract
Description
ANTI-CD22 ANTIBODIES AND USES THEREOF CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims the benefit of, and priority to, U.S. Provisional Application No. 63 / 488,161, filed on March 2, 2023, U.S. Provisional Application No. 63 / 488,166, filed on March 2, 2023, U.S. Provisional Application No. 63 / 460,851, filed on April 20, 2023, U.S. Provisional Application No. 63 / 460,852, filed on April 20, 2023, and U.S. Provisional Application No. 63 / 460,854, filed on April 20, 2023, the contents of which are hereby each incorporated by reference in their entirety. SEQUENCE LISTING
[0002] The contents of the electronic sequence listing (183952035840SEQLIST.xml; Size: 102,253 bytes; and Date of Creation: February 29, 2024) is herein incorporated by reference in its entirety. BACKGROUND
[0003] CD22 is a cell surface sialoglycoprotein uniquely present on mature B-lymphocytes than precursor B-cells. CD22 regulates B-cell function and proliferation. As B cells mature, expression increases and localization of CD22 shifts to the cell surface. Other cells such as lymphoma, leukemic and lymphocytic B cells also produce CD22. CD22 has been implicated in autoimmune disorders and B cell malignancies. SUMMARY
[0004] The disclosure relates to, among other things, antibodies and antigen-binding fragments thereof that bind to CD22 (e.g., human CD22). For example, in one aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen-binding fragment thereof comprises a HC CDR3 comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 3. In some embodiments, the disclosure features an isolated antibody or antigen- binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen-binding fragment thereof comprises a HC CDR3 comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 51. In some embodiments, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen-binding fragment thereof comprises a HC CDR3 comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 65. Insome embodiments, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen-binding fragment thereof comprises a HC CDR3 comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 79.
[0005] In another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen- binding fragment thereof comprises a HC CDR3 comprising or consisting of an amino acid sequence that differs from SEQ ID NO: 3 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions. In some embodiments, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen- binding fragment thereof comprises a HC CDR3 comprising or consisting of an amino acid sequence that differs from SEQ ID NO: 51 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions. In some embodiments, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen- binding fragment thereof comprises a HC CDR3 comprising or consisting of an amino acid sequence that differs from SEQ ID NO: 65 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions. In some embodiments, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen- binding fragment thereof comprises a HC CDR3 comprising or consisting of an amino acid sequence that differs from SEQ ID NO: 79 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions.
[0006] In another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen- binding fragment thereof three CDRs (HC CDR1, HC CDR2 and HC CDR3) of the heavy chain variable region set forth in SEQ ID NO: 7. In some embodiments, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen- binding fragment thereof three CDRs (HC CDR1, HC CDR2 and HC CDR3) of the heavy chain variable region set forth in SEQ ID NO: 55. In some embodiments, the disclosure features an isolated antibody or antigen-bindingfragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen- binding fragment thereof three CDRs (HC CDR1, HC CDR2 and HC CDR3) of the heavy chain variable region set forth in SEQ ID NO: 69. In some embodiments, the disclosure features an isolated antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen- binding fragment thereof three CDRs (HC CDR1, HC CDR2 and HC CDR3) of the heavy chain variable region set forth in SEQ ID NO: 83. In some embodiments, the CDRs are defined according to Kabat. In some embodiments, the CDRs are defined according to Chothia. In some embodiments, the CDRs are defined according to IMGT.
[0007] In another aspect, the disclosure features an antibody or antigen-binding fragment thereof that cross-competes the binding of an antibody or antigen-binding fragment thereof comprising: (i) the amino acid sequence depicted in SEQ ID NO: 7 and the amino acid sequence depicted in SEQ ID NO: 8; (ii) the amino acid sequence depicted in SEQ ID NO: 55 and the amino acid sequence depicted in SEQ ID NO: 56; (iii) the amino acid sequence depicted in SEQ ID NO: 69 and the amino acid sequence depicted in SEQ ID NO: 70; or (iv) the amino acid sequence depicted in SEQ ID NO: 83 and the amino acid sequence depicted in SEQ ID NO: 84.
[0008] In another aspect, the disclosure features an antibody or antigen-binding fragment thereof that cross-competes the binding of an antibody or antigen-binding fragment thereof comprising: (i) a heavy chain variable region comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 7 and a light chain variable region comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 8; (ii) a heavy chain variable region comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 55 and a light chain variable region comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 56; (iii) a heavy chain variable region comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 69 and a light chain variable region comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 70; or (iv) a heavy chain variable region comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 83 and a light chain variable region comprising or consisting of the amino acid sequence depicted in SEQ ID NO: 84.
[0009] In some embodiments, any antibody or antigen-binding fragment thereof described herein comprises the three CDRs (LC CDR1, LC CDR2 and LC CDR3) of the light chain variable region set forth in SEQ ID NO: 8. In some embodiments, any antibody or antigen-binding fragment thereof described herein comprises the three CDRs (LC CDR1, LC CDR2 and LC CDR3) of the light chain variable region set forth in SEQ ID NO: 56. In some embodiments, any antibody or antigen-binding fragment thereof described herein comprises the three CDRs (LC CDR1, LC CDR2 and LC CDR3) of the light chain variable region set forth in SEQ ID NO: 70. In some embodiments, any antibody or antigen-binding fragment thereof described herein comprises the three CDRs (LC CDR1, LC CDR2 and LC CDR3) of the light chain variable region set forth in SEQ ID NO: 84. In some embodiments, the CDRs are defined according to Chothia. In some embodiments, the CDRs are defined according to IMGT.
[0010] In another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof comprising: (i) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 1 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 2, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 3; (ii) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 49 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 50, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 51; (iii) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 63 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 64, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 65; or (iv) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 63 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 78, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 79.
[0011] In another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof comprising: (i) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 1, (b) HC CDR2 is or comprises the amino acid sequence depicted inSEQ ID NO: 2, and (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 3 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; (ii) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 49, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 50, and (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 51 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; (iii) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 64, and (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 65 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; or (iv) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 78, and (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 79 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions.
[0012] In another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof comprising: (i) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 1 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 2 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 3 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; (ii) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 49 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 50 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQID NO: 51 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; (iii) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 63 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 64 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 65 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; or (iv) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 63 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 78 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 79 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions.
[0013] In another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof comprising: (i) (a) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 4 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 5, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 6; (ii) (a) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 52 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 53, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 54; (iii) (a) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 66 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) LC CDR2 is or comprises the aminoacid sequence depicted in SEQ ID NO: 67, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 68; or (iv) (a) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 80 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 81, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 82.
[0014] In another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof comprising: (i) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 4, (b) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 5 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 6; (ii) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 52, (b) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 53 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 54; (iii) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 66, (b) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 67 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 68; or (iv) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 80, (b) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 81 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 82.
[0015] In another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof comprising: (i) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 4, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 5, and (c) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 6 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; (ii) (a) LCCDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 52, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 53, and (c) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 54 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; (iii) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 66, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 67, and (c) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 68 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; or (iv) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 80, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 81, and (c) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 82 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions.
[0016] In another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof comprising: (i) (a) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 4 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 5 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 6 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; (ii) (a) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 52 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 53 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 54 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; (iii) (a) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 66 by no greaterthan four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 67 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 68 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; or (iv) (a) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 80 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 81 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 82 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions.
[0017] In yet another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof comprising: (i) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 1 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 2 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 3 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (d) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 4 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (e) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 5 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (f) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 6 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acidsubstitutions (e.g., conservative substitutions), deletions, or insertions; (ii) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 49 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 50 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 51 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (d) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 52 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (e) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 53 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (f) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 54 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; (iii) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 63 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 64 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 65 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (d) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 66 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (e) LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 67 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (f) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 68 by no greater than four (e.g., no greater than three, no greater than two,or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions; or (iv) (a) HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 63 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 78 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (c) HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 79 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (d) LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 80 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, © LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 81 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (f) LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 82 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions.
[0018] In some embodiments, any antibody or antigen-binding fragment thereof described herein comprises the heavy chain variable region sequence set forth in SEQ ID NO: 7, 55, 69, or 83.
[0019] In some embodiments, any antibody or antigen-binding fragment thereof described herein comprises the light chain variable region sequence set forth in SEQ ID NO: 8, 56, 70, or 84.
[0020] In yet another aspect, the disclosure features an antibody or antigen-binding fragment thereof that binds to CD22 (e.g., human CD22), wherein the antibody or antigen- binding fragment thereof comprises: (i) three CDRs (HC CDR1, HC CDR2 and HC CDR3) of the heavy chain variable region set forth in SEQ ID NO: 7, and three CDRs (LC CDR1, LC CDR2 and LC CDR3) of the light chain variable region set forth in SEQ ID NO: 8; (ii) three CDRs (HC CDR1, HC CDR2 and HC CDR3) of the heavy chain variable region set forth in SEQ ID NO: 55, and three CDRs (LC CDR1, LC CDR2 and LC CDR3) of the light chain variable region set forth in SEQ ID NO: 56; (iii) three CDRs (HC CDR1, HC CDR2 and HC CDR3) of the heavy chain variable region set forth in SEQ ID NO: 69, and three CDRs (LCCDR1, LC CDR2 and LC CDR3) of the light chain variable region set forth in SEQ ID NO: 70; or (iv) three CDRs (HC CDR1, HC CDR2 and HC CDR3) of the heavy chain variable region set forth in SEQ ID NO: 83, and three CDRs (LC CDR1, LC CDR2 and LC CDR3) of the light chain variable region set forth in SEQ ID NO: 84. In some embodiments, the CDRs are defined according to Kabat. In some embodiments, the CDRs are defined according to Chothia. In some embodiments, the CDRs are defined according to IMGT.
[0021] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein comprises: (i) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 1, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 2, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 3; (ii) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 49, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 50, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 51; (iii) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 64, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 65; or (iv) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 78, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 79.
[0022] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein comprises: (i) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 4, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 5, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 6; (ii) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 52, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 53, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 54; (iii) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 66, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 67, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 68; or (iv) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 80, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 81, and (c) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 82.
[0023] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein comprises: (i) (a) a HC CDR1 comprising the amino acid sequence depicted in SEQ ID NO: 1, (b) a HC CDR2 comprising the amino acid sequence depicted in SEQ ID NO: 2, (c) a HC CDR3 comprising the amino acid sequence depicted in SEQ ID NO: 3, (d) a LC CDR1 comprising the amino acid sequence depicted in SEQ ID NO: 4, (e) a LC CDR2 comprising the amino acid sequence depicted in SEQ ID NO: 5, and (f) a LC CDR3 comprising the amino acid sequence depicted in SEQ ID NO: 6; (ii) (a) a HC CDR1 comprising the amino acid sequence depicted in SEQ ID NO: 49, (b) a HC CDR2 comprising the amino acid sequence depicted in SEQ ID NO: 50, (c) a HC CDR3 comprising the amino acid sequence depicted in SEQ ID NO: 51, (d) a LC CDR1 comprising the amino acid sequence depicted in SEQ ID NO: 52, (e) a LC CDR2 comprising the amino acid sequence depicted in SEQ ID NO: 53, and (f) a LC CDR3 comprising the amino acid sequence depicted in SEQ ID NO: 54; (iii) (a) a HC CDR1 comprising the amino acid sequence depicted in SEQ ID NO: 63, (b) a HC CDR2 comprising the amino acid sequence depicted in SEQ ID NO: 64, (c) a HC CDR3 comprising the amino acid sequence depicted in SEQ ID NO: 65, (d) a LC CDR1 comprising the amino acid sequence depicted in SEQ ID NO: 66, (e) a LC CDR2 comprising the amino acid sequence depicted in SEQ ID NO: 67, and (f) a LC CDR3 comprising the amino acid sequence depicted in SEQ ID NO: 68; or (iv) (a) a HC CDR1 comprising the amino acid sequence depicted in SEQ ID NO: 63, (b) a HC CDR2 comprising the amino acid sequence depicted in SEQ ID NO: 78, (c) a HC CDR3 comprising the amino acid sequence depicted in SEQ ID NO: 79, (d) a LC CDR1 comprising the amino acid sequence depicted in SEQ ID NO: 80, (e) a LC CDR2 comprising the amino acid sequence depicted in SEQ ID NO: 81, and (f) a LC CDR3 comprising the amino acid sequence depicted in SEQ ID NO: 82.
[0024] In some embodiments, an isolated antibody or antigen-binding fragment thereof comprises (i) the heavy chain variable region sequence set forth in SEQ ID NO: 7 and / or the light chain variable region sequence set forth in SEQ ID NO: 8; (ii) the heavy chain variable region sequence set forth in SEQ ID NO: 55 and / or the light chain variable region sequence set forth in SEQ ID NO: 56; (iii) the heavy chain variable region sequence set forth in SEQ ID NO: 69 and / or the light chain variable region sequence set forth in SEQ ID NO: 70; or (iv) the heavy chain variable region sequence set forth in SEQ ID NO: 83 and / or the light chain variable region sequence set forth in SEQ ID NO: 84.
[0025] In some embodiments, an isolated antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7, 55, 69, or 83. Thus, for example, in some embodiments, an isolated antibody or antigen- binding fragment thereof described herein can comprise a heavy chain variable region comprising: (i) (a) a HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 1 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) a HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 2 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) a HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 3 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the heavy chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7; (ii) (a) a HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 49 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) a HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 50 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) a HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 51 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the heavy chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 55; (iii) (a) a HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 63 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) a HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 64 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) a HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 65 byno greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the heavy chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 69; or (iv) (a) a HC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 63 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) a HC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 78 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) a HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 79 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the heavy chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 83.
[0026] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein can comprise a heavy chain variable region comprising: (a) a HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 1; (b) a HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 2; and (c) a HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 3 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the heavy chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7.
[0027] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein can comprise a heavy chain variable region comprising: (a) a HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 49; (b) a HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 50; and (c) a HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 51 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the heavy chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 55.
[0028] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein can comprise a heavy chain variable region comprising: (a) a HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63; (b) a HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 64; and (c) a HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 65 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the heavy chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 69.
[0029] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein can comprise a heavy chain variable region comprising: (a) a HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63; (b) a HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 78; and (c) a HC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 79 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the heavy chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 83.
[0030] In some embodiments, an isolated antibody or antigen-binding fragment thereof comprises a light chain variable region comprising an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 8, 56, 70, or 84. Thus, for example, in some embodiments, an isolated antibody or antigen- binding fragment thereof described herein can comprise a light chain variable region comprising: (i) (a) a LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 4 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) a LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 5 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) a LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 6 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the light chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%,95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 8; (ii) (a) a LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 52 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) a LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 53 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) a LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 54 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the light chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 56; (iii) (a) a LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 66 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) a LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 67 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) a LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 68 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the light chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 70; or (iv) (a) a LC CDR1 is or comprises an amino acid sequence that differs from SEQ ID NO: 80 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, (b) a LC CDR2 is or comprises an amino acid sequence that differs from SEQ ID NO: 81 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, and (c) a LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 82 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the light chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 84.
[0031] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein can comprise a light chain variable region comprising: (a) a LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 4; (b) a LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 5; and (c) a LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 6 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the light chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 8.
[0032] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein can comprise a light chain variable region comprising: (a) a LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 52; (b) a LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 53; and (c) a LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 54 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the light chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 56.
[0033] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein can comprise a light chain variable region comprising: (a) a LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 66; (b) a LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 67; and (c) a LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 68 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g., conservative substitutions), deletions, or insertions, wherein the light chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 70.
[0034] In some embodiments, an isolated antibody or antigen-binding fragment thereof described herein can comprise a light chain variable region comprising: (a) a LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 80; (b) a LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 81; and (c) a LC CDR3 is or comprises an amino acid sequence that differs from SEQ ID NO: 82 by no greater than four (e.g., no greater than three, no greater than two, or one) amino acid substitutions (e.g.,conservative substitutions), deletions, or insertions, wherein the light chain variable region comprises an amino acid sequence that is at least 75% (e.g., at least 80%, 85%, 90%, 95%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 84.
[0035] In some embodiments, the anti-CD22 antibody comprises HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3, wherein: (i) (a) HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 1, (b) HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 2, (c) HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 3, (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 4, (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 5,and(f) LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 6; (ii) (a) HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 49, (b) HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 50, (c) HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 51, (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 52, (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 53,and(f) LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 54; (iii) (a) HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 63, (b) HC CDR2comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 64, (c) HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 65, (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 66, (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 67,and(f) LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 68; or (iv) (a) HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 63, (b) HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 78, (c) HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 79, (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 80, (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 81,and(f) LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 82.
[0036] In some embodiments, the anti-CD22 antibody comprises (i) a heavy chain variabledomain (VH) comprising (a)a HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 1, (b)a HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 2,and (c)a HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 3,anda light chain variable domain (VL) comprising (d)a LC CDR1 comprises an amino acidsequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 4, (e) a LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 5,and (f)a LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 6; (ii) a heavy chain variabledomain (VH) comprising (a)a HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 49, (b)a HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 50,and(c)a HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity toSEQ ID NO: 51,and a light chain variable domain (VL) comprising (d)a LC CDR1comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 52,(e)a LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 53,and (f)a LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 54; (iii) a heavy chain variabledomain (VH) comprising (a)a HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 63, (b)a HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 64,and (c)a HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%,99.9%, 99.99%, or 100% identity to SEQ ID NO: 65,and a light chain variable domain (VL)comprising (d)a LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 66,(e)a LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 67,and (f)a LC CDR3 comprises an amino acidsequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 68; or (iv) a heavy chain variabledomain (VH) comprising (a)a HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 63, (b)a HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 78,and (c)a HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ IDNO: or 79,and a light chain variable domain (VL) comprising (d)a LC CDR1 comprises anamino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 80,(e)a LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 81,and(f) a LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 82.
[0037] In some embodiments, the anti-CD22 antibody comprises the VH comprising at least two CDRs selected from (i)(a)-(c), (ii)(a)-(c), (iii)(a)-(c), or (iv)(a)-(c); the VLcomprising at least two CDRs selected from (i)(d)-(f), (ii)(d)-(f), (iii)(d)-(f), or (iv)(d)-(f); or the VHcomprises at least two CDRs selected from (i)(a)-(c), (ii)(a)-(c), (iii)(a)-(c), or (iv)(a)-(c) and the VLcomprises at leasttwo CDRs selected from (i)(d)-(f), (ii)(d)-(f), (iii)(d)-(f), or (iv)(d)-(f).
[0038] In some aspect, the present disclosure provides an antibody comprising: (i) a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 of any one of the antibodies listed in Table 1;(ii) a VH and / or a VL of any one of the antibodies listed in Table 1; or (iii) a heavy chain and / or a light chain of any one of the antibodies listed in Table 1.
[0039] In some embodiments, the antibody comprises: (i) a heavy chain comprising an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 11, and a light chain comprising an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 12; (ii) a heavy chain comprising an amino acid sequence with at least 70%, 80%, 85%, 90%,95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 57, and a light chain comprising an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 58; (iii) a heavy chain comprising an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 71, and a light chain comprising an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 72; or (iv) a heavy chain comprising an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 85, and a light chain comprising an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 86. In some embodiments, the antibody comprises: (i) a heavy chain set forth in SEQ ID NO: 11, and a light chain set forth in SEQ ID NO: 12; (ii) a heavy chain set forth in SEQ ID NO: 57, and a light chain set forth in SEQ ID NO: 58; (iii) a heavy chain set forth in SEQ ID NO: 71, and a light chain set forth in SEQ ID NO: 72; or (iv) a heavy chain set forth in SEQ ID NO: 85, and a light chain set forth in SEQ ID NO: 86.
[0040] In some aspects, the present disclosure provides an antibody comprising a HC CDR3 comprising the amino acid sequence of ARELTGDAFDX7(SEQ ID NO: 35),wherein X7is Ior L.
[0041] In some embodiments, the antibody further comprises a HC CDR1 comprising the amino acid sequence of GFX1FX2X3YG (SEQ ID NO: 33), wherein X1is T or I, X2is S or R, and X3is S or N, and / or a HC CDR2 comprising the amino acid sequence of IYYDGX4X5X6(SEQ ID NO: 34), wherein X4is N or S, X5is K or N, and X6is K or N.
[0042] In some embodiments, the antibody further comprises a LC CDR1 comprising the amino acid sequence of QX8IGSX9 (SEQ ID NO: 36), wherein X8 is S or R, and X9 is S or H, a LC CDR2 comprising the amino acid sequence of YAS, and / or a LC CDR3 comprising the amino acid sequence of HQSSX10EPYT (SEQ ID NO: 38), wherein X10is T, R, or S.
[0043] In some embodiments, the present disclosure provides an antibody comprising aHCCDR1 comprising the amino acid sequence of GFX1FX2X3YG (SEQ ID NO: 33), wherein X1 is T or I, X2is S or R, and X3is S or N, a HC CDR2 comprising the amino acid sequence of IYYDGX4X5X6(SEQ ID NO: 34), wherein X4is N or S, X5is K or N, and X6isK or N, aHC CDR3 comprising the amino acid sequence of ARELTGDAFDX7 (SEQ IDNO: 35),wherein X7 is I or L, a LC CDR1 comprising the amino acid sequence of QX8IGSX9 (SEQ ID NO: 36), wherein X8 is S or R, and X9 is S or H, a LC CDR2 comprisingthe amino acidsequence of YAS, and / or a LC CDR3 comprising the amino acid sequence of HQSSX10EPYT (SEQ ID NO: 38), wherein X10is T, R, or S.
[0044] In yet another aspect, the disclosure features an isolated antibody or antigen-binding fragment thereof that cross-competes the binding of any antibody or antigen-binding fragment described herein to CD22 (e.g., human CD22).
[0045] In some embodiments, an antibody described herein is a recombinant antibody.
[0046] In some embodiments, an antibody or antigen-binding fragment thereof described herein cross-reacts with CD22 from a non-human primate, such as a rhesus macaque.
[0047] In some embodiments, an antibody described herein is a human antibody.
[0048] In some embodiments, an antibody or antigen-binding fragment thereof described herein comprises a heavy chain constant region.
[0049] In some embodiments, an antibody or antigen-binding fragment thereof described herein comprises a heavy chain constant region.
[0050] In some embodiments, an antibody described herein is, or an antigen-binding fragment is from an antibody is a fragment of, an IgG1, an IgG2, and IgG3, an IgG4, and IgM, and IgA1, and IgA2, and IgD, or an IgE antibody. In some embodiments, an isolated antibody described herein, or an antigen-binding fragment is from an antibody is a fragment of, is an IgG1 antibody or IgG4 antibody.
[0051] In some embodiments, an antibody or antigen-binding fragment thereof described herein further comprises a heterologous moiety. In some embodiments, e.g., where the heterologous moiety is a polypeptide, the antibody or antigen-binding fragment thereof can be a fusion protein with such heterologous moiety. In some embodiments, the antibodies or antigen-binding fragments thereof can be conjugated to a heterologous moiety. The heterologous moiety can be, e.g., a cytotoxic agent, cytostatic agent, radionuclide, or detectable label. In some embodiments, the heterologous moiety can be, e.g., a heterologous polypeptide, a therapeutic agent (e.g., a toxin or a drug), or a detectable label such as, but not limited to, a radioactive label, an enzymatic label, a detectable label, such as a fluorescent label or a luminescent label, or an affinity tag, such as biotin or streptavidin. Suitable radioactive labels include, e.g.,32P,33P,14C,125I,131I,35S, and3H. Suitable fluorescent labels include, without limitation, fluorescein, fluorescein isothiocyanate (FITC), green fluorescent protein (GFP), DyLight™ 488, phycoerythrin (PE), propidium iodide (PI), PerCP, PE-AlexaFluor® 700, Cy5, allophycocyanin, and Cy7. Luminescent labels include, e.g., any of a variety of luminescent lanthanide (e.g., europium or terbium) chelates. For example, suitable europium chelates include the europium chelate of diethylene triamine pentaacetic acid (DTPA) or tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA). Enzymatic labels include, e.g., alkaline phosphatase, CAT, luciferase, and horseradish peroxidase.
[0052] In another aspect, the disclosure features a fusion protein comprising an antibody or antigen-binding fragment thereof described herein.
[0053] In another aspect, the disclosure features a bispecific or multispecific polypeptide comprising two or more different antigen-binding domains, wherein at least one of the two or more different antigen-binding domains comprises an antibody or antigen-binding fragment thereof described herein.
[0054] In yet another aspect, the disclosure features an isolated nucleic acid encoding a polypeptide, wherein polypeptide is or comprises any one or more of the antibodies or antigen-binding fragments thereof described herein, any of the fusion proteins described herein, or any bispecific or multispecific polypeptide described herein.
[0055] In another aspect, the disclosure features an expression vector comprising one or more of the nucleic acids described herein. Also featured is a cell (e.g., a recombinant cell) comprising any of the nucleic acids and / or expression vectors described herein.
[0056] In another aspect, the disclosure features a method for expressing a polypeptide, the method comprising culturing the cell, recombinant cell, or a plurality of such cells or recombinant cells, under conditions suitable for expression of the polypeptide from the expression vector by the cell or cells. In some embodiments, the methods can further comprise isolating the polypeptide from the cell or cells and / or from the culture media in which the cell or cells were cultured. Also featured is an isolated polypeptide produced from the methods described herein.
[0057] In yet another aspect, the disclosure features a pharmaceutical composition comprising: (i) any one or more of the antibodies or antigen-binding fragments thereof described herein, (ii) any one or more of the fusion proteins described herein, (iii) any one or more of the bispecific or multispecific polypeptides described herein; (iv) any one or more of the nucleic acids described herein; (v) any one or more of the expression vectors described herein; (vi) any one or more of the recombinant cells described herein; and / or (vii) any one or more of the isolated polypeptides described herein; and (b) a pharmaceutically acceptable carrier or excipient.
[0058] In yet another aspect, the disclosure features a method for treating a B cell disorder, the method comprising administering to a subject with a B cell disorder an effective amount of a therapeutic agent, thereby treating the B cell disorder, wherein the therapeutic agent is or comprises: (i) any one or more of the antibodies or antigen-binding fragments thereof described herein (including conjugates), (ii) any one or more of the fusion proteins described herein, (iii) any one or more of the bispecific or multispecific polypeptides described herein; (iv) any one or more of the nucleic acids described herein; (v) any one or more of the expression vectors described herein; (vi) any one or more of the recombinant cells described herein; (vii) any one or more of the isolated polypeptides described herein; and / or (viii) any one or more of the pharmaceutical compositions described herein.
[0059] In some embodiments, the B cell disorder is an autoimmune disease, such as wherein the autoimmune disease is rheumatoid arthritis, systemic lupus erythematosus (SLE), myasthenia gravis, Graves’ disease, or immune thrombocytopenic purpura (ITP).
[0060] In some embodiments, the B cell disorder is a cancer. The cancer can be, e.g., a B cell lymphoma, such as a non-Hodgkin lymphoma. The non-Hodgkin lymphoma can be, e.g., Burkitt lymphoma, chronic lymphocytic leukemia (CLL), diffuse large B-cell lymphoma, follicular lymphoma, or mantle cell lymphoma.
[0061] In yet another aspect, the disclosure features a method for preventing, reducing, delaying or inhibiting the proliferation and / or growth of a cancer cell comprising contacting the cancer cell with a therapeutic agent that binds to CD22 expressed on the surface of the cancer cell, wherein the therapeutic agent is: (i) any one or more of the antibodies or antigen- binding fragments thereof described herein (including conjugates), (ii) any one or more of the fusion proteins described herein, (iii) any one or more of the bispecific or multispecific polypeptides described herein; (iv) any one or more of the recombinant cells described herein; (v) any one or more of the isolated polypeptides described herein; and / or (vi) any one or more of the pharmaceutical compositions described herein.
[0062] In certain embodiments, the therapeutic agent can be administered through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, subcutaneously, intra-ocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices. In certain embodiments, the compositions can be administered by bolus injection or continuously by infusion, or by implantation device.
[0063] In some aspects, the present disclosure provides a chimeric antigen receptor (CAR) comprising the anti-CD22 antibody described herein.
[0064] In some embodiments, the CAR further comprises a hinge region. In some embodiments, the CAR further comprises a transmembrane domain. In some embodiments, the CAR further comprises an intracellular domain. In some embodiments, the CAR further comprises a co-stimulatory domain.
[0065] In some aspects, the present disclosure provides an isolated nucleic acid encoding the anti-CD22 CAR described herein.
[0066] In some embodiments, the present disclosure provides an expression vector comprising the isolated nucleic acid encoding the anti-CD22 CAR described herein.
[0067] In some embodiments, the present disclosure provides an immune cell expressing the anti-CD22 CAR described herein. In some embodiments, the immune cell comprises the isolated nucleic acid or the expression vector encoding the anti-CD22 CAR.
[0068] In some embodiments, the immune cell is a T cell, a NK cell, or a NKT cell.
[0069] In some embodiments, the present disclosure provides a composition comprising the immune cell expressing the anti-CD22 CAR, and a pharmaceutically acceptable carrier.
[0070] In some aspects, the present disclosure provides a method for treating a B cell disorder described herein. In some embodiments, the immune cell is administered intravenously. In some embodiments, the immune cell is administered subcutaneously. BRIEF DESCRIPTION OF THE DRAWINGS
[0071] The accompanying drawings, which are incorporated in and constitute a part of this specification, illustrate certain embodiments, and together with the written description, serve to provide non-limiting examples of certain aspects of the compositions and methods disclosed herein.
[0072] FIGs. 1A-1D are sensograms showing detector response versus time for the interaction between CD22 mAb-1 (FIG. 1A), mAb-2 (FIG. 1B), mAb-3 (FIG. 1C), and mAb-4 (FIG. 1D) and the immobilized recombinant human CD22. DETAILED DESCRIPTION
[0073] The present disclosure, at least in part, is based on the development of anti-CD22 antibodies and their variants thereof, which showed high binding affinity and specificity to CD22. Also provided are the use of the anti-CD22 antibodies and their variants in research, diagnostic / detection, and therapeutic applications.
[0074] The foregoing and other aspects, implementations, acts, functionalities, features and embodiments of the present teachings can be more fully understood from the following description in conjunction with the accompanying drawings. I. Definitions
[0075] Administering: As used herein, the terms “administering” or “administration” means to provide an antibody or a composition thereof to a subject in a manner that is physiologically and / or pharmacologically useful (e.g., to treat a condition in the subject).
[0076] Affinity Matured Antibody: “Affinity Matured Antibody” is used herein to refer to an antibody with one or more alterations in one or more CDRs, which result in an improvement in the affinity (i.e., KD, kd or ka) of the antibody for a target antigen compared to a parent antibody, which does not possess the alteration(s). Exemplary affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen. A variety of procedures for producing affinity matured antibodies are known in the art, including the screening of a combinatory antibody library that has been prepared using bio-display. For example, Marks et al., BioTechnology, 10: 779-783 (1992) describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and / or framework residues is described by Barbas et al., Proc. Nat. Acad. Sci. USA, 91: 3809-3813 (1994); Schier et al., Gene, 169: 147-155 (1995); Yelton et al., J. Immunol., 155: 1994-2004 (1995); Jackson et al., J. Immunol., 154(7): 3310-3319 (1995); and Hawkins et al, J. Mol. Biol., 226: 889-896 (1992). Selective mutation at selective mutagenesis positions and at contact or hypermutation positions with an activity-enhancing amino acid residue is described in U.S. Pat. No. 6,914,128 B1.
[0077] Antibody: As used herein, the term “antibody” refers to a polypeptide that includes at least one immunoglobulin variable domain or at least one site, e.g., paratope, that specifically binds to an antigen. In some embodiments, an antibody comprises a paratope. In some embodiments, a paratope comprise one or more complementarity determining region (CDRs). In some embodiments, an antibody is a full-length antibody. In some embodiments, an antibody is a chimeric antibody. In some embodiments, an antibody is a humanized antibody. However, in some embodiments, an antibody is a Fab fragment, a F(ab')2 fragment, a Fv fragment or a scFv fragment. In some embodiments, an antibody is a nanobody derived from a camelid antibody or a nanobody derived from shark antibody. In some embodiments, an antibody is a diabody. In some embodiments, an antibody comprises a framework having a human germline sequence. In another embodiment, an antibody comprises a heavy chainconstant domain selected from the group consisting of IgG, IgG1, IgG2, IgG2A, IgG2B, IgG2C, IgG3, IgG4, IgA1, IgA2, IgD, IgM, and IgE constant domains. In some embodiments, an antibody comprises a heavy (H) chain variable region (abbreviated herein as VH), and / or a light (L) chain variable region (abbreviated herein as VL). In some embodiments, an antibody comprises a constant domain, e.g., an Fc region. An immunoglobulin constant domain refers to a heavy or light chain constant domain. Human IgG heavy chain and light chain constant domain amino acid sequences and their functional variations are known. With respect to the heavy chain, in some embodiments, the heavy chain of an antibody described herein can be an alpha ^Į^^ delta ('), epsilon (H), gamma ^Ȗ^ or mu (µ) heavy chain. In some embodiments, the heavy chain of an antibody described herein can comprise a human alpha ^Į^^ delta ('), epsilon (H), gamma ^Ȗ^ or mu (µ) heavy chain. In a particular embodiment, an antibody described herein comprises a human gamma 1 CH1, CH2, and / or CH3 domain. In some embodiments, the amino acid sequence of the VH domain FRPSULVHV^WKH^DPLQR^DFLG^VHTXHQFH^RI^D^KXPDQ^JDPPD^^Ȗ^^KHDY\^FKDLQ^FRQVWDQW^UHJLRQ^^VXFK^ as any known in the art. Non-limiting examples of human constant region sequences have been described in the art, e.g., see U.S. Pat. No. 5,693,780 and Kabat E A et al., (1991) supra. In some embodiments, the VH domain comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or at least 99% identical to any of the variable chain constant regions provided herein. In some embodiments, an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and / or methylation. In some embodiments, an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules. In some embodiments, the one or more sugar or carbohydrate molecule are conjugated to the antibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and / or phosphoglycosylation. In some embodiments, the one or more sugar or carbohydrate molecule are monosaccharides, disaccharides, oligosaccharides, or glycans. In some embodiments, the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan. In some embodiments, the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, or a phospholipid unit. In some embodiments, an antibody is a construct that comprises a polypeptide comprising one or more antigen binding fragments of the disclosure linked to a linker polypeptide or an immunoglobulin constant domain. Linker polypeptides comprise two or more amino acid residues joined by peptide bonds and are used to link one or more antigen binding portions. Examples of linkerpolypeptides have been reported (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123). Still further, an antibody may be part of a larger immunoadhesion molecule, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides. Examples of such immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al. (1994) Mol. Immunol. 31:1047-1058). In some embodiments, an antibody can be a bispecific and a multispecific antibody.
[0078] Approximately: As used herein, the term “approximately” or “about,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range of values that fall within 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
[0079] CDR: As used herein, the term "CDR" refers to the complementarity determining region within antibody variable sequences. A typical antibody molecule comprises a heavy chain variable region (VH) and a light chain variable region (VL), which are usually involved in antigen binding. The VH and VL regions can be further subdivided into regions of hypervariability, also known as “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, which are known as “framework regions” (“FR”). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The extent of the framework region and CDRs can be precisely identified using methodology known in the art, for example, by the Kabat definition, the IMGT definition, the Chothia definition, the AbM definition, and / or the contact definition, all of which are well known in the art. See, e.g., Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; IMGT®, the international ImMunoGeneTics information system® http: / / www.imgt.org, Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [[Epub]], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); Chothia et al., (1989) Nature 342:877; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917, Al-lazikani et al (1997) J. Molec. Biol. 273:927-948; and Almagro, J. Mol. Recognit. 17:132-143 (2004). ee also hgmp.mrc.ac.uk and bioinf.org.uk / abs. As used herein, a CDR may refer to the CDR defined by any method known in the art. Two antibodies having the same CDR means that the two antibodies have the same amino acid sequence of that CDR as determined by the same method, for example, the IMGT definition.
[0080] In certain embodiments, there are three CDRs in each of the variable regions of a heavy chain and a light chain, which are designated CDR1, CDR2 and CDR3, for each of the variable regions. The term "CDR set" as used herein refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) and (1991)) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs. These CDRs may be referred to as Kabat CDRs. Sub-portions of CDRs may be designated as LC CDR1, LC CDR2 and LC CDR3 or HC CDR1, HC CDR2 and HC CDR3 where the "LC" and the "HC" designates the light chain and the heavy chain regions, respectively. These regions may be referred to as Chothia CDRs, which have boundaries that overlap with Kabat CDRs. Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (FASEB J. 9:133- 139 (1995)) and MacCallum (J Mol Biol 262(5):732-45 (1996)). Still other CDR boundary definitions may not strictly follow one of the above systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding. The methods used herein may utilize CDRs defined according to any of these systems, although preferred embodiments use Kabat or Chothia defined CDRs.
[0081] In certain embodiments, the CDRs of an antibody may have different amino acid sequences when different definition systems are used (e.g., the IMGT definition, the Kabatdefinition, or the Chothia definition). A definition system annotates each amino acid in a given antibody sequence (e.g., VH or VL sequence) with a number, and numbers corresponding to the heavy chain and light chain CDRs are provided in Table 2. The CDRs listed in Table 1 are defined in accordance with the Kabat definition. One skilled in the art is able to derive the CDR sequences using the different numbering systems for the anti-CD22 antibodies provided in Table 1. Table 2. CDR Definitions1IMGT®, the international ImMunoGeneTics information system®, imgt.org, Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999)2Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-32423Chothia et al., J. Mol. Biol. 196:901-917 (1987))
[0082] CDR-grafted antibody: The term "CDR-grafted antibody" refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and / or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.
[0083] Chimeric antibody: The term "chimeric antibody" refers to antibodies which comprise heavy and light chain variable region sequences from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.
[0084] Complementary: As used herein, the term “complementary” refers to the capacity for precise pairing between two nucleotides or two sets of nucleotides. In particular, complementary is a term that characterizes an extent of hydrogen bond pairing that brings about binding between two nucleotides or two sets of nucleotides. For example, if a base atone position of an oligonucleotide is capable of hydrogen bonding with a base at the corresponding position of a target nucleic acid (e.g., an mRNA), then the bases are considered to be complementary to each other at that position. Base pairings may include both canonical Watson-Crick base pairing and non-Watson-Crick base pairing (e.g., Wobble base pairing and Hoogsteen base pairing). For example, in some embodiments, for complementary base pairings, adenosine-type bases (A) are complementary to thymidine- type bases (T) or uracil-type bases (U), that cytosine-type bases (C) are complementary to guanosine-type bases (G), and that universal bases such as 3-nitropyrrole or 5-nitroindole can hybridize to and are considered complementary to any A, C, U, or T. Inosine (I) has also been considered in the art to be a universal base and is considered complementary to any A, C, U, or T.
[0085] Compete: The term “compete”, as used herein with regard to an antibody, means that a first antibody binds to an epitope of a protein (e.g., CD22) in a manner sufficiently similar to the binding of a second antibody, such that the result of binding of the first antibody with its epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody. The alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody, can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope. However, where each antibody detectably inhibits the binding of the other antibody with its epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to “Cross-compete” with each other for binding of their respective epitope(s). In some embodiments, antibodies that compete or cross-compete bind to the same or overlapping epitopes. Regardless of the mechanism by which such competition or cross-competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate that such competing and / or cross-competing antibodies are encompassed and can be useful for the methods and / or compositions provided herein.
[0086] Conjugated: As used herein, “conjugated” means two entities are associated, preferably with sufficient affinity that a therapeutic / diagnostic benefit of the association between the two entities is realized. The association between the two entities can be either direct or via a linker, such as a polymer linker. Conjugated can include covalent or noncovalent bonding as well as other forms of association, such as entrapment, e.g., of oneentity on or within the other, or of either or both entities on or within a third entity, such as a micelle.
[0087] Conservative amino acid substitution: As used herein, a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Fourth Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 2012, or Current Protocols in Molecular Biology, F.M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
[0088] Cross-reactive: As used herein and in the context of a targeting agent (e.g., antibody), the term “cross-reactive,” refers to a property of the agent being capable of specifically binding to more than one antigen of a similar type or class (e.g., antigens of multiple homologs, paralogs, or orthologs) with similar affinity or avidity. For example, in some embodiments, an antibody that is cross-reactive against human and non-human primate antigens of a similar type or class (e.g., a human CD22 and non-human primate CD22) is capable of binding to the human antigen and non-human primate antigens with a similar affinity or avidity. In some embodiments, an antibody is cross-reactive against a human antigen and a rodent antigen of a similar type or class. In some embodiments, an antibody is cross-reactive against a rodent antigen and a non-human primate antigen of a similar type or class. In some embodiments, an antibody is cross-reactive against a human antigen, a non- human primate antigen, and a rodent antigen of a similar type or class.
[0089] Cytotoxic agent: As used herein, the term "cytotoxic agent" refers to a substance that inhibits or prevents a cellular function and / or causes cell death or destruction. Such agents are well known in the art, and include, e.g., radioactive isotopes (e.g., At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamycin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin, or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof, such as nucleolytic enzymes; antibiotics; toxins such as small moleculetoxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and / or variants thereof; and the various anti-tumor or anti-cancer agents described below.
[0090] Chemotherapeutic agent: As used herein, a "chemotherapeutic agent" refers to a chemical compound useful in the treatment of proliferative disorders, such as cancers (e.g., cancers expressing CD22). These agents can be, e.g., alkylating agents, such as thiotepa and cyclophosphamide (CYTOXAN®); alkylsulfonates such as busulfan, improsulfan and piposulfane; aziridines such as benzodopa, carbocuone, meturedopa and uredopa; ethylene imines and methylamelamines, including altretamine, triethylene methamine, triethylene phosphoramide, triethylene-thiophosphoramide and trimethylolomelamine; acetogenins (especially bulatacin and bulatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARINOL); beta-lapacona; lapacol; Colchicines; betulinic acid; a camptothecin (which includes the synthetic analog topotecan (HYCAMTIN®), CPT-11 (irinotecan, CAMPTOSAR), acetylcamptothecin, scopolectin and 9-aminocamptothecin); Bryostatin; Callistatin; CC-1065 (including its synthetic analogs of adozelesin, carzelesin and bizelesin); podophyllotoxin; podophyllinic acid; teniposide; cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (which include the synthetic analogs, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictiina, -pongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, colofosfamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterin, prednimustine, trofosfamidea, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine and ranimnustine; antibiotics, such as enediin antibiotics (eg, calicheamicin, especially gammall calicheamicin and omegall calicheamicin (see, for example, Agnew, Chem Intl. Ed. Engl., 33: 183-186 (1994)); dynemycin, including dynemycin A; a esperamycin; as well as neocarzinostatin chromophore and chromophores of related chromoprotein antibiotics), aclacinomisins, actinomycin, autramycin, azaserin, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorrubicin, 6-diazo-5-oxo- L-norleucine, doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino- doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin , chelamicin, rodrububicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogues such as fludarabine, 6-mercaptopurine, tiamiprin, thioguanine; analogues of pyrimidine such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocythabin, floxuridine; androgens such as calusterone, dromostanolone propionate, epithiostanol, mepitiostane, testolactone; antisuprenal drugs such as aminoglutethimide, mitotane, trilostane; folic acid enhancer such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabuchil; bisantrene; edatraxate; defofamin; demecolcine; diazicuone; elfornitin; eliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainin; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; fenamet; pirarubicin; losoxantrone; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, OR); razoxane; rhizoxin; sizofirano; spirogermanium; tenuazonic acid; triazicuone; 2,2 ', 2"- trichlorotriethylamine, trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine), urethane, vindesine (ELDISINE, FILDESIN), dacarbazine, manomustine, mitobronitol, mitolactol, pipobroman, gacitosin, arabinoside ("Ara-C"), thiotepa, taxoids, for example, paclitaxel (TAXOL, Bristol-Myers Squibb Oncology, Princeton, NJ), Cremophor- free ABRAXANE ™, nanoparticle formulation modified with paclitaxel albumin (American Pharmaceutical Partners, Schaumberg, Illinois), and docetaxel (TAXOTERE®; Rhone- Poulenc Rorer, Antony, France); chloranbuchil; gemcitabine (GEMZAR); 6-thioguanine; mercaptopurine; methotrexate; platinum analogues such as cisplatin and carboplatin; vinblastine (VELBAN®); platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine (ONCOVIN®); oxaliplatin; leucovovina; vinorrelbine (NAVELBINE®); novantrone; edatrexate; Daunomycin; aminopterin; ibandronate; Topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; capecitabine (XELODA®); pharmaceutically acceptable salts, acids or derivatives of any of the foregoing; as well as combinations of two or more of the foregoing such as CHOP, an abbreviation for a combination therapy of cyclophosphamide, doxorubicin, vincristine and prednisolone; CVP, an abbreviation for a combination therapy of cyclophosphamide, vincristine and prednisolone; and FOLFOX, an abbreviation for an oxaliplatin treatment regimen (ELOXATIN ™) combined with 5-FU and leucovorin.
[0091] Effective Amount: As used herein, “an effective amount” refers to the amount of each active agent (e.g., anti-CD22 antibody) required to confer a desired effect (e.g., atherapeutic effect on the subject), either alone or in combination with one or more other active agents. In some embodiments, the therapeutic effect is reduced CD22 level or activity, and / or alleviated disease conditions (e.g., B Cell disorder).
[0092] Framework: As used herein, the term "framework" or "framework sequence" refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a framework sequence is subject to correspondingly different interpretations. The six CDRs (LC CDR1, LC CDR2, and LC CDR3 of the light chain and HC CDR1, HC CDR2, and HC CDR3 of the heavy chain) also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4. Without specifying the particular sub-regions as FR1, FR2, FR3 or FR4, a framework region, as referred by others, represents the combined FRs within the variable region of a single, naturally occurring immunoglobulin chain. As used herein, a FR represents one of the four sub-regions, and FRs represents two or more of the four sub-regions constituting a framework region. Human heavy chain and light chain acceptor sequences are known in the art. In one embodiment, the acceptor sequences known in the art may be used in the antibodies disclosed herein.
[0093] Human antibody: The term "human antibody", as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3. However, the term "human antibody", as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
[0094] Humanized antibody: The term "humanized antibody" refers to antibodies which comprise heavy and light chain variable region sequences from a non-human species (e.g., amouse)but in which at least a portion of the VH and / or VL sequence has been altered to be more "human-like", i.e., more similar to human germline variable sequences. One type of humanized antibody is a CDR-grafted antibody, in which human CDR sequences are introduced into non-human VH and VL sequences to replace the corresponding nonhumanCDR sequences. In one embodiment, humanized anti-CD22 antibodies and antigen binding portions are provided. Such antibodies may be generated by obtaining murine anti-CD22 monoclonal antibodies using traditional hybridoma technology followed by humanization using in vitro genetic engineering, such as those disclosed in Kasaian et al PCT publication No. WO 2005 / 123126 A2.
[0095] Humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity. In some embodiments, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non- human residues. Furthermore, the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Antibodies may have Fc regions modified as described in WO 99 / 58572. Other forms of humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody, which are also termed one or more CDRs derived from one or more CDRs from the original antibody. Humanized antibodies may also involve affinity maturation.
[0096] In some embodiments, humanization is achieved by grafting the CDRs (e.g., as shown in Table 1) into the human variable domains (e.g., IGKV1-NL1*01 and IGHV1-3*01 human variable domain). In some embodiments, the anti-CD22 antibody of the present disclosure is a humanized variant comprising one or more amino acid substitutions (e.g., in the VH framework region) as compared with any one of the VHs listed in Table 1, and / or one or more amino acid substitutions (e.g., in the VL framework region) as compared with any one of the VLs listed in Table 1.
[0097] Isolated antibody: An "isolated antibody", as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds CD22 is substantially free of antibodies thatspecifically bind antigens other than CD22). An isolated antibody that specifically binds CD22 may, however, have cross-reactivity to other antigens. Moreover, an isolated antibody may be substantially free of other cellular material and / or chemicals.
[0098] Kabat numbering: The terms "Kabat numbering", "Kabat definitions and "Kabat labeling" are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e. hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad, Sci. 190:382-391 and, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). For the heavy chain variable region, the hypervariable region ranges from amino acid positions 31 to 35 for CDR1, amino acid positions 50 to 65 for CDR2, and amino acid positions 95 to 102 for CDR3. For the light chain variable region, the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3.
[0099] Recombinant antibody: The term "recombinant antibody", as used herein, is intended to include all antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described in more details in this disclosure), including, for example, antibodies isolated from a recombinant, combinatorial human antibody library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem.35:425-445; Gavilondo J. V., and Larrick J. W. (2002) BioTechniques 29:128- 145; Hoogenboom H., and Chames P. (2000) Immunology Today 21:371-378), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor, L. D., et al. (1992) Nucl. Acids Res. 20:6287-6295; Kellermann S-A., and Green L. L. (2002) Current Opinion in Biotechnology 13:593-597; Little M. et al (2000) Immunology Today 21:364-370) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences. In some embodiments, recombinant human antibodies are provided herein. In certain embodiments, such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the aminoacid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo. One embodiment of the disclosure provides fully human antibodies capable of binding human CD22 which can be generated using techniques well known in the art, such as, but not limited to, using human Ig phage libraries such as those disclosed in Jermutus et al., PCT publication No. WO 2005 / 007699 A2.
[0100] Selective: As used herein, the term “selective” or “selectively” refers to the ability of a molecule to produce an effect (e.g., inhibit, antagonize, agonize, etc) in relation to its target molecule compared to a reference molecule. For example, a molecule that selectively inhibits its target molecule means that this molecule is capable of inhibiting its target molecule with a degree that is distinguishable from a reference molecule in an inhibition assay or other inhibitory context. For example, with respect to an inhibitor, the term, “selectively inhibits”, refers to the ability of the inhibitor to inhibit its target molecule with a degree that is distinguishable from a reference molecule that is not substantially inhibited in an inhibition assay, e.g., to an extent that permit selective inhibition of the target molecule, as described herein. Once the reaction is terminated, the signal produced by inhibiting the target molecule can be measured. The half maximal inhibitor concentration for the target molecule and the reference molecule can be calculated. In some embodiments, a molecule described herein selectively binds to a target molecule. In some embodiments, a molecule described herein selectively inhibits a target molecule (e.g., CD22). In some embodiments, a molecule described herein selectively antagonizes a target molecule (e.g., CD22). In some embodiments, a molecule described herein selectively neutralizes a target molecule (e.g., CD22).
[0101] Specifically binds: As used herein, the term “specifically binds” refers to the ability of a molecule to bind to a binding partner with a degree of affinity or avidity that enables the molecule to be used to distinguish the binding partner from an appropriate control in a binding assay or other binding context. With respect to an antibody, the term, “specifically binds”, refers to the ability of the antibody to bind to a specific antigen with a degree of affinity or avidity, compared with an appropriate reference antigen or antigens, that enables the antibody to be used to distinguish the specific antigen from others, as described herein. In some embodiments, an antibody specifically binds to a target if the antibody has aKDforbinding the target of at least about 10-4M, 10-5M, 10-6M, 10-7M, 10-8M, 10-9M, 10- 10M,10-11M, 10-12M, 10-13M, or less. In some embodiments, an antibody specifically binds CD22.
[0102] Subject: As used herein, the term “subject” refers to a mammal. In some embodiments, a subject is non-human primate, or rodent. In some embodiments, a subject is a human. In some embodiments, a subject is a patient, e.g., a human patient that has or is suspected of having a disease. In some embodiments, the subject is a human patient who has or is suspected of having a B cell disorder and / or one or more conditions arising as a result of a B cell disorder.
[0103] Treatment: As used herein, the term “treating” or “treatment” refers to the application or administration of a composition including one or more active agents (e.g., anti- CD22 antibodies) to a subject, who has a target disease or disorder, a symptom of the disease / disorder, or a predisposition toward the disease / disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward the disease or disorder. Alleviating a target disease / disorder includes delaying or preventing the development or progression of the disease, or reducing disease severity. II. Antibodies and Related Compositions (a) Anti-CD22 Antibodies
[0104] In some embodiments, the anti-CD22 antibody is an antibody specific for CD22. Provided herein, in some aspects, are antibodies that bind to human CD22 with high specificity and affinity. In some embodiments, the anti-CD22 antibody described herein specifically binds to any extracellular epitope of a CD22 or an epitope that becomes exposed to an antibody. In some embodiments, anti-CD22 antibodies provided herein bind specifically to CD22 from human, non-human primates, mouse, rat, etc. In some embodiments, anti-CD22 antibodies provided herein bind to human CD22. In some embodiments, the anti-CD22 antibody described herein binds to an amino acid segment of a human or non-human primate CD22. CD22 is a molecule belonging to the SIGLEC family of lectins. It is found on the surface of mature B cells and to a lesser extent on some immature B cells. In some embodiments, CD22 acts as a immune regulatory molecule (e.g., prevents the overactivation of the immune system and the development of autoimmune diseases). In some embodiments, CD22 regulates B-cell function and proliferation (see, e.g., Shah et al., Targeting CD22 for the Treatment of B-Cell Malignancies. ImmunoTargets and therapy, 2021, 10, 225–236).
[0105] In some embodiments, an anti-CD22 antibody described herein specifically binds to human CD22. Exemplary amino acid sequences of human CD22 are set forth in NCBI Accession Numbers NP_001172028, NP_001172028.1, NP_001172029, NP_001172029.1, NP_001172030, NP_001172030.1, NP_001265346, NP_001265346.1, NP_001762.2, or NP_001762, and UniProt Accession Numbers A0A087WZQ4, A0A2I3RQA0, A0A2I3T384, A0A2J8QHH2, A0A2R9BGV8, A0A2R9BHT7, A0A2R9BQF7, A0A5F9D606, G1PJ35, G1STP5, H0VKS5, H2QG24, M0QY05, M0QY14, M0QYP4, M0QZ01, M0QZP5, M0QZR7, M0R0R6, M0R1M2, M0R2M0, M0R2R8, M0R3H1, O60926, O95700, Q0EAF5, Q9UQB1, Q9UQB2, P20273, Q9N1E3, Q9N1E4, Q9N1E5, Q9N1E6.
[0106] In some embodiments, the anti-CD22 antibody described herein specifically binds to an epitope on human CD22 (e.g., extracellular domain(s) (ECD) of human CD22 described herein). An exemplary amino acid sequence of the extracellular domains of a human CD22 is set forth in any one of SEQ ID NOs: 45-48.
[0107] Human CD22 full ECD domains 1-7 (SEQ ID NO: 45)
[0108] DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFD GTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKW MERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAA VTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEI KVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQS GKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPT NYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYP PKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVG WDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSS HPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLY APRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLE PVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR
[0109] Human CD22 full ECD domains 1-7 with Avi-His Tag (SEQ ID NO: 46)
[0110] DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFD GTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKW MERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAA VTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEI KVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQS GKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYP PKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVG WDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSS HPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLY APRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLE PVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRGGGGSGLNDIFEAQKIE WHEGGGGSHHHHHH
[0111] Human CD22 full ECD domains 4-7 with Avi-His Tag (SEQ ID NO: 47)
[0112] QYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEE KVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDT VTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSW ASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLG KESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVME GKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNS VGKGRSPLSTLTVYYSPETIGRRGGGGSGLNDIFE AQKIEWHEGGGGSHHHHHH
[0113] Human CD22 full ECD domains 1-3 with Avi-His Tag (SEQ ID NO: 48)
[0114] DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFD GTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKW MERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAA VTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEI KVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQS GKYCCQVSNDVGPGRSEEVFLQVQYAGGGGSGLNDIFEAQKIEWHEGGGGSHHH HHH
[0115] In some embodiments, an anti-CD22 antibody described herein may bind to a fragment of a human CD22 (e.g., human CD22 described herein) may be between about 5 and about 425 amino acids, between about 10 and about 400 amino acids, between about 50 and about 350 amino acids, between about 100 and about 300 amino acids, between about 150 and about 250 amino acids, between about 200 and about 300 amino acids, or between about 75 and about 150 amino acids in length. The fragment may comprise a contiguous number of amino acids from human CD22 (e.g., human CD22 ECD domains as set forth in any one of SEQ ID NOs: 45-48 described herein).
[0116] In some embodiments, an anti-CD22 antibody described herein specifically binds to mouse CD22. Exemplary amino acid sequences of mouse CD22 are set forth in NCBIAccession Numbers NP_001036782, NP_001036782.1, NP_033975.3, or NP_033975, and Uniprot Accession Numbers P35329, Q3U0M3, Q9JHK8, A0A8B7H4W8, A0A087WQ27, A0A087WQV3, A0A087WR31, A0A087WR96, A0A087WST4, A0A1L1SSS3, A0A6I9LN61, A0A6I9LTY4, A0A6P5PYI2, or A0A6P5Q630.
[0117] In some embodiments, the anti-CD22 antibody described herein specifically binds to an epitope on mouse CD22 (e.g., extracellular domain(s) (ECD) of mouse CD22 described herein). An exemplary amino acid sequence of the extracellular domains of a mouse CD22 is set forth in SEQ ID NO: 37.
[0118] Mouse CD22 full ECD domains (SEQ ID NO: 37)
[0119] SANDWTVDHPQTLFAWEGACIRIPCKYKTPLPKARLDNILLFQNYEFDKATK KFTGTVLYNATKTEKDPESELYLSKQGRVTFLGNRIDNCTLKIHPIRANDSGNLGLRM TAGTERWMEPIHLNVSEKPFQPYIQMPSEIRESQSVTLTCGLNFSCFGYDILLKWFLED SEITSITSSVTSITSSVTSSIKNVYTESKLTFQPKWTDHGKSVKCQVQHSSKVLSERTVR LDVKYTPKLEIKVNPTEVEKNNSVTMTCRVNSSNPKLRTVAVSWFKDGRPLEDQELE QEQQMSKLILHSVTKDMRGKYRCQASNDIGPGESEEVELTVHYAPEPSRVHIYPSPAE EGQSVELICESLASPSATNYTWYHNRKPIPGDTQEKLRIPKVSPWHAGNYSCLAENRL GHGKIDQEAKLDVHYAPKAVTTVIQSFTPILEGDSVTLVCRYNSSNPDVTSYRWNPQG SGSVLKPGVLRIQKVTWDSMPVSCAACNHKCSWALPVILNVHYAPRDVKVLKVSPAS EIRAGQRVLLQCDFAESNPAEVRFFWKKNGSLVQEGRYLSFGSVSPEDSGNYNCMVN NSIGETLSQAWNLQVLYAPRRLRVSISPGDHVMEGKKATLSCESDANPPISQYTWFDS SGQDLHSSGQK
[0120] In some embodiments, an anti-CD22 antibody described herein may bind to a fragment of a mouse CD22 (e.g., mouse CD22 described herein) may be between about 5 and about 425 amino acids, between about 10 and about 400 amino acids, between about 50 and about 350 amino acids, between about 100 and about 300 amino acids, between about 150 and about 250 amino acids, between about 200 and about 300 amino acids, or between about 75 and about 150 amino acids in length. The fragment may comprise a contiguous number of amino acids from mouse CD22 (e.g., mouse CD22 ECD domains as set forth in SEQ ID NO: 37).
[0121] In some embodiments, an anti-CD22 antibody described herein specifically binds to a non-human primate CD22. In some embodiments, the non-human primate is Rhesus macaque. Exemplary amino acid sequences of Rhesus macaque CD22 are set forth in NCBI Accession Numbers AFE80881.1, XP_028694578.1, XP_028694577.1, XP_028694576.1,XP_028694575.1, XP_014979162.2, XP_028694574.1, or XP_014979161.2, and Uniprot Accession Numbers A0A1D5QV53, A0A5F7ZI40, A0A5F8AEU2, A0A5F8ALZ1, A0A5F8A9A7, F6W458, F6W485, F6WAA5, or H9G1X2.
[0122] In some embodiments, the anti-CD22 antibody described herein specifically binds to an epitope on Rhesus macaque CD22 (e.g., extracellular domain(s) (ECD) of Rhesus macaque CD22 described herein). In some embodiments, an anti-CD22 antibody described herein may bind to a fragment of a Rhesus macaque CD22 (e.g., Rhesus macaque CD22 described herein) may be between about 5 and about 425 amino acids, between about 10 and about 400 amino acids, between about 50 and about 350 amino acids, between about 100 and about 300 amino acids, between about 150 and about 250 amino acids, between about 200 and about 300 amino acids, or between about 75 and about 150 amino acids in length. The fragment may comprise a contiguous number of amino acids from Rhesus macaque CD22 (e.g., Rhesus macaque CD22 described herein).
[0123] In some embodiments, the anti-CD22 antibodies described herein are affinity matured clones. In some embodiments, an anti-CD22 antibody specifically binds a CD22 (e.g., a human, mouse, or non-human primate CD22) with binding affinity (e.g., as indicatedby KD)of at least about 10-4M, 10-5M, 10-6M, 10-7M, 10-8M, 10-9M, 10-10M, 10-11M, 10-12M, 10-13M, or less. For example, the anti-CD22 antibodies of the present disclosure can bind to a CD22 protein (e.g., a human, mouse, or non-human primate CD22) with an affinity between 5 pM and 500 nM, e.g., between 50 pM and 100 nM, between 500 pM and 50 nM, between 1 nM and 50 nM, between 2 nM and 20 nM, between 1 nM and 10 nM, between 1 nM and 3 nM, or between 2 nM and 5 nM. The disclosure also includes antibodies that compete with any of the antibodies described herein for binding to a CD22 protein (e.g., a human, mouse, or non-human primate CD22) and that have an affinity of 100 nM or lower (e.g., 80 nM or lower, 50 nM or lower, 20 nM or lower, 10 nM or lower, 5 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower). The affinity and binding kinetics of the anti-CD22 antibody can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE). In some embodiments, the anti-CD22 antibodies described herein binds to CD22 (e.g., a human or non-human primate CD22) witha KDof nanomolarrange.
[0124] Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance (SPR), florescent activated cell sorting (FACS) or spectroscopy (e.g., using afluorescence assay). Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v / v) surfactant P20) and PBS buffer (10mM PO4-3, 137mM NaCl, and 2.7mM KCl). These techniques can be used to measure the concentration of bound proteins as a function of target protein concentration. The concentration of bound protein ([[Bound]]) is generally related to the concentration of free target protein ([[Free]]) by the following equation: [[Bound]] = [[Free]] / (Kd+[[Free]])
[0125] It is not always necessary to make an exact determination of KA, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as ELISA or FACS analysis, is proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay, e.g., an in vitro or in vivo assay.
[0126] The heavy chain (HC) and light chain (LC) sequences, heavy chain variable domain (VH) and light chain variable domain (VL), CDR sequences, and heavy chain and light chain constant region sequences of non-limiting examples of anti-CD22 antibodies are provided in Table 1. Table 1. Examples of anti-CD22 antibodies^^CDR sequences of CD22 mAbs defined by Kabat definition *CDR consensus sequences defined by IMGT definition
[0127] In some embodiments, following the IMGT definition, an anti-CD22 antibody of the present disclosure comprises consensus sequence of a HC CDR1 comprising the aminoacidsequence of GFX1FX2X3YG (SEQ ID NO: 33), in which X1is T or I, X2is S or R, and X3is S or N; a HC CDR2 comprising the amino acid sequence of IYYDGX4X5X6(SEQ ID NO: 34), in which X4is N or S, X5is K or N, and X6is K or N; a HC CDR3 comprising the amino acid sequence of ARELTGDAFDX7, in which X7 is I or L, a LC CDR1 comprising the amino acid sequence of QX8IGSX9, X8 is S or R, and X9 is S or H; a LC CDR2 comprisingtheamino acid sequence of YAS; and / or a LC CDR3 comprising the amino acid sequence of HQSSX10EPYT, in which X10is T, R, or S. The consensus sequences of the anti-CD22 antibodies described herein can also be defied by Kabat definition or Chothia definition.
[0128] In some embodiments, the anti-CD22 antibodies of the present disclosure comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-CD22 antibodies selected from Table 1. In some embodiments, the anti-CD22 antibodies of the present disclosure comprise the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Table 1. In some embodiments, the anti-CD22 antibodies of the present disclosure comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-CD22 antibodies selected from Table 1. In some embodiments, the anti- CD22 antibodies of the present disclosure comprise the LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-CD22 antibodies selected from Table 1.
[0129] In some embodiments, the anti-CD22 antibodies of the present disclosure comprises the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-CD22 antibodies selected from Table 1. In some embodiments, antibody heavy and light chain CDR3 domains may play a particularly important role in the binding specificity / affinity of an antibody for an antigen. Accordingly, the anti-CD22 antibodies of the disclosure may include at least the heavy and / or light chain CDR3s of any one of the anti- CD22 antibodies selected from Table 1.
[0130] In some embodiments, the isolated anti-CD22 antibody comprises a heavy chain variable region that comprises a heavy chain CDR1 (HC CDR1), a heavy chain CDR2 (HC CDR2), and a heavy chain CDR3 (HC CDR3).
[0131] Also within the scope of the present disclosure are functional variants of any of the exemplary anti-CD22 antibodies as disclosed herein. A functional variant may contain one or more amino acid residue variations in the VHand / or VL, or in one or more of the HC CDRs and / or one or more of the LC CDRs as relative to the reference antibody, while retaining substantially similar binding and biological activities (e.g., substantially similar binding affinity, binding specificity, inhibitory activity, anti-inflammatory activity, or a combination thereof) as the reference antibody.
[0132] In some embodiments, any of the anti-CD22 antibodies of the disclosure have one or more CDRs (e.g., HC CDR or LC CDR) sequences substantially similar to any of the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 sequences from one of the anti-CD22 antibodies selected from Table 1. In some embodiments, the position of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary by one, two, three, four, five, or six amino acid positions so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). For example, in some embodiments, the position defining a CDR of any antibody described herein can vary by shifting the N-terminal and / or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the CDR position of any one of the antibodies described herein, so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). In another embodiment, the length of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).
[0133] Accordingly, in some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described herein (e.g., CDRS from any of the anti-CD22 antibodies selected from Table 1) so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described herein (e.g., CDRS from any of the anti-CD22 antibodies selected from Table 1) so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-CD22 antibodies selected from Table 1) so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-CD22 antibodies selected from Table 1) so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti- CD22 antibodies selected from Table 1) so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it isderived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-CD22 antibodies selected from Table 1) so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). Any method can be used to ascertain whether immunospecific binding to CD22 (e.g., human CD22) is maintained, for example, using binding assays and conditions described in the art.
[0134] In some examples, any of the anti-CD22 antibodies of the disclosure have one or more CDR (e.g., HC CDR or LC CDR) sequences substantially similar to any one of the anti- CD22 antibodies selected from Table 1. For example, the antibodies may include one or more CDR sequence(s) from any of the anti-CD22 antibodies selected from Table 1 containing up to 5, 4, 3, 2, or 1 amino acid residue variations as compared to the corresponding CDR region in any one of the CDRs provided herein (e.g., CDRs from any of the anti-CD22 antibodies selected from Table 1) so long as immunospecific binding to CD22 (e.g., human CD22) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, any of the amino acid variations in any of the CDRs provided herein may be conservative variations. Conservative variations can be introduced into the CDRs at positions where the residues are not likely to be involved in interacting with a CD22 protein (e.g., a human CD22 protein), for example, as determined based on a crystal structure. Some aspects of the disclosure provide anti-CD22 antibodies that comprise one or more of the heavy chain variable (VH) and / or light chain variable (VL) domains provided herein. In some embodiments, any of the VH domains provided herein include one or more of the HC CDR sequences (e.g., HC CDR1, HC CDR2, and HC CDR3) provided herein, for example, any of the CDR-H sequences provided in any one of the anti-CD22 selected from Table 1. In some embodiments, any of the VL domains provided herein include one or more of the CDR-L sequences (e.g., LC CDR1, LC CDR2, and LC CDR3) provided herein, for example, any of the LC CDR sequences provided in any one of the anti-CD22 antibodies selected from Table 1.
[0135] In some embodiments, the anti-CD22 antibodies of the disclosure include any antibody that includes a heavy chain variable domain and / or a light chain variable domain ofany one of the anti-CD22 antibodies selected from Table 1, and variants thereof. In some embodiments, anti-CD22 antibodies of the disclosure include any antibody that includes the heavy chain variable and light chain variable pairs of any anti-CD22 antibodies selected from Table 1.
[0136] Aspects of the disclosure provide anti-CD22 antibodies having a heavy chain variable (VH) and / or a light chain variable (VL) domain amino acid sequence homologous to any of those described herein. In some embodiments, the anti-CD22 antibody comprises a heavy chain variable sequence or a light chain variable sequence that is at least 75% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the heavy chain variable sequence and / or any light chain variable sequence of any one of the anti-CD22 antibodies selected from Table 1. In some embodiments, the homologous heavy chain variable and / or a light chain variable amino acid sequences do not vary within any of the CDR sequences provided herein. For example, in some embodiments, the degree of sequence variation (e.g., 75%, 80%, 85%, 90%, 95%, 98%, or 99%) may occur within a heavy chain variable and / or a light chain variable sequence excluding any of the CDR sequences provided herein. In some embodiments, any of the anti-CD22 antibodies provided herein comprise a heavy chain variable sequence and a light chain variable sequence that comprises a framework sequence that is at least 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the framework sequence of any anti-CD22 antibodies selected from Table 1.
[0137] In some embodiments, the anti-CD22 antibody of the present disclosure is a humanized antibody (e.g., a humanized variant containing one or more CDRs of Table 1). In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, and a LC CDR3 that are the same as the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 shown in Table 1, and comprises a humanized heavy chain variable region and / or a humanized light chain variable region.
[0138] In some embodiments, the anti-CD22 antibody of the present disclosure is a humanized antibody comprising a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-CD22 antibodies listed in Table 1. Alternatively or in addition, the anti-CD22 antibody of the present disclosure is a humanized antibody comprising a VL containing no more than 20 amino acid variations (e.g., no morethan 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL of any one of the anti-CD22 antibodies listed in Table 1. Anti-CD22 mAb-1 and Variants
[0139] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 55. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 56.
[0140] In some embodiments, according to the Kabat definition system, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC CDR2 having the amino acid sequence of SEQ ID NO: 50, a HC CDR3 having the amino acid sequence of SEQ ID NO: 51, a LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 54.
[0141] In some embodiments, anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and HC CDR3 having the amino acid sequence of SEQ ID NO: 51. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and LC CDR3 having the amino acid sequence of SEQ ID NO: 54.
[0142] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and HC CDR3 having the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LCCDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and LC CDR3 having the amino acid sequence of SEQ ID NO: 54.
[0143] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 54.
[0144] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 54.
[0145] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 55. Alternatively or in addition, theanti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 56.
[0146] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 55. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 56.
[0147] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 55. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 56.
[0148] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 55; alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 56. In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 55 and a VL comprising the amino acid sequence of SEQ ID NO: 56. Anti-CD22 mAb-2 and Variants
[0149] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 69. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 70.
[0150] In some embodiments, according to the Kabat definition system, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having the amino acid sequence of SEQ ID NO: 64, a HC CDR3 having the amino acid sequence of SEQ ID NO: 65, a LC CDR1 having the amino acid sequence of SEQ ID NO: 66, a LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 68.
[0151] In some embodiments, anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, HC CDR2 having the amino acid sequence of SEQ ID NO: 64, and HC CDR3 having the amino acid sequence of SEQ ID NO: 65. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 66, LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and LC CDR3 having the amino acid sequence of SEQ ID NO: 68.
[0152] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, HC CDR2 having the amino acid sequence of SEQ ID NO: 64, and HC CDR3 having the amino acid sequence of SEQ ID NO: 65. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 66, LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and LC CDR3 having the amino acid sequence of SEQ ID NO: 68.
[0153] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 64, and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 65. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having theamino acid sequence of SEQ ID NO: 66, a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 68.
[0154] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 64, and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 65. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 66, a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 68.
[0155] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 69. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 70.
[0156] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 69. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 70.
[0157] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 69. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising an amino acidsequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 70.
[0158] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 69; alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 70. In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 69 and a VL comprising the amino acid sequence of SEQ ID NO: 70. Anti-CD22 mAb-3 and Variants
[0159] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 83. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 84.
[0160] In some embodiments, according to the Kabat definition system, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having the amino acid sequence of SEQ ID NO: 78, a HC CDR3 having the amino acid sequence of SEQ ID NO: 79, a LC CDR1 having the amino acid sequence of SEQ ID NO: 80, a LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0161] In some embodiments, anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, HC CDR2 having the amino acid sequence of SEQ ID NO: 78, and HC CDR3 having the amino acid sequence of SEQ ID NO: 79. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 80, LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0162] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, HC CDR2 having the amino acid sequence of SEQ ID NO: 78, and HC CDR3 having the amino acid sequence of SEQ ID NO: 79. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 80, LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0163] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 78, and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 79. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 80, a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0164] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 78, and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 79. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the aminoacid sequence of SEQ ID NO: 80, a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0165] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 83. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 84.
[0166] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 83. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 84.
[0167] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 83. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 84.
[0168] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 83; alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 84. In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 83 and a VL comprising the amino acid sequence of SEQ ID NO: 84. Anti-CD22 mAb-4 and Variants
[0169] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 7. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 8.
[0170] In some embodiments, according to the Kabat definition system, the anti-CD22 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.
[0171] In some embodiments, anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.
[0172] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.
[0173] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 6.
[0174] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 6.
[0175] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 7. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 8.
[0176] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., nomore than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 8.
[0177] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 8.
[0178] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 7; alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 8. In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 7 and a VL comprising the amino acid sequence of SEQ ID NO: 8. Additional anti-CD22 antibodies
[0179] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 21. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 22.
[0180] In some embodiments, according to the Kabat definition system, the anti-CD22 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 17, a HC CDR2 having the amino acid sequence of SEQ ID NO: 18, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 19, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 20.
[0181] In some embodiments, anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 17, HC CDR2 having the amino acid sequence of SEQ ID NO: 18, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range.Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 19, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 20.
[0182] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 17, HC CDR2 having the amino acid sequence of SEQ ID NO: 18, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 19, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 20.
[0183] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 17; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 18; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 19; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 20.
[0184] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1having the amino acid sequence of SEQ ID NO: 17; a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 18; and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 19; a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 20.
[0185] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 21. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 22.
[0186] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 21. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 22.
[0187] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 21. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 22.
[0188] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 25. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 26.
[0189] In some embodiments, according to the Kabat definition system, the anti-CD22 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 23, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 19, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 24.
[0190] In some embodiments, anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 23, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 19, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 24.
[0191] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 23, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 19, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 24.
[0192] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 23; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 19; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 24.
[0193] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 23; and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 19; a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 24.
[0194] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 25. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 26.
[0195] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 25. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations(e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 26.
[0196] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 25. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 26.
[0197] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 31. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 32.
[0198] In some embodiments, according to the Kabat definition system, the anti-CD22 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 27, a HC CDR3 having the amino acid sequence of SEQ ID NO: 28, a LC CDR1 having the amino acid sequence of SEQ ID NO: 29, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 30.
[0199] In some embodiments, anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 27, and HC CDR3 having the amino acid sequence of SEQ ID NO: 28. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 29, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 30.
[0200] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 27, and HC CDR3 having the amino acid sequence of SEQ ID NO: 28. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 29, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 30.
[0201] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 27; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 28. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 29; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 30.
[0202] In some embodiments, the anti-CD22 antibody of the present disclosure comprises: a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 27; and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 28. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises: a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the aminoacid sequence of SEQ ID NO: 29; a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 30.
[0203] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 31. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 32.
[0204] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 31. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 32.
[0205] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 31. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 32.
[0206] In some embodiments, the anti-CD22 antibody of the present disclosure is a chimeric antibody, which can include a heavy constant region and a light constant region from a human antibody. Chimeric antibodies refer to antibodies having a variable region or part of variable region from a first species and a constant region from a second species. Typically, in these chimeric antibodies, the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a non- human mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human. In some embodiments, amino acid modifications can be made in the variable region and / or the constant region.
[0207] In some embodiments, the anti-CD22 antibody described herein is a chimeric antibody, which can include a heavy constant region and a light constant region from a human antibody. Chimeric antibodies refer to antibodies having a variable region or part ofvariable region from a first species and a constant region from a second species. Typically, in these chimeric antibodies, the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a non-human mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human. In some embodiments, amino acid modifications can be made in the variable region and / or the constant region.
[0208] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a VL domain and / or VH domain of any one of the anti-CD22 antibodies selected from Table 1, and comprises a constant region comprising the amino acid sequences of the constant regions of an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), or any subclass (e.g., IgG2a and IgG2b) of immunoglobulin molecule. Non-limiting examples of human constant regions are described in the art, e.g., see Kabat E A et al., (1991) supra. An example of a human IgG1 constant region is given below: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG (SEQ ID NO: 9).
[0209] In some embodiments, the light chain of any of the anti-CD22 antibodies described herein may further comprise a light chain constant region (CL), which can be any CL known in the art. In some examples, the CL is a kappa light chain. In other examples, the CL is a lambda light chain. In some embodiments, the CL is a kappa light chain. An exemplary sequence of which is provided below: RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVT EQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 10).
[0210] Other antibody heavy and light chain constant regions may be used in some embodiments, e.g., those provided in the IMGT database (www.imgt.org) or at www.vbase2.org / vbstat.php., both of which are incorporated by reference herein.
[0211] In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the VH as listed in Table 1 or any variants thereof and a heavy chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to SEQ ID NO: 9. In some embodiments, the anti-CD22 antibody described hereincomprises a heavy chain comprising the VH as listed in Table 1 or any variants thereof and a heavy chain constant region that contains no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with SEQ ID NO: 9. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the VH as listed in Table 1 or any variants thereof and a heavy chain constant region set forth in SEQ ID NO: 9.
[0212] In some embodiments, the anti-CD22 antibody described herein comprises a light chain comprising the VL as listed in Table 1 or any variants thereof and a light chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to SEQ ID NO: 10. In some embodiments, the anti-CD22 antibody described herein comprises a light chain comprising the VL as listed in Table 1 or any variants thereof and a light chain constant region contains no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with SEQ ID NO: 10. In some embodiments, the anti-CD22 antibody described herein comprises a light chain comprising the VL as listed in Table 1 or any variants thereof and a light chain constant region set forth in SEQ ID NO: 10.
[0213] Examples of IgG heavy chain and light chain amino acid sequences of the anti- CD22 antibodies described are provided in Table 1 above.
[0214] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 11. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO:12. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 11. Alternatively or in addition, the anti-CD22 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 12. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 11. Alternatively or in addition, the anti-CD22 antibody described herein comprises a light chain comprising the amino acid sequence ofSEQ ID NO: 12. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 11, and a light chain comprising the amino acid sequence of SEQ ID NO: 12.
[0215] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 57. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 58. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO:57. Alternatively or in addition, the anti-CD22 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 58. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 57. Alternatively or in addition, the anti-CD22 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 58. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 57, and a light chain comprising the amino acid sequence of SEQ ID NO: 58.
[0216] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 71. Alternatively or in addition, the anti- CD22 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 72. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 71. Alternatively or in addition, the anti-CD22 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 72. In someembodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 71. Alternatively or in addition, the anti-CD22 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 72. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 71, and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
[0217] In some embodiments, the anti-CD22 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain as set forth in SEQ ID NO: 85. Alternatively or in addition, the anti-CD22 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain as set forth in SEQ ID NO: 86. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 85. Alternatively or in addition, the anti-CD22 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to SEQ ID NO: 86. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 85. Alternatively or in addition, the anti-CD22 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 86. In some embodiments, the anti-CD22 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 85, and a light chain comprising the amino acid sequence of SEQ ID NO: 86.
[0218] The anti-CD22 antibodies described herein can be in any antibody form, including, but not limited to, intact (i.e., full-length) antibodies, antigen-binding fragments thereof (such as Fab, F(ab'), F(ab')2, Fv), single chain antibodies, bi-specific antibodies, or nanobodies. In some embodiments, the anti-CD22 antibody described herein is a scFv. In some embodiments, the anti-CD22 antibody described herein is a scFv-Fab (e.g., scFv fused to a portion of a constant region).
[0219] In some embodiments, conservative mutations can be introduced into antibody sequences (e.g., CDRs or framework sequences) at positions where the residues are not likely to be involved in interacting with a target antigen (e.g., CD22), for example, as determinedbased on a crystal structure. In some embodiments, one, two or more mutations (e.g., amino acid substitutions) are introduced into the Fc region of an anti-CD22 antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgG1) and / or CH3 domain (residues 341-447 of human IgG1) and / or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding and / or antigen-dependent cellular cytotoxicity.
[0220] In some embodiments, one, two or more mutations (e.g., amino acid substitutions) are introduced into the hinge region of the Fc region (CH1 domain) such that the number of cysteine residues in the hinge region are altered (e.g., increased or decreased) as described in, e.g., U.S. Pat. No. 5,677,425. The number of cysteine residues in the hinge region of the CH1 domain can be altered to, e.g., facilitate assembly of the light and heavy chains, or to alter (e.g., increase or decrease) the stability of the antibody or to facilitate linker conjugation. In some embodiments, one, two or more mutations (e.g., amino acid substitutions) are introduced into the Fc region of an antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgG1) and / or CH3 domain (residues 341-447 of human IgG1) and / or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to increase or decrease the affinity of the antibody for an Fc receptor (e.g., an activated Fc receptor) on the surface of an effector cell. Mutations in the Fc region of an antibody that decrease or increase the affinity of an antibody for an Fc receptor and techniques for introducing such mutations into the Fc receptor or fragment thereof are known to one of skill in the art. Examples of mutations in the Fc receptor of an antibody that can be made to alter the affinity of the antibody for an Fc receptor are described in, e.g., Smith P et al., (2012) PNAS 109: 6181-6186, U.S. Pat. No. 6,737,056, and International Publication Nos. WO 02 / 060919; WO 98 / 23289; and WO 97 / 34631, which are incorporated herein by reference.
[0221] In some embodiments, one, two or more amino acid mutations (i.e., substitutions, insertions or deletions) are introduced into an IgG constant domain, or FcRn-binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to alter (e.g., decrease or increase) half-life of the antibody in vivo. See, e.g., International Publication Nos. WO 02 / 060919; WO 98 / 23289; and WO 97 / 34631; and U.S. Pat. Nos. 5,869,046, 6,121,022, 6,277,375 and 6,165,745 for examples of mutations that will alter (e.g., decrease or increase) the half-life of an antibody in vivo.
[0222] In some embodiments, one, two or more amino acid mutations (i.e., substitutions, insertions or deletions) are introduced into an IgG constant domain, or FcRn-binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to decrease the half-life of the anti-CD22 antibody in vivo. In some embodiments, one, two or more amino acid mutations (i.e., substitutions, insertions or deletions) are introduced into an IgG constant domain, or FcRn-binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to increase the half-life of the antibody in vivo. In some embodiments, the antibodies can have one or more amino acid mutations (e.g., substitutions) in the second constant (CH2) domain (residues 231-340 of human IgG1) and / or the third constant (CH3) domain (residues 341-447 of human IgG1), with numbering according to the EU index in Kabat (Kabat E A et al., (1991) supra). In some embodiments, the constant region of the IgG1 of an antibody described herein comprises a methionine (M) to tyrosine (Y) substitution in position 252, a serine (S) to threonine (T) substitution in position 254, and a threonine (T) to glutamic acid (E) substitution in position 256, numbered according to the EU index as in Kabat. See U.S. Pat. No. 7,658,921, which is incorporated herein by reference. This type of mutant IgG, referred to as "YTE mutant" has been shown to display fourfold increased half-life as compared to wild-type versions of the same antibody (see Dall'Acqua W F et al., (2006) J Biol Chem 281: 23514-24). In some embodiments, an antibody comprises an IgG constant domain comprising one, two, three or more amino acid substitutions of amino acid residues at positions 251-257, 285-290, 308-314, 385-389, and 428-436, numbered according to the EU index as in Kabat.
[0223] In some embodiments, one, two or more amino acid substitutions are introduced into an IgG constant domain Fc region to alter the effector function(s) of the anti-CD22 antibody. The effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260 (e.g., L234A and L235A mutations). In some embodiments, the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating antibody thereby increasing tumor localization. See, e.g., U.S. Pat. Nos. 5,585,097 and 8,591,886 for a description of mutations that delete or inactivate the constant domain and thereby increase tumor localization. In some embodiments, one or more amino acid substitutions may be introduced into the Fc region of an antibody described herein to remove potential glycosylation sites on Fc region, which may reduce Fc receptor binding (see, e.g., Shields R L et al., (2001) J Biol Chem 276: 6591-604).
[0224] In some embodiments, one or more amino in the constant region of an anti-CD22 antibody described herein can be replaced with a different amino acid residue such that the antibody has altered Clq binding and / or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in further detail in U.S. Pat. No. 6,194,551 (Idusogie et al). In some embodiments, one or more amino acid residues in the N-terminal region of the CH2 domain of an antibody described herein are altered to thereby alter the ability of the antibodyto activate complement. This approach is described further in International Publication No. WO 94 / 29351. In some embodiments, the Fc region of an antibody described herein is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and / or to increase the affinity of the DQWLERG\^IRU^DQ^)FȖ^UHFHSWRU^^7KLV^DSSURDFK^LV^GHVFULEHG^IXUWKHU^LQ^,QWHUQDWLRQDO^3XEOLFDWLRQ^ No. WO 00 / 42072. In some embodiments, the heavy and / or light chain variable domain(s) sequence(s) of the antibodies provided herein can be used to generate, for example, CDR- grafted, chimeric, humanized, or composite human antibodies or antigen-binding fragments, as described elsewhere herein. As understood by one of ordinary skill in the art, any variant, CDR-grafted, chimeric, humanized, or composite antibodies derived from any of the antibodies provided herein may be useful in the compositions and methods described herein and will maintain the ability to specifically bind CD22, such that the variant, CDR-grafted, chimeric, humanized, or composite antibody has at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more binding to CD22 relative to the original antibody from which it is derived.
[0225] In some embodiments, the antibodies provided herein comprise mutations that confer desirable properties to the antibodies. For example, to avoid potential complications due to Fab-arm exchange, which is known to occur with native IgG4 mAbs, the antibodies provided herein may comprise a stabilizing ‘Adair’ mutation (Angal S., et al., “A single amino acid substitution abolishes the heterogeneity of chimeric mouse / human (IgG4) antibody,” Mol Immunol 30, 105-108; 1993), where serine 228 (EU numbering; residue 241 Kabat numbering) is converted to proline resulting in an IgG1-like hinge sequence. Accordingly, any of the antibodies may include a stabilizing ‘Adair’ mutation.
[0226] In some embodiments, an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and / or methylation. In some embodiments, an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules. In some embodiments, the one or more sugar or carbohydrate molecule are conjugated to theantibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and / or phosphoglycosylation. In some embodiments, the one or more sugar or carbohydrate molecules are monosaccharides, disaccharides, oligosaccharides, or glycans. In some embodiments, the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan. In some embodiments, the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, an N-acetylgalactosamine unit, a galactose unit, a fucose unit, or a phospholipid unit. In some embodiments, there are about 1-10, about 1-5, about 5-10, about 1-4, about 1-3, or about 2 sugar molecules. In some embodiments, a glycosylated antibody is fully or partially glycosylated. In some embodiments, an antibody is glycosylated by chemical reactions or by enzymatic means. In some embodiments, an antibody is glycosylated in vitro or inside a cell, which may optionally be deficient in an enzyme in the N- or O- glycosylation pathway, e.g. a glycosyltransferase. In some embodiments, an antibody is functionalized with sugar or carbohydrate molecules as described in International Patent Application Publication WO2014065661, published on May 1, 2014, entitled, “Modified antibody, antibody- conjugate and process for the preparation thereof”.
[0227] In some embodiments, any one of the anti-CD22 antibodies described herein may comprise a signal peptide in the heavy and / or light chain sequence (e.g., a N-terminal signal peptide). In some embodiments, the anti-CD22 antibody described herein comprises any one of the VH and VL sequences, any one of the IgG heavy chain and light chain sequences, or any one of the F(ab') heavy chain and light chain sequences described herein, and further comprises a signal peptide (e.g., a N-terminal signal peptide).
[0228] In some embodiments, any one of the antibodies described herein is a multispecific antibody that specifically binds CD22 and one or more additional target antigens. In some embodiments, the antibody is a bispecific antibody that specifically binds to CD22 and one additional target antigen. In some embodiments, the multispecific antibody or bispecific antibody can be obtained by known technology in the art. In some embodiments, the one or more additional target include but are not limited to CD3, CD4, CD8, CD20, CD19, CD21, CD23, CD46, CD80, HLA-DR, CD74, CD22, CD14, CD15, CD16, CD123, TCR gamma / delta, NKp46, or KIR.
[0229] In some embodiments, the antibodies described herein are conjugated directly or indirectly to one or more molecular payloads or labels. For example, in some embodiments, antibodies described herein are conjugated to molecular payload, e.g., a molecular payloadproviding a therapeutic benefit for a subject, e.g., an antibody-drug conjugate (ADC). In some embodiments, a molecular payload may be a small molecule, protein, nucleic acid, oligonucleotide, or any molecular entity capable of modulating the activity or function of a gene, protein, and / or nucleic acid, e.g., in a cell. In some embodiments, the molecular payload is a cytotoxic agent or a chemotherapeutic agent. In some embodiments, antibodies described herein are conjugated directly or indirectly to a detectable label, e.g., for diagnostic purposes.
[0230] In some embodiments, the present disclosure also provides fusion proteins comprising an anti-CD22 antibody described herein fused directly or indirectly (e.g., via a linker) to one or more polypeptide or protein. (b) Chimeric Antigen Receptors
[0231] In some aspects, the present disclosure also contemplates engineering any of the anti- CD22 antibody to be an extracellular ligand-binding domain of a CAR expressed by genetically modified immune cells (e.g., T cells, NK cells, or NKT cells) described herein. Aspects of the present disclosure also provides chimeric antigen receptors (CARs) comprising an extracellular ligand-binding domain. In some embodiments, the ligand-binding domain binds to a cell surface marker on a target cell (e.g., a B cell). In some embodiments, the ligand-binding domain binds to a cell surface marker on a target cell in a particular disease state (e.g., CD22 on B cells in a B cell disorder). Generally, a CAR (e.g., anti-CD22 CAR) of the present disclosure comprises at least an extracellular domain and an intracellular domain. In some embodiments, the extracellular domain of an anti-CD22 CAR comprises a target-specific binding element (e.g., an antibody that specifically binds to CD22 (e.g., human CD22)) otherwise referred to herein as a ligand-binding domain (also referred to herein as an antigen-binding domain). In some embodiments, the extracellular ligand-binding domain of an anti-CD22 CAR is an antigen-binding domain or a portion thereof. In some embodiments, the extracellular ligand-binding domain of an anti-CD22 CAR is a Fab. In some embodiments, the extracellular ligand-binding domain of an anti-CD22 CAR is a scFv. In some embodiments, an extracellular ligand-binding domain of a CAR described herein comprises an anti-CD22 antibody or antigen binding fragments thereof (e.g., anti-CD22 antibody). In some embodiments, an anti-CD22 CAR comprises a HC CDR1, a HC CDR2 and a HC CDR3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 7, 55, 69, or 83. Alternatively or in addition, an anti-CD22 CAR comprises a LC CDR1, a LC CDR2 and a LC CDR3 of a light chain variable domain (VL) having theamino acid sequence of SEQ ID NO: 8, 56, 70, or 84. In some embodiments, an anti-CD22 CAR comprises: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 7, and a LC CDR1, a LC CDR2 and a LC CDR3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 8; (ii) a HC CDR1, a HC CDR2 and a HC CDR3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 55, and a LC CDR1, a LC CDR2 and a LC CDR3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 56; (iii) a HC CDR1, a HC CDR2 and a HC CDR3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 69, and a LC CDR1, a LC CDR2 and a LC CDR3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 70; or (iv) a HC CDR1, a HC CDR2 and a HC CDR3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 83, and a LC CDR1, a LC CDR2 and a LC CDR3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 84.
[0232] In some embodiments, according to the Kabat definition system, an anti-CD22 CAR comprises a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, 51, 65, or 79. In some embodiments, according to the Kabat definition system, an anti-CD22 CAR comprises (i) a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and a HC CDR3 having the amino acid sequence of SEQ ID NO: 3; (ii) a HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and a HC CDR3 having the amino acid sequence of SEQ ID NO: 51; (iii) a HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having the amino acid sequence of SEQ ID NO: 64, and a HC CDR3 having the amino acid sequence of SEQ ID NO: 65; or (iv) a HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having the amino acid sequence of SEQ ID NO: 78, and a HC CDR3 having the amino acid sequence of SEQ ID NO: 79. Alternatively or in addition, in some embodiments, according to the Kabat definition system, an anti-CD22 CAR comprises (i) a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6; (ii) a LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 54; (iii) a LC CDR1 having the amino acid sequence of SEQ ID NO: 66, a LC CDR2 having the amino acid sequence of SEQ ID NO:67, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 68; or (iv) a LC CDR1 having the amino acid sequence of SEQ ID NO: 80, a LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 82. In some embodiments, according to the Kabat definition system, an anti-CD22 CAR comprises (i) a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 3, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6; (ii) a HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC CDR2 having the amino acid sequence of SEQ ID NO: 50, a HC CDR3 having the amino acid sequence of SEQ ID NO: 51, a LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 54; (iii) a HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having the amino acid sequence of SEQ ID NO: 64, a HC CDR3 having the amino acid sequence of SEQ ID NO: 65, a LC CDR1 having the amino acid sequence of SEQ ID NO: 66, a LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 68; or (iv) a HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having the amino acid sequence of SEQ ID NO: 78, a HC CDR3 having the amino acid sequence of SEQ ID NO: 79, a LC CDR1 having the amino acid sequence of SEQ ID NO: 80, a LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0233] In some embodiments, an anti-CD22 CAR comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with (i) the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3; (ii) the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and HC CDR3 having the amino acid sequence of SEQ ID NO: 51; (iii) the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, HC CDR2 having the amino acid sequence of SEQ ID NO: 64, and HC CDR3 having the amino acid sequence of SEQ ID NO: 65; or (iv) the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, HC CDR2 having the amino acid sequence of SEQ ID NO: 78, and HC CDR3 having theamino acid sequence of SEQ ID NO: 79. Alternatively or in addition, an anti-CD22 CAR comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with (i) the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6; (ii) the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and LC CDR3 having the amino acid sequence of SEQ ID NO: 54; (iii) the LC CDR1 having the amino acid sequence of SEQ ID NO: 66, LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and LC CDR3 having the amino acid sequence of SEQ ID NO: 68; or (iv) the LC CDR1 having the amino acid sequence of SEQ ID NO: 80, LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0234] In some embodiments, an anti-CD22 CAR comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to: (i) the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 3; (ii) the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and HC CDR3 having the amino acid sequence of SEQ ID NO: 51; (iii) the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, HC CDR2 having the amino acid sequence of SEQ ID NO: 64, and HC CDR3 having the amino acid sequence of SEQ ID NO: 65; or (iv) the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, HC CDR2 having the amino acid sequence of SEQ ID NO: 78, and HC CDR3 having the amino acid sequence of SEQ ID NO: 79. Alternatively or in addition, an anti-CD22 CAR comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to (i) the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6; (ii) the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and LC CDR3 having the amino acid sequence of SEQ ID NO: 54; (iii) the LC CDR1 having the amino acid sequence of SEQ ID NO: 66, LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and LC CDR3 having the amino acid sequence of SEQ ID NO: 68; or (iv) the LC CDR1having the amino acid sequence of SEQ ID NO: 80, LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0235] In some embodiments, an anti-CD22 CAR comprises: (i) a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 3; (ii) a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 51; (iii) a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 64, and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 65; or (iv) a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 78, and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 79. Alternatively or in addition, an anti-CD22 CAR thereof comprises: (i) a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having no more than 3 aminoacid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 6; (ii) a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 54; (iii) a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 66, a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 68; or (iv) a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 80, a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0236] In some embodiments, the anti-CD22 CAR comprises: (i) a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 3; (ii) a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 49, a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 50, and / or a HC CDR3 atleast 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 51; (iii) a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 64, and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 65; or (iv) a HC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 63, a HC at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR2 having the amino acid sequence of SEQ ID NO: 78, and / or a HC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the HC CDR3 having the amino acid sequence of SEQ ID NO: 79. Alternatively or in addition, the anti- CD22 CAR comprises: (i) a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 6; (ii) a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 52, a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 53, and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 54; (iii) a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 66, a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 67, and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 68; or (iv) a LC CDR1 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR1 having the amino acid sequence of SEQ ID NO: 80, a LC CDR2 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR2 having the amino acid sequence of SEQ ID NO: 81, and / or a LC CDR3 at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the LC CDR3 having the amino acid sequence of SEQ ID NO: 82.
[0237] In some embodiments, an anti-CD22 CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 7, 55, 69, or 83. Alternatively or in addition, an anti-CD22 CAR comprises a VL comprising the amino acid sequence of SEQ ID NO: 8, 56, 70, or 84. In some embodiments, an anti- CD22 CAR comprises (i) a VH comprising the amino acid sequence of SEQ ID NO: 7, and a VL comprising the amino acid sequence of SEQ ID NO: 8; (ii) a VH comprising the amino acid sequence of SEQ ID NO: 55, and a VL comprising the amino acid sequence of SEQ ID NO: 56; (iii) a VH comprising the amino acid sequence of SEQ ID NO: 69, and a VL comprising the amino acid sequence of SEQ ID NO: 70; or (iv) a VH comprising the amino acid sequence of SEQ ID NO: 83, and a VL comprising the amino acid sequence of SEQ ID NO: 84.
[0238] In some embodiments, an anti-CD22 CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in any of SEQ ID NOs: 7, 55, 69, and 83. Alternatively or in addition, an anti-CD22 CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in any of SEQ ID NOs: 8, 56, 70, and 84. In some embodiments, an anti-CD22 CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7, and a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 8. In some embodiments, an anti-CD22 CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 55, and a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 56. In some embodiments, an anti-CD22 CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 69, and a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 70. In some embodiments, ananti-CD22 CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 83, and a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 84.
[0239] In some embodiments, an anti-CD22 CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in any of SEQ ID NOs: 7, 55, 69, and 83. Alternatively or in addition, an anti- CD22 CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in any of SEQ ID NOs: 8, 56, 70, and 84. In some embodiments, an anti-CD22 CAR comprises a VH that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 7, and a VL that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 8. In some embodiments, an anti-CD22 CAR comprises a VH that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 55, and a VL that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 56. In some embodiments, an anti-CD22 CAR comprises a VH that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 69, and a VL that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 70. In some embodiments, an anti-CD22 CAR comprises a VH that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH as set forth in SEQ ID NO: 83, and a VL that is at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VL as set forth in SEQ ID NO: 84.
[0240] In some embodiments, an anti-CD22 CAR comprises an extracellular ligand- binding domain that comprises a single-chain variable fragment (scFv). In some embodiments, the VH and the VL of an anti-CD22 CAR (e.g., an anti-CD22 scFv) are joined together by a linker. In some embodiments, a linker may have a length of about 2 to 10 amino acids, 5 to 20 amino acids, 10 to 30 amino acids, 20-50 amino acids, 40 to 60 amino acids, 60 to 80 amino acids, or more than 80 amino acids. In some embodiments, a linker may include, without limitation, any of those encompassed by U.S. Patent Nos. 8,445,251 and 9,434,931.
[0241] In some embodiments, an anti-CD22 CAR comprises an extracellular ligand- binding domain that comprises a scFv comprising a VH and a VL, and the C-terminus of the VH is joined with the N terminus of the VL via a linker. In some embodiments, an anti-CD22 CAR comprises an extracellular ligand-binding domain that comprises scFv comprising a VH and a VL, and the C-terminus of the VL is joined with the N terminus of the VH via a linker. In some embodiments, an anti-CD22 CAR of the present disclosure further comprises a hinge region. Any suitable known hinge region can be used in the anti-CD22 CAR described herein, e.g., hinge regions derived from CD4, CD8, CD28, CD3, IgG1, IgG4, IgD, IgA, or IgM, a hybrid or variant therefore (see, e.g., Jayaraman et al., CAR-T design: Elements and their synergistic function, eBioMedicine, VOLUME 58, 102931, AUGUST 2020); Guedan et al., Engineering and Design of Chimeric Antigen Receptors, Mol Ther Methods Clin Dev. 2019 Mar 15; 12: 145–156).
[0242] In some embodiments, an anti-CD22 CAR of the present disclosure further comprises a transmembrane domain, which links the extracellular ligand-binding domain with the intracellular signaling and co-stimulatory domains. With respect to the transmembrane domain, the CAR can be designed to comprise a transmembrane domain that is fused to the extracellular domain (e.g., the antigen binding domain) of the CAR directly or via the hinge region. Any transmembrane domain is contemplated for use herein as long as the domain is capable of anchoring a CAR comprising the domain to a cell membrane. In some embodiments, the transmembrane domain that naturally is associated with one of the domains in the CAR is used. In some instances, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex. One skilled in the art would appreciate that the full transmembrane domain, or portion thereof, is implemented with the cytoplasmic domain, or a portion thereof. The transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In some embodiments, the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. Preferably a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. Optionally, a short oligo- or polypeptide linker, preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR. Aglycine-serine doublet provides a particularly suitable linker. In some embodiments, the transmembrane domain can be any suitable transmembrane domain known in the art, e.g., WUDQVPHPEUDQH^GRPDLQ^GHULYHG^IURP^7&5Į^^7&5ȕ^^7&5ȗ^^&'^ȗ^^&'^İ^^&'^Ȗ^^&'^į^^&'^^^ CD5, CD8, CD9, CD16, CD22, CD28, CD32, CD33, CD34, CD37, CD45, CD64, CD80, CD86, CD134, CD137, CD154, or inducible T cell costimulator (ICOS). However, any transmembrane domain is contemplated for use herein as long as the domain is capable of anchoring a CAR comprising the extracellular domain to a cell membrane. Transmembrane domains can be identified using any method known in the art or described herein, e.g., by using the UniProt Database.
[0243] In some embodiments, an anti-CD22 CAR further comprises an intracellular (or cytoplasmic) domain. In some embodiments, the intracellular domain of the CAR is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed in. The term “effector function” refers to a specialized function of a cell (e.g., a T cell, a NK cell, or a NKT cell). Effector function of a cell (e.g., a T cell, a NK cell, or a NKT cell), for example, may be cytolytic activity or helper activity including the secretion of cytokines. Thus the term “intracellular signaling domain” refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire domain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact domain as long as it transduces the effector function signal. The term intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal. In certain embodiments, the intracellular (or cytoplasmic) domain of a chimeric antigen receptor as disclosed herein may include, but is not limited to, a 4-1BB intracellular domain, a OX40 intracellular domain, a CD30 intracellular domain, a CD40 intracellular domain, an ICOS intracellular domain, a LFA-^^LQWUDFHOOXODU^GRPDLQ^^D^&'^^LQWUDFHOOXODU^GRPDLQ^^D^&'^^ȗ^ LQWUDFHOOXODU^GRPDLQ^^D^&'^^Ȗ^LQWUDFHOOXODU^GRPDLQ^^D^&'^^į^LQWUDFHOOXODU^GRPDLQ^^D^&'^^İ^ intracellular domain, and a CD7 intracellular domain, and a CD22 intracellular domain.
[0244] In some embodiments, the intracellular domain further comprises one or more intracellular co-stimulatory domains, such as those described herein, which transmit a co- stimulatory signal which promotes cell proliferation, cell survival, and / or cytokine secretion after binding of the extracellular domain. In some embodiments, such intracellular co-stimulatory domains include, without limitation, any co-stimulatory domain disclosed herein or those domains known in the art, including but not limited to CD28, ICOS, 4-1BB, OX40, or CD27.
[0245] The intracellular signaling domain of a chimeric antigen receptor of the present disclosure is responsible for activation of at least one of the normal effector functions of the cell in which the CAR has been placed and / or activation of proliferative and cell survival pathways.
[0246] It is to be understood that a chimeric antigen receptor as disclosed herein can include a domain (e.g., an extracellular domain, a transmembrane domain, an intracellular (cytoplasmic) domain, a co-stimulatory domain, a signaling domain, or any combination thereof) having a sequence as set forth herein, or a variant thereof, or a fragment thereof, of any one or more of the domains disclosed herein (e.g., a variant and / or fragment that retains the function required for the chimeric antigen receptor activity). III. Preparation of the Anti-CD22 Antibodies
[0247] Antibodies capable of binding CD22 as described herein can be made by any method known in the art. See, for example, Harlow and Lane, (1998) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York.
[0248] In some embodiments, antibodies specific to a target antigen (e.g., CD22) can be made by the conventional hybridoma technology. The full-length target antigen or a fragment thereof, optionally coupled to a carrier protein such as KLH, can be used to immunize a host animal for generating antibodies binding to that antigen. The route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein. General techniques for production of mouse, humanized, and human antibodies are known in the art and are described herein. It is contemplated that any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human hybridoma cell lines. Typically, the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and / or intradermally with an amount of immunogen, including as described herein.
[0249] If desired, an antibody (monoclonal or polyclonal) of interest (e.g., produced by a hybridoma) may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation. The sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen forfuture use. In an alternative, the polynucleotide sequence may be used for genetic manipulation to "humanize" the antibody or to improve the affinity (affinity maturation), or other characteristics of the antibody. For example, the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans. It may be desirable to genetically manipulate the antibody sequence to obtain greater affinity to the target antigen and greater efficacy. It will be apparent to one of skill in the art that one or more polynucleotide changes can be made to the antibody and still maintain its binding specificity to the target antigen.
[0250] In other embodiments, fully human antibodies can be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins. Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are XenomouseRTM from Amgen, Inc. (Fremont, CA) and HuMAb-MouseRTM and TC MouseTM from Medarex, Inc. (Princeton, NJ) or H2L2 mice from Harbour Antibodies BV (Holland). In another alternative, antibodies may be made recombinantly by phage display or yeast technology. See, for example, U.S. Pat. Nos. 5,565,332; 5,580,717; 5,733,743; and 6,265,150; and Winter et al., (1994) Annu. Rev. Immunol. 12:433-455. Alternatively, the phage display technology (McCafferty et al., (1990) Nature 348:552-553) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
[0251] Antigen-binding fragments of an intact antibody (full-length antibody) can be prepared via routine methods. For example, F(ab')2 fragments can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab')2 fragments. Genetically engineered antibodies, such as humanized antibodies, chimeric antibodies, single-chain antibodies, and bi-specific antibodies, can be produced via, e.g., conventional recombinant technology. In one example, DNA encoding a monoclonal antibodies specific to a target antigen can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies). The hybridoma cells serve as a preferred source of such DNA. Once isolated, the DNA may be placed into one or more expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, humanHEK293 cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. See, e.g., PCT Publication No. WO 87 / 04462. The DNA can then be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al., (1984) Proc. Nat. Acad. Sci. 81:6851, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. In that manner, genetically engineered antibodies, such as “chimeric” or “hybrid” antibodies; can be prepared that have the binding specificity of a target antigen.
[0252] A single-chain antibody can be prepared via recombinant technology by linking a nucleotide sequence coding for a heavy chain variable region and a nucleotide sequence coding for a light chain variable region. Preferably, a flexible linker is incorporated between the two variable regions.
[0253] Alternatively, techniques described for the production of single chain antibodies (U.S. Patent Nos. 4,946,778 and 4,704,692) can be adapted to produce a phage or yeast scFv library and scFv clones specific to CD22 can be identified from the library following routine procedures. Positive clones can be subjected to further screening to identify those that has high CD22 binding affinity.
[0254] Antibodies obtained following a method known in the art and described herein can be characterized using methods well known in the art. For example, one method is to identify the epitope to which the antigen binds, or “epitope mapping.” There are many methods known in the art for mapping and characterizing the location of epitopes on proteins, including solving the crystal structure of an antibody-antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in Chapter 11 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999. In one example, epitope mapping can be accomplished use H / D-Ex (hydrogen deuterium exchange) coupled with proteolysis and mass spectrometry. In an additional example, epitope mapping can be used to determine the sequence to which an antibody binds. The epitope can be a linear epitope, i.e., contained in a single stretch of amino acids, or a conformational epitope formed by a three- dimensional interaction of amino acids that may not necessarily be contained in a single stretch (primary structure linear sequence). Peptides of varying lengths (e.g., at least 4-6 amino acids long) can be isolated or synthesized (e.g., recombinantly) and used for binding assays with anantibody. In another example, the epitope to which the antibody binds can be determined in a systematic screening by using overlapping peptides derived from the target antigen sequence and determining binding by the antibody. According to the gene fragment expression assays, the open reading frame encoding the target antigen is fragmented either randomly or by specific genetic constructions and the reactivity of the expressed fragments of the antigen with the antibody to be tested is determined. The gene fragments may, for example, be produced by PCR and then transcribed and translated into protein in vitro, in the presence of radioactive amino acids. The binding of the antibody to the radioactively labeled antigen fragments is then determined by immunoprecipitation and gel electrophoresis. Certain epitopes can also be identified by using large libraries of random peptide sequences displayed on the surface of phage particles (phage libraries). Alternatively, a defined library of overlapping peptide fragments can be tested for binding to the test antibody in simple binding assays. In an additional example, mutagenesis of an antigen binding domain, domain swapping experiments and alanine scanning mutagenesis can be performed to identify residues required, sufficient, and / or necessary for epitope binding. Alternatively, competition assays can be performed using other antibodies known to bind to the same antigen to determine whether an antibody binds to the same epitope as the other antibodies. Competition assays are well known to those of skill in the art.
[0255] In some examples, an anti-CD22 antibody is prepared by recombinant technology as exemplified below. Nucleic acids encoding the heavy and light chain of an anti-CD22 antibody as described herein can be cloned into one expression vector, each nucleotide sequence being in operable linkage to a suitable promoter. In one example, each of the nucleotide sequences encoding the heavy chain and light chain is in operable linkage to a distinct promoter. Alternatively, the nucleotide sequences encoding the heavy chain and the light chain can be in operable linkage with a single promoter, such that both heavy and light chains are expressed from the same promoter. When necessary, an internal ribosomal entry site (IRES) can be inserted between the heavy chain and light chain encoding sequences.
[0256] In some examples, the nucleotide sequences encoding the two chains of the antibody are cloned into two vectors, which can be introduced into the same or different cells. When the two chains are expressed in different cells, each of them can be isolated from the host cells expressing such and the isolated heavy chains and light chains can be mixed and incubated under suitable conditions allowing for the formation of the antibody.
[0257] Generally, a nucleic acid sequence encoding one or all chains of an antibody can be cloned into a suitable expression vector in operable linkage with a suitable promoter using methods known in the art. For example, the nucleotide sequence and vector can be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined together with a ligase. Alternatively, synthetic nucleic acid linkers can be ligated to the termini of a gene. These synthetic linkers contain nucleic acid sequences that correspond to a particular restriction site in the vector. The selection of expression vectors / promoter would depend on the type of host cells for use in producing the antibodies.
[0258] A variety of promoters can be used for expression of the antibodies described herein, including, but not limited to, cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR, the simian virus 40 (SV40) early promoter, E. coli lac UV promoter, and the herpes simplex tk virus promoter.
[0259] Regulatable promoters can also be used. Such regulatable promoters include those using the lac repressor from E. coli as a transcription modulator to regulate transcription from lac operator bearing mammalian cell promoters [[Brown, M. et al., Cell, 49:603-612 (1987)]], those using the tetracycline repressor (tetR) [[Gossen, M., and Bujard, H., Proc. Natl. Acad. Sci. USA 89:5547-555115 (1992); Yao, F. et al., Human Gene Therapy, 9:1939-1950 (1998); Shockelt, P., et al., Proc. Natl. Acad. Sci. USA, 92:6522-6526 (1995)]]. Other systems include FK506 dimer, VP16 or p65 using astradiol, RU486, diphenol murislerone, or rapamycin. Inducible systems are available from Invitrogen, Clontech and Ariad, among others.
[0260] Regulatable promoters that include a repressor with the operon can be used. In one embodiment, the lac repressor from E. coli can function as a transcriptional modulator to regulate transcription from lac operator-bearing mammalian cell promoters [[M. Brown et al., Cell, 49:603-612 (1987)]]; Gossen and Bujard (1992); [[M. Gossen et al., Natl. Acad. Sci. USA, 89:5547-5551(1992)]] combined the tetracycline repressor (tetR) with the transcription activator (VP 16) to create a tetR-mammalian cell transcription activator fusion protein, tTa (tetR-VP 16), with the tetO bearing minimal promoter derived from the human cytomegalovirus (hCMV) promoter to create a tetR-tet operator system to control gene expression in mammalian cells. In one embodiment, a tetracycline inducible switch is used. The tetracycline repressor (tetR) alone, rather than the tetR-mammalian cell transcription factor fusion derivatives can function as potent trans-modulator to regulate gene expression inmammalian cells when the tetracycline operator is properly positioned downstream for the TATA element of the CMVIE promoter (Yao et al., Human Gene Therapy). One particular advantage of this tetracycline inducible switch is that it does not require the use of a tetracycline repressor-mammalian cells transactivator or repressor fusion protein, which in some instances can be toxic to cells (Gossen 5 et al., Natl. Acad. Sci. USA, 89:5547-5551 (1992); Shockett et al., Proc. Natl. Acad. Sci. USA, 92:6522-6526 (1995)), to achieve its regulatable effects.
[0261] Additionally, the vector can contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene for selection of stable or transient transfectants in mammalian cells; enhancer / promoter sequences from the immediate early gene of human CMV for high levels of transcription; transcription termination and RNA processing signals from SV40 for mRNA stability; SV40 polyoma origins of replication and ColE1 for proper episomal replication; internal ribosome binding sites (IRESes), versatile multiple cloning sites; and T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA. Suitable vectors and methods for producing vectors containing transgenes are well known and available in the art. Examples of polyadenylation signals useful to practice the methods described herein include, but are not limited to, human collagen I polyadenylation signal, human collagen II polyadenylation signal, and SV40 polyadenylation signal.
[0262] One or more vectors (e.g., expression vectors) comprising nucleic acids encoding any of the antibodies (e.g., the nucleic acid coding sequence listed in Table 3) may be introduced into suitable host cells for producing the antibodies. Non-limiting examples of the host cells include Chinese hamster ovary (CHO) cells, dhfr- CHO cell, human embryonic kidney (HEK)-293 cells, verda reno (VERO) cells, nonsecreting null (NS0) cells, human embryonic retinal (PER.C6) cells, Sp2 / 0 cells, baby hamster kidney (BHK) cells, Madin- Darby Canine Kidney (MDCK) cells, Madin-Darby Bovine Kidney (MDBK) cells, and monkey kidney CV1 line transformed by SV40 (COS) cells. In some embodiments, the host cell expressing the anti-CD22 antibodies are CHO cells. The host cells can be cultured under suitable conditions for expression of the antibody or any polypeptide chain thereof. Such antibodies or polypeptide chains thereof can be recovered by the cultured cells (e.g., from the cells or the culture supernatant) via a conventional method, e.g., affinity purification. If necessary, polypeptide chains of the antibody can be incubated under suitable conditions for a suitable period of time allowing for production of the antibody. In some embodiments, the host cellcomprises the nucleic acid encoding the heavy chain of the anti-CD22 antibody. In some embodiments, the host cell comprises the nucleic acid encoding the light chain of the anti- CD22 antibody. In some embodiments, the host cell comprises the nucleic acid encoding the heavy chain and the nucleic acid encoding the light chain.
[0263] In some embodiments, methods for preparing an antibody described herein involve a recombinant expression vector that encodes both the heavy chain and the light chain of an anti-CD22 antibody, as also described herein. The recombinant expression vector can be introduced into a suitable host cell (e.g., a dhfr- CHO cell) by a conventional method, e.g., calcium phosphate mediated transfection. Positive transformant host cells can be selected and cultured under suitable conditions allowing for the expression of the two polypeptide chains that form the antibody, which can be recovered from the cells or from the culture medium. When necessary, the two chains recovered from the host cells can be incubated under suitable conditions allowing for the formation of the antibody.
[0264] In one example, two recombinant expression vectors are provided, one encoding the heavy chain of the anti-CD22 antibody and the other encoding the light chain of the anti- CD22 antibody. Both of the two recombinant expression vectors can be introduced into a suitable host cell (e.g., dhfr- CHO cell) by a conventional method, e.g., calcium phosphate- mediated transfection.
[0265] Alternatively, each of the expression vectors can be introduced into a suitable host cells. Positive transformants can be selected and cultured under suitable conditions allowing for the expression of the polypeptide chains of the antibody. When the two expression vectors are introduced into the same host cells, the antibody produced therein can be recovered from the host cells or from the culture medium. If necessary, the polypeptide chains can be recovered from the host cells or from the culture medium and then incubated under suitable conditions allowing for formation of the antibody. When the two expression vectors are introduced into different host cells, each of them can be recovered from the corresponding host cells or from the corresponding culture media. The two polypeptide chains can then be incubated under suitable conditions for formation of the antibody.
[0266] Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recovery of the antibodies from the culture medium. For example, some antibodies can be isolated by affinity chromatography with a Protein A or Protein G coupled matrix.
[0267] Any of the nucleic acids encoding the heavy chain, the light chain, or both of an anti- CD22 antibody as described herein (e.g., as provided in Table 3), vectors (e.g., expression vectors) containing such; and host cells comprising the vectors are within the scope of the present disclosure. Table 3: Nucleic acids Sequences encoding the VH / VL of anti-CD22 antibodies listed in Table 1.
[0268] In some embodiments, the present disclosure provides an isolated nucleic acid comprising a sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 13, 39, 41, 43, 59, 73, and 87. In some embodiments, the present disclosure provides an isolated nucleic acid comprising a sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 14, 40, 42, 44, 60, 74, and 88. In some embodiments, the present disclosure provides an isolated nucleic acid comprising a sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 13, 39, 41, 43, 59, 73, and 87, and an isolated nucleic acid comprising a sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 14, 40, 42, 44, 60, 74, and 88.
[0269] In some embodiments, the present disclosure provides an isolated nucleic acid comprising a sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 15,61, 75, and 89. In some embodiments, the present disclosure provides an isolated nucleic acid comprising a sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 16, 62, 76, and 90. In some embodiments, the present disclosure provides an isolated nucleic acid comprising a sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 15, 61, 75, and 89, and a nucleic acid comprising a sequence at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 16, 62, 76, and 90.
[0270] In some embodiments, the present disclosure provides an expression vector encoding the anti-CD22 antibody described herein. In some embodiments, the expression vector comprises an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 13, 39, 41, 43, 59, 73, and 87. In some embodiment, the expression vector comprises an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 14, 40, 42, 44, 60, 74, and 88. In some embodiment, the expression vector comprises an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 13, 39, 41, 43, 59, 73, and 87, and an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 14, 40, 42, 44, 60, 74, and 88. In some embodiments, the expression vector comprises an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 15, 61, 75, and 89. In some embodiment, the expression vector comprises an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 16, 62, 76, and 90. In some embodiment, the expression vector comprises an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 15, 61, 75, and 89, and an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 16, 62, 76, and 90.
[0271] In some embodiments, the anti-CD22 described herein is produced by expressing in a recombinant cell: (i) an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 13, 39, 41, 43, 59, 73, and 87, and / or (ii) an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 14, 40, 42, 44, 60, 74, and 88.
[0272] In some embodiments, the anti-CD22 described herein is produced by expressing in a recombinant cell: (i) an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 15, 61, 75, and 89, and / or (ii) an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 16, 62, 76, and 90.
[0273] In some embodiments, the anti-CD22 described herein is produced by expressing in a recombinant cell an expression vector comprising: (i) an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 13, 39, 41, 43, 59, 73, and 87, and / or (ii) an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 14, 40, 42, 44, 60, 74, and 88.
[0274] In some embodiments, the anti-CD22 described herein is produced by expressing in a recombinant cell an expression vector comprising: (i) an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 15, 61, 75, and 89, and / or (ii) an isolated nucleic acid at least 60% (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to any one of SEQ ID NOs: 16, 62, 76, and 90.
[0275] In some embodiments, the present disclosure provides a recombinant cell (e.g., a recombinant cell for producing the antibody) expressing the anti-CD22 antibody described herein.
[0276] Accordingly, the present disclosure provides methods for producing the antibody, the methods comprising culturing the recombinant cells under conditions suitable for expression of the antibody from the expression vector by the recombinant cell. Recombinant cells expressing the antibody can be cultured in any suitable condition known in the art. In someembodiments, the method further comprising isolating the antibody from the culture media in which the cell or cells were cultured using any suitable known methods in the art. IV. Pharmaceutical Composition
[0277] The antibodies, as well as the encoding nucleic acids or nucleic acid sets, vectors comprising such, or host cells comprising the vectors, as described herein can be mixed with a pharmaceutically acceptable carrier (excipient) to form a pharmaceutical composition for use in treating a target disease. “Acceptable” means that the carrier must be compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated. Pharmaceutically acceptable excipients (carriers) including buffers, which are well known in the art. See, e.g., Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover.
[0278] The anti-CD22 antibody containing pharmaceutical composition disclosed herein may further comprise a suitable buffer agent. A buffer agent is a weak acid or base used to maintain the pH of a solution near a chosen value after the addition of another acid or base. In some examples, the buffer agent disclosed herein can be a buffer agent capable of maintaining physiological pH despite changes in carbon dioxide concentration (produced by cellular respiration). Exemplary buffer agents include, but are not limited to a HEPES (4-(2- hydroxyethyl)-1-piperazineethanesulfonic acid) buffer, Dulbecco's phosphate-buffered saline (DPBS) buffer, or Phosphate-buffered Saline (PBS) buffer. Such buffers may comprise disodium hydrogen phosphate and sodium chloride, or potassium dihydrogen phosphate and potassium chloride.
[0279] In some embodiments, the buffer agent in the pharmaceutical composition described herein may maintain a pH value of about 5-8. For example, the pH of the pharmaceutical composition can be about 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, or 8.0. In other examples, the pharmaceutical composition may have a pH value lower than 7, for example, about 7, 6.8, 6.5, 6.3, 6, 5.8, 5.5, 5.3, or 5.
[0280] The pharmaceutical composition described herein comprises one or more suitable salts. A salt is an ionic compound that can be formed by the neutralization reaction of an acid and a base. (Skoog, D.A; West, D.M.; Holler, J.F.; Crouch, S.R. (2004). “chapters 14–16”. Fundamentals of Analytical Chemistry (8th ed.)). Salts are composed of related numbers of cations (positively charged ions) and anions (negative ions) so that the product is electrically neutral (without a net charge).
[0281] In some embodiments, the pharmaceutical compositions can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions. (Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover). In some embodiments, the pharmaceutical composition can be formulated for intravenous injection. In some embodiments, the pharmaceutical composition can be formulated for subcutaneous injection.
[0282] The pharmaceutical compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes. Therapeutic antibody compositions are generally placed into a container having a sterile access port, for example, an intravenous or subcutaneous solution bag or vial having a stopper pierceable by a hypodermic injection needle. V. Methods of Use
[0283] Aspects of the disclosure relate to compositions and methods for treating B cell disorders and / or one or more conditions arising as a result of B cell disorders in a subject.
[0284] In some aspect, the disclosure features a method for treating a B cell disorder, the method comprising administering to a subject with a B cell disorder an effective amount of a therapeutic agent, thereby treating the B cell disorder, wherein the therapeutic agent is or comprises: (i) any one or more of the antibodies or antigen-binding fragments thereof described herein (including conjugates), (ii) any one or more of the fusion proteins described herein, (iii) any one or more of the bispecific or multispecific polypeptides described herein; (iv) any one or more of the nucleic acids described herein; (v) any one or more of the expression vectors described herein; (vi) any one or more of the recombinant cells described herein; (vii) any one or more of the isolated polypeptides described herein; and / or (viii) any one or more of the pharmaceutical compositions described herein.
[0285] In some embodiments, the B cell disorder is an autoimmune disease, such as wherein the autoimmune disease is rheumatoid arthritis, systemic lupus erythematosus (SLE), myasthenia gravis, Graves’ disease, or immune thrombocytopenic purpura (ITP).
[0286] In some embodiments, the B cell disorder is a cancer. The cancer can be, e.g., a B cell lymphoma, such as a non-Hodgkin lymphoma. The non-Hodgkin lymphoma can be, e.g., Burkitt lymphoma, chronic lymphocytic leukemia (CLL), diffuse large B-cell lymphoma, follicular lymphoma, or mantle cell lymphoma.
[0287] In yet another aspect, the disclosure features a method for preventing, reducing, delaying or inhibiting the proliferation and / or growth of a cancer cell comprising contactingthe cancer cell with a therapeutic agent that binds to CD22 expressed on the surface of the cancer cell, wherein the therapeutic agent is: (i) any one or more of the antibodies or antigen- binding fragments thereof described herein (including conjugates), (ii) any one or more of the fusion proteins described herein, (iii) any one or more of the bispecific or multispecific polypeptides described herein; (iv) any one or more of the recombinant cells described herein; (v) any one or more of the isolated polypeptides described herein; and / or (vi) any one or more of the pharmaceutical compositions described herein.
[0288] In certain embodiments, the therapeutic agent can be administered through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, subcutaneously, intra-ocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices. In certain embodiments, the compositions can be administered by bolus injection or continuously by infusion, or by implantation device.
[0289] Determination of whether an amount of the antibody (e.g., anti-CD22 antibody) achieved the therapeutic effect would be evident to one of skill in the art based on the teachings provided herein. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. The particular dosage regimen, i.e., dose, timing and repetition, used in the method described herein will depend on the particular subject and that subject's medical history, as discussed herein.
[0290] Empirical considerations, such as time to maximum effect, the half-life, and / or time above a specific concentration generally will contribute to the determination of the dosage. For example, antibodies that are compatible with the human immune system, such as humanized antibodies or fully human antibodies, may be used to prolong half-life of the antibody and to prevent the antibody being attacked by the host's immune system. Other reasons for dose-adjusting include differences in pharmacokinetics or pharmacodynamic response driven by sex, age, individual response, polymorphisms on the antibody target and / or receptors involved in antibody clearance. Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and / or suppression and / or amelioration and / or delay of a targetdisease / disorder. Alternatively, sustained continuous release formulations of an antibody may be appropriate. Various formulations and devices for achieving sustained release are known in the art.
[0291] Dosing frequencies may vary in accordance with the claimed methods. In some embodiments, a composition may be administered once. In some embodiments, a composition will be administered on multiple occasions. In some embodiments, dosing frequency is every week, every 2 weeks, every 3 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every 2 months, or every 3 months, or longer. In some embodiments, a composition will be administered daily, biweekly, weekly, bimonthly, monthly, or at any time interval that provide suitable (e.g., maximal) efficacy while minimizing safety risks to the subject. Generally, the efficacy and the treatment and safety risks may be monitored throughout the course of treatment.
[0292] In some embodiments, a subject may be administered a composition provided herein (e.g., an anti-CD22 antibody) at one or more intervals during a set period of time. In some cases, periods of time during which a subject is administered a composition at one or more intervals may be separated by periods of time in which the subject is not administered the composition. In some embodiments, the relative durations of respective periods of time may depend on the subject’s response to treatment or severity of disease or both and / or may be determined based on the judgment of a treating physician.
[0293] In some embodiments, an antibody can be administered parenterally. For example, a parenterally administered composition may be administered by subcutaneous, intracutaneous, intravenous, intraperitoneal, intratumor, intramuscular, intraarticular, intraarterial, or infusion techniques. In addition, it can be administered to the subject via injectable depot routes of administration such as using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods.
[0294] In some embodiments, an antibody (e.g., an anti-CD22 antibody) is administered intravenously. In some embodiments, an antibody (e.g., an anti-CD22 antibody) is administered subcutaneously.
[0295] For intravenous injection, water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically acceptable excipient is infused. Physiologically acceptable excipients may include, for example, 5% dextrose, 0.9% saline. Ringer’s solution or other suitable excipients. Otherinjectable compositions may contain various carriers such as vegetable oils, dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like). In some cases, preparations, e.g., a sterile formulation of a suitable soluble salt form of the antibody, can be dissolved and administered in a pharmaceutical excipient such as Water-for- Injection, 0.9% saline, or 5% glucose solution.
[0296] In one embodiment, an antibody is administered via site-specific or targeted local delivery techniques. Examples of site-specific or targeted local delivery techniques include various implantable depot sources of the antibody or local delivery catheters, such as infusion catheters, an indwelling catheter, or a needle catheter, synthetic grafts, adventitial wraps, shunts and stents or other implantable devices, site specific carriers, direct injection, or direct application. See, e.g., PCT Publication No. WO 00 / 53211 and U.S. Pat. No. 5,981,568.
[0297] In some embodiments, more than one antibody, or a combination of an antibody and another suitable therapeutic agent, may be administered to a subject in need of the treatment. The antibody can also be used in conjunction with other agents that serve to enhance and / or complement the effectiveness of the agents. Treatment efficacy for a target disease / disorder can be assessed by methods well-known in the art.
[0298] The anti-CD22 antibody and treatment methods involving such as described in the present disclosure may be utilized in combination with other types of therapy for the target disease or disorder disclosed herein. In this context, an antibody composition and a therapeutic agent may be given either simultaneously or sequentially. Examples include chemotherapy, immune therapy, surgery, radiation, gene therapy, and so forth, or anti- infection therapy. Such therapies can be administered simultaneously or sequentially (in any order) with the treatment according to the present disclosure.
[0299] For example, the combination therapy can include the anti-CD22 antibody and pharmaceutical composition described herein, co-formulated with and / or co-administered with, at least one additional therapeutic agent. Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus preventing possible toxicities or complications associated with the various monotherapies.
[0300] In some embodiments, the antibodies described herein are conjugated directly or indirectly to one or more molecular payloads or labels. For example, in some embodiments, antibodies described herein are conjugated to molecular payload, e.g., a molecular payload providing a therapeutic benefit for a subject, e.g., an antibody-drug conjugate (ADC).Accordingly, in some embodiments, methods are provided for delivering a molecular payloads to a subject for therapeutic purposes. In such embodiments, the molecular payload may be a small molecule, protein, nucleic acid, oligonucleotide, or any molecular entity capable of modulating the activity or function of a gene, protein, and / or nucleic acid, e.g., in a cell. In some embodiments, the molecular payload is a cytotoxic agent or a chemotherapeutic agent.
[0301] Any of the anti-CD22 antibodies disclosed herein can also be used for detecting presence of CD22 in vitro or in vivo. Results obtained from such detection methods can be used for diagnostic purposes (e.g., diagnosing diseases associated with CD22) or for scientific research purposes (e.g., identifying new CD22 secreting cell types, studying bioactivity and / or regulation of secreted CD22). For assay uses such as diagnostic uses, an anti-CD22 antibody as described herein may be conjugated with a detectable label (e.g., an imaging agent such as a contrast agent) for detecting presence of CD22 (e.g., soluble CD22), either in vivo or in vitro.
[0302] In other embodiments, an anti-CD22 antibody as described herein can be attached to a detectable label, which is a compound that is capable of releasing a detectable signal, either directly or indirectly, such that the aptamer can be detected, measured, and / or qualified, in vitro or in vivo. Examples of such “detectable labels" are intended to include, but are not limited to, fluorescent labels, chemiluminescent labels, colorimetric labels, enzymatic markers, radioactive isotopes, and affinity tags such as biotin. Such labels can be conjugated to the aptamer, directly or indirectly, by conventional methods.
[0303] In some embodiments, the detectable label is an agent suitable for detecting CD22 expressing cells in vitro, which can be a radioactive molecule, a radiopharmaceutical, or an iron oxide particle. Radioactive molecules suitable for in vivo imaging include, but are not limited to,122I,123I,124I,125I,131I,18F,75Br,76Br,77Br,211At,225Ac,177Lu,153Sm,186Re,188Re,67Cu,213Bi,212Bi,212Pb, and67Ga. Exemplary radiopharmaceuticals suitable for in vivo imaging include111In Oxyquinoline,131I Sodium iodide,99mTc Mebrofenin, and99mTc Red Blood Cells,123I Sodium iodide,99mTc Exametazime,99mTc Macroaggregate Albumin,99mTc Medronate,99mTc Mertiatide,99mTc Oxidronate,99mTc Pentetate,99mTc Pertechnetate,99mTc Sestamibi,99mTc Sulfur Colloid,99mTc Tetrofosmin, Thallium-201, or Xenon-133.
[0304] The reporting agent can also be a dye, e.g., a fluorophore, which is useful in detecting a disease mediated by CD22 expressing cells in tissue samples.
[0305] To perform a diagnostic assay in vitro, an anti-CD22 antibody can be brought in contact with a sample suspected of containing CD22, e.g., CD22 expressing cells in disease microenvironment. The antibody and the sample may be incubated under suitable conditions for a suitable period to allow for binding of the antibody to the CD22 antigen. Such an interaction can then be detected via routine methods, e.g., ELISA, histological staining or FACS. To perform a diagnostic assay in vivo, a suitable amount of anti-CD22 antibodies, conjugated with a label (e.g., an imaging agent or a contrast agent), can be administered to a subject in need of the examination. Presence of the labeled antibody can be detected based on the signal released from the label by routine methods.
[0306] perform scientific research assays, an anti-CD22 antibody can be used to study bioactivity of CD22, detect the presence of CD22 intracellularly, and or regulating the effect of CD22. For example, a suitable amount of anti-CD22 can be brought in contact with a sample (e.g. a new cell type that is not previously identified as CD22 producing cells) suspected of producing CD22. The cells are permeabilized prior to contacting the anti-CD22 antibody. The antibody and the sample may be incubated under suitable conditions for a suitable period to allow for binding of the antibody to the CD22 antigen. Such an interaction can then be detected via routine methods, e.g., ELISA, histological staining or FACS. VI. Kits for Therapeutic and Diagnostic Applications
[0307] The present disclosure also provides kits for the therapeutic or diagnostic applications as disclosed herein. Such kits can include one or more containers comprising an anti-CD22 antibody, e.g., any of those described herein.
[0308] In some embodiments, the kit can comprise instructions for use in accordance with any of the methods described herein. The included instructions can comprise a description of administration of the anti-CD22 antibody to treat, delay the onset, or alleviate a target disease as those described herein. The kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has the target disease. In still other embodiments, the instructions comprise a description of administering an antibody to an individual at risk of the target disease.
[0309] The instructions relating to the use of an anti-CD22 antibody generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
[0310] The label or package insert indicates that the composition is used for treating, delaying the onset and / or alleviating a disease or disorder. Instructions may be provided for practicing any of the methods described herein.
[0311] The kits of this invention are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like.
[0312] Also contemplated are packages for use in combination with a specific device, such as an infusion device, such as a minipump. A kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an anti-CD22 antibody as those described herein.
[0313] Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container. In some embodiments, the invention provides articles of manufacture comprising contents of the kits described above.
[0314] Also provided herein are kits for use in detecting CD22 in a sample. Such a kit may comprise any of the anti-CD22 antibodies described herein. In some instances, the anti-CD22 antibody can be conjugated with a detectable label as those described herein. Conjugated or attached can include covalent or noncovalent bonding as well as other forms of association, such as entrapment, e.g., of one entity on or within the other, or of either or both entities on or within a third entity, such as a micelle.
[0315] Alternatively or in addition, the kit may comprise a secondary antibody capable of binding to anti-CD22 antibody. The kit may further comprise instructions for using the anti- CD22 antibody for detecting CD22. EXAMPLES Example 1: Screening Methods. i. SPRi for Binding Affinity
[0316] Antibody binding kinetic experiments were performed using the Carterra® LSA, with a phosphate buffered saline (PBS) based running buffer at pH 7.40, and with 1% BSA and0.05% Tween20. Antibodies were captured on an anti-human Fc capture chip prepared with a HC30M chip (also Carterra). For kinetics analysis, purified recombinant His-tagged human CD22 at a concentration from 0.076 nM to 500 nM (a serial 3-fold dilution) was injected sequentially. For each concentration, there was 5-minute association followed by 15 minute dissociation. Results were processed and analyzed using the Carterra LSA Kinetics Software. A sensogram showing detector response versus time for the interaction between mAbs-1-4 and the immobilized recombinant human CD22 is provided in FIGs. 1A-1D.
[0317] The output from the instrument is a sensogram, which is a plot of detector response (measured in "resonance units” (RU)) as a function of time. An increase of 1000 RU corresponds to an increase of mass on the sensor surface of approximately 1 ng / mm2.
[0318] The kinetic data were referenced with the interstitial reference spots and double- referenced to a buffer cycle, and then fit globally to a 1:1 binding model to determine apparent association and dissociation kinetic rate constants (ka and kd values). The ratio kd / ka was used to derive the KD value of each antigen / mAb interaction, i.e., KD=kd / ka.
[0319] A summary of the binding kinetics for mAbs-1-4 are provided below in Table 4. Table 4.“Rmax” is the maximum SPR signal generated by the mAbs-1-4 / CD22 interaction. “Res SD” refers to the residual standard deviation.
[0320] For the reactivity assay to Rhesus CD22, His-tagged rhesus CD22 (Acro) at 300 nM was used in the binding assay. Results were processed and analyzed using the Carterra LSA Kinetics Software (as above). The data were referenced with the interstitial reference spots and double-referenced to a buffer cycle, and then the responses (nm) after association werereported. Isotype control was used to determine the cutoff response for positive binding. Under these conditions, mAb-1 was determined to be cross-reactive with rhesus CD22. ii. Cell Binding
[0321] To calculate the EC50 for antibody binding to cells expressing CD22, anti-CD22 antibodies were tested at a concentration from 100 nM to 0.6 pM (a serial 3-fold dilution) for binding to Raji cells. Cells were then incubated with the secondary antibody R-Phycoerythrin AffiniPure Goat Anti-Human IgG (Jackson Immunoresearch 109-115-098). The data were acquired on FACSCanto II (BD). Median fluorescence intensities (MFI) were plotted against the concentrations of the anti-CD22 antibodies. EC50 was derived from fitting to 4 parameter dose-response curve.
[0322] A summary of EC50 for mAbs-2-4 is provided below in Table 5. Table 5.OTHER EMBODIMENTS
[0323] All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.
[0324] From the above description, one skilled in the art can easily ascertain the essential characteristics of the present invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, other embodiments are also set forth as follows: EQUIVALENTS AND SCOPE
[0325] In the claims, articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from thecontext. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
[0326] Furthermore, the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Where elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is / are referred to as comprising particular elements and / or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and / or features. For purposes of simplicity, those embodiments have not been specifically set forth in haec verba herein.
[0327] The phrase “and / or,” as used herein in the specification and in the claims, should be understood to mean “either or both” of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Multiple elements listed with “and / or” should be construed in the same fashion, i.e., “one or more” of the elements so conjoined. Other elements may optionally be present other than the elements specifically identified by the “and / or” clause, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, a reference to “A and / or B”, when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
[0328] As used herein in the specification and in the claims, “or” should be understood to have the same meaning as “and / or” as defined above. For example, when separating items in a list, “or” or “and / or” shall be interpreted as being inclusive, i.e., the inclusion of at least one, but also including more than one, of a number or list of elements, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as “only one of” or “exactly one of,” or, when used in the claims, “consisting of,” will refer to the inclusion of exactly one element of a number or list of elements. In general, the term “or” as used hereinshall only be interpreted as indicating exclusive alternatives (i.e. “one or the other but not both”) when preceded by terms of exclusivity, such as “either,” “one of,” “only one of,” or “exactly one of.” “Consisting essentially of,” when used in the claims, shall have its ordinary meaning as used in the field of patent law.
[0329] As used herein in the specification and in the claims, the phrase “at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase “at least one” refers, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, “at least one of A and B” (or, equivalently, “at least one of A or B,” or, equivalently “at least one of A and / or B”) can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
[0330] It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.
[0331] In the claims, as well as in the specification above, all transitional phrases such as “comprising,” “including,” “carrying,” “having,” “containing,” “involving,” “holding,” “composed of,” and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases “consisting of” and “consisting essentially of” shall be closed or semi-closed transitional phrases, respectively, as set forth in the United States Patent Office Manual of Patent Examining Procedures, Section 2111.03. It should be appreciated that embodiments described in this document using an open-ended transitional phrase (e.g., “comprising”) are also contemplated, in alternative embodiments, as “consisting of” and “consisting essentially of” the feature described by the open-ended transitional phrase. For example, if the application describes “a composition comprising A and B,” theapplication also contemplates the alternative embodiments “a composition consisting of A and B” and “a composition consisting essentially of A and B.”
[0332] Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
[0333] This application refers to various issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a conflict between any of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the invention can be excluded from any claim, for any reason, whether or not related to the existence of prior art.
[0334] Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present embodiments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended claims. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.
[0335] The recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups. The recitation of an embodiment for a variable herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof. The recitation of an embodiment herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
Claims
CLAIMS What is claimed is:
1. An antibody that specifically binds to human CD22, the antibody comprising HC CDR1, HC CDR2 and HC CDR3 of the heavy chain variable region set forth in SEQ ID NO: 7, 55, 69, or 83.
2. The isolated antibody of claim 1, wherein the antibody further comprises LC CDR1, LC CDR2 and LC CDR3 of the light chain variable region set forth in SEQ ID NO: 8, 56, 70, or 84.
3. The antibody of claim 1 or 2, wherein: (i) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 1, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 2, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 3; (ii) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 49, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 50, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 51; (iii) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 64, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 65; or (iv) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 78, and (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO:
79.
4. The antibody of claim 2 or 3, wherein: (i) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 4; (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 5; and (c) LC is or comprises the amino acid sequence depicted in SEQ ID NO: 6; (ii) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 52, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 53, and (c) LC is or comprises the amino acid sequence depicted in SEQ ID NO: 54;(iii) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 66, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 67, and (c) LC is or comprises the amino acid sequence depicted in SEQ ID NO: 68; or (iv) (a) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 80, (b) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 81, and (c) LC is or comprises the amino acid sequence depicted in SEQ ID NO:
82.
5. The antibody according to any one of claims 1-4, wherein: (i) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 1, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 2, (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 3, (d) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 4, (e) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 5, and (f) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 6; (ii) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 49, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 50, (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 51, (d) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 52, (e) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 53, and (f) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 54; (iii) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 64, (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 65, (d) LC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 66, (e) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 67, and (f) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 68; or (iv) (a) HC CDR1 is or comprises the amino acid sequence depicted in SEQ ID NO: 63, (b) HC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 78, (c) HC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO: 79, (d) LC CDR1 is or comprises the amino acid sequencedepicted in SEQ ID NO: 80, (e) LC CDR2 is or comprises the amino acid sequence depicted in SEQ ID NO: 81, and (f) LC CDR3 is or comprises the amino acid sequence depicted in SEQ ID NO:
82.
6. The antibody of any one of claims 1-5, wherein the antibody comprises (i) the heavy chain variable region sequence set forth in SEQ ID NO: 7 and the light chain variable region sequence set forth in SEQ ID NO: 8; (ii) the heavy chain variable region sequence set forth in SEQ ID NO: 55 and the light chain variable region sequence set forth in SEQ ID NO: 56; (iii) the heavy chain variable region sequence set forth in SEQ ID NO: 69 and the light chain variable region sequence set forth in SEQ ID NO: 70; or (iv) the heavy chain variable region sequence set forth in SEQ ID NO: 83 and the light chain variable region sequence set forth in SEQ ID NO:
84.
7. The antibody of any one of claims 1-5, wherein the antibody comprises a heavy chain variable region comprising an amino acid sequence that is at least 75%, 80%, 85%, 90%, 95%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 8, 56, 70, or 84.
8. The antibody according to any one of claims 1-5 or 7, wherein the antibody comprises a light chain variable region comprising an amino acid sequence that is at least 75%, 80%, 85%, 90%, 95%, 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 7, 55, 69, or 83.
9. An antibody that cross-competes for binding to human CD22 with an antibody of any one of claims 1-8.
10. The antibody of any one of claims 1-9, wherein the antibody is a human antibody.
11. The antibody of any one of claims 1-10, wherein the antibody comprises a heavy chain constant region.
12. The antibody of any one of claims 1-10, wherein the antibody comprises a human heavy chain Fc region.
13. The antibody of claim 12, wherein the heavy chain Fc region is selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.
14. The antibody of any one of claims 1-13, wherein the antibody is an IgG1 antibody.
15. The antibody of claim any one of claims 1-14, wherein the antibody comprises a light chain constant region.
16. The antibody of claim 15, wherein the light chain is a kappa light chain.
17. The antibody of any one of claims 14-16, wherein the antibody comprises a heavy chain set forth in SEQ ID NO: 11, 57, 71, or 85.
18. The antibody of claim 16 or 17, wherein the antibody comprises a light chain set forth in SEQ ID NO: 12, 58, 72, or 86.
19. The antibody of any one of claims 1-18, wherein the antibody comprises: (i) a heavy chain set forth in SEQ ID NO: 11, and a light chain set forth in SEQ ID NO: 12; (ii) a heavy chain set forth in SEQ ID NO: 57, and a light chain set forth in SEQ ID NO: 58; (iii) a heavy chain set forth in SEQ ID NO: 71, and a light chain set forth in SEQ ID NO: 72; or (iv) a heavy chain set forth in SEQ ID NO: 85, and a light chain set forth in SEQ ID NO: 86.
20. The antibody of any one of claims 1-19, wherein the antibody further comprises a heterologous moiety.
21. The antibody of any one of claims 1-20, wherein the heterologous moiety is a cytotoxic agent, cytostatic agent, radionuclide, or detectable label.
22. A fusion protein comprising an antibody of any one of claims 1-21.
23. The antibody of any one of claims 1-19, wherein the antibody is a multispecific antibody that specifically binds CD22 and one or more additional target antigens.
24. The antibody of claim 23, wherein the antibody is a bispecific antibody that specifically binds to CD22 and one additional target antigen.
25. An isolated nucleic acid encoding the antibody of any one of claims 1-19, 23, or 24, or the fusion protein of claim 22.
26. An expression vector comprising the isolated nucleic acid of claim 25.
27. A recombinant cell comprising the isolated nucleic acid of claim 25 or the expression vector of claim 26.
28. A method for expressing the antibody of any one of claims 1-19, 23, or 24, or the fusion protein of claim 22, the method comprising culturing the recombinant cell according to claim 27, or a plurality of such cells, under conditions suitable for expression of the antibody or the fusion protein from the expression vector by the cell or cells.
29. The method of claim 28, further comprising isolating the antibody or fusion protein from the cell or cells or from the culture media in which the cell or cells were cultured.
30. An isolated antibody or fusion protein produced by the method of claim 28 or 29.
31. A composition comprising: (a) (i) the antibody of any one of claims 1-19, 23, or 24, (ii) the fusion protein according to claim 22, (iii) the isolated nucleic acid of claim 25, (iv) the expression vector of claim 26; (v) the recombinant cell of claim 27; or (vi) the antibody or fusion protein according to claim 30; and (b) a pharmaceutically acceptable carrier or excipient.
32. A method for treating a B cell disorder, the method comprising administering to a subject with a B cell disorder an effective amount of a therapeutic agent, thereby treating the B cell disorder, wherein the therapeutic agent is or comprises: (i) the antibody according to any one of claims 1-19, 23, or 24, (ii) the fusion protein according to claim 22, (iii) the isolated nucleic acid of claim 25, (iv) the expression vector according to claim 26; (v) the recombinant cell according to claim 27; (vi) the antibody or fusion protein according to claim 30; or (vii) the pharmaceutical composition according to claim 31.
33. The method of claim 32, wherein the B cell disorder is an autoimmune disease.
34. The method of claim 33, wherein the autoimmune disease is rheumatoid arthritis, systemic lupus erythematosus (SLE), myasthenia gravis, Graves’ disease, or immune thrombocytopenic purpura (ITP).
35. The method of claim 32, wherein the B cell disorder is a cancer.
36. The method of claim 35, wherein the cancer is a B cell lymphoma.
37. The method of claim 36, wherein the B cell lymphoma is a non-Hodgkin lymphoma.
38. The method of claim 37, wherein the non-Hodgkin lymphoma is Burkitt lymphoma, chronic lymphocytic leukemia (CLL), diffuse large B-cell lymphoma, follicular lymphoma, or mantle cell lymphoma.
39. The method of any one of claims 32-38, wherein the therapeutic agent is administered intravenously.
40. The method according to any one of claims 32-38, wherein the therapeutic agent is administered subcutaneously.
41. An antibody that specifically binds to human CD22, the antibody comprising HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3, wherein: (i) (a) HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 1, (b) HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 2; (c) HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 3, (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 4, (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 5, and (f) LC CDR3comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, Or 100% identity to SEQ ID NO: 6; (ii) (a) HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 49, (b) HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 50, (c) HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 51, (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 52, (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 53, and (f) LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, Or 100% identity to SEQ ID NO: 54; (iii) (a) HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 63, (b) HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 64, (c) HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 65, (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 66, (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 67,and (f) LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, Or 100% identity to SEQ ID NO: 68; or (iv) (a) HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 63, (b) HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 78, (c) HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 79, (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 80, (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 81, and (f) LC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, Or 100% identity to SEQ ID NO:
82.
42. The antibody of claim 41, wherein (i) the VHcomprises: (a) a HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 1; (b) a HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 2; or (c) a HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 3; andthe VLcomprises a: (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 4; (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 5; or (f) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 6; (ii) the VHcomprises: (a) a HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 49; (b) a HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 50; or (c) a HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 51; and the VLcomprises a: (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 52; (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 53; or (f) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 54; (iii) the VH comprises: (a) a HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%,99.9%, 99.99%, or 100% identity to SEQ ID NO: 63; (b) a HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 64; or (c) a HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 65; and the VLcomprises a: (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 66; (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 67; or (f) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 68; or (iv) the VHcomprises: (a) a HC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 63; (b) a HC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 78; or (c) a HC CDR3 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 79; and the VLcomprises a: (d) LC CDR1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO: 80; (e) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%,99.9%, 99.99%, or 100% identity to SEQ ID NO: 81; or (f) LC CDR2 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, or 100% identity to SEQ ID NO:
82.
43. The antibody of claim 41 or 42, wherein: (a) the VH comprises at least two CDRs selected from (i)(a)-(c), (ii)(a)-(c), (iii)(a)-(c), or (iv)(a)-(c); (b) the VL comprises at least two CDRs selected from (i)(d)-(f), (ii)(d)-(f), (iii)(d)-(f), or (iv)(d)-(f); or (c) the VH comprises at least two CDRs selected from (i)(a)-(c), (ii)(a)-(c), (iii)(a)-(c), or (iv)(a)-(c) and the VLcomprises at least two CDRs selectedfrom (i)(d)-(f),(ii)(d)-(f), (iii)(d)-(f), or (iv)(d)-(f).
44. An antibody that cross-competes the binding to human CD22 with an antibody of any one of claims 41-43.
45. The antibody of any one of claims 41-44, wherein the antibody is a human antibody.
46. The antibody of claim any one of claims 41-45, wherein the antibody comprises a heavy chain constant region.
47. The antibody of any one of claims 41-46, wherein the antibody comprises a human heavy chain constant region.
48. The antibody of any one of claims 41-47, wherein the heavy chain constant region is selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.
49. The antibody of any one of claims 41-48, wherein the heavy chain constant region is IgG1.
50. The antibody of any one of claims 41-49, wherein the Engineered Antibody further comprises a heterologous moiety.
51. The antibody of claim 50, wherein the heterologous moiety is a cytotoxic agent, cytostatic agent, radionuclide, or detectable label.
52. A fusion protein comprising the antibody of any one of claims 41-51.
53. The antibody of any one of claims 41-52, wherein the antibody is a multispecific antibody that specifically binds CD22 and one or more additional target antigens.
54. The antibody of claim 53, wherein the antibody is a bispecific antibody that specifically binds to CD22 and one additional target antigen.
55. An isolated nucleic acid encoding the antibody of any one of claims 41-49, 53, or 54, or the fusion protein according to claim 52.
56. An expression vector comprising the isolated nucleic acid of claim 55.
57. A recombinant cell comprising the isolated nucleic acid of claim 55 or the expression vector of claim 56.
58. A method for expressing the antibody of any one of claims 41-49, 53 or 54, the method comprising culturing the recombinant cell according to claim 57, or a plurality of such cells, under conditions suitable for expression of the polypeptide from the expressionvector by the cell or cells.
59. The method of claim 58, further comprising isolated the polypeptide from the cell or cells or from the culture media in which the cell or cells were cultured.
60. An antibody or a fusion protein produced by the method of claim 58 or 59.
61. A pharmaceutical composition comprising: (a) (i) the antibody of any one of claims 41-49, 53, or 54, (ii) the fusion protein according to claim 52; (iii) the isolated nucleic acid of claim 55, (iv) the expression vector according to claim 56; (v) the recombinant cell according to claim 57; or (vi) the isolated antibody or fusion protein of claim 60; and (b) a pharmaceutically acceptable carrier or excipient.
62. A method for treating a B cell disorder, the method comprising administering to a subject with a B cell disorder an effective amount of a therapeutic agent, thereby treating the B cell disorder, wherein the therapeutic agent is or comprises: (i) the antibody of any one of claims 41-49, 53, 54 or 90, (ii) the fusion protein according to claim 52; (iii) the isolated nucleic acid of claim 55, (iv) the expression vector according to claim 56; (v) the recombinant cell according to claim 57; (vi) the isolated antibody or fusion protein of claim 60; or (vii) the composition of claim 61.
63. The method of claim 62, wherein the B cell disorder is an autoimmune disease.
64. The method of claim 63, wherein the autoimmune disease is rheumatoid arthritis, systemic lupus erythematosus (SLE), myasthenia gravis, Graves’ disease, or immune thrombocytopenic purpura (ITP).
65. The method of claim 62, wherein the B cell disorder is a cancer.
66. The method of claim 65, wherein the cancer is a B cell lymphoma.
67. The method of claim 66, wherein the B cell lymphoma is a non-Hodgkin lymphoma.
68. The method of claim 67, wherein the non-Hodgkin lymphoma is Burkitt lymphoma, chronic lymphocytic leukemia (CLL), diffuse large B-cell lymphoma, follicular lymphoma, or mantle cell lymphoma.
69. The method of any one of claims 62-68, wherein the therapeutic agent is administered intravenously.
70. The method of any one of claims 62-68, wherein the therapeutic agent is administered subcutaneously.
71. A chimeric antigen receptor (CAR) comprising the antibody of any one of claims 1-8 or 41-43 or 90.
72. The CAR of claim 71, further comprising a hinge region.
73. The CAR of claim 71 or 72, further comprising a transmembrane domain.
74. The CAR of any one of claims 71-73, further comprising an intracellular domain.
75. The CAR of any one of claims 71-74, further comprising a co-stimulatory domain.
76. An isolated nucleic acid encoding the CAR of any one of claims 71-75.
77. An expression vector comprising the isolated nucleic acid of claim 76.
78. An immune cell expressing the CAR of any one of the claims 71-75, or comprising the isolated nucleic acid of claim 76 or the expression vector of claim 77.
79. The immune cell of claim 78, wherein the immune cell is a T cell, a NK cell, or a NKT cell.
80. A composition comprising the immune cell of claim 78 or 79, and a pharmaceutically acceptable carrier.
81. A method for treating a B cell disorder, the method comprising administering to a subject with a B cell disorder an effective amount of the immune cell of claim 78 or 79, or the composition of claim 80.
82. The method of claim 81, wherein the B cell disorder is an autoimmune disease.
83. The method of claim 82, wherein the autoimmune disease is rheumatoid arthritis, systemic lupus erythematosus (SLE), myasthenia gravis, Graves’ disease, or immune thrombocytopenic purpura (ITP).
84. The method of claim 81, wherein the B cell disorder is a cancer.
85. The method of claim 84, wherein the cancer is a B cell lymphoma.
86. The method of claim 85, wherein the B cell lymphoma is a non-Hodgkin lymphoma.
87. The method of claim 86, wherein the non-Hodgkin lymphoma is Burkitt lymphoma, chronic lymphocytic leukemia (CLL), diffuse large B-cell lymphoma, follicular lymphoma, or mantle cell lymphoma.
88. The method of any one of claims 81-87, wherein the immune cell or the composition is administered intravenously.
89. The method of any one of claims 81-87, wherein the immune cell or the composition is administered subcutaneously.
90. An antibody comprising: (i) a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 of any one of the antibodies listed in Table 1; (ii) a VH and / or a VL of any one of the antibodies listed in Table 1; or (iii) a heavy chain and / or a light chain of any one of the antibodies listed in Table 1.
91. An antibody comprising a HC CDR3 comprising the amino acid sequence of ARELTGDAFDX7(SEQ ID NO: 35), wherein X7is I or L.
92. The antibody of claim 91, wherein the antibody further comprises a HC CDR1 comprising the amino acid sequence of GFX1FX2X3YG (SEQ ID NO: 33), wherein X1 is T or I, X2 is S or R, and X3 is S or N, and / or a HC CDR2 comprising the amino acid sequence of IYYDGX4X5X6(SEQ ID NO: 34), wherein X4is N or S, X5is K or N, and X6is K or N.
93. The antibody of claim 91 or 92, wherein the antibody further comprises a LC CDR1comprising the amino acid sequence of QX8IGSX9 (SEQ ID NO: 36), wherein X8 is S or R, and X9 is S or H, a LC CDR2 comprising the amino acid sequence of YAS, and / or a LC CDR3 comprising the amino acid sequence of HQSSX10EPYT (SEQ ID NO: 38), wherein X10 is T, R, or S.
94. An antibody comprising a HC CDR1 comprising the amino acid sequence of GFX1FX2X3YG (SEQ ID NO: 33), wherein X1 is T or I, X2 is S or R, and X3 is S or N, a HC CDR2 comprising the amino acid sequence of IYYDGX4X5X6(SEQ ID NO: 34), wherein X4is N or S, X5is K or N, and X6is K or N, a HC CDR3 comprising the amino acid sequence of ARELTGDAFDX7 (SEQ ID NO: 35), wherein X7 is I or L, a LC CDR1 comprising the amino acid sequence of QX8IGSX9(SEQ ID NO: 36), wherein X8is S or R,and X9is S or H,a LC CDR2 comprising the amino acid sequence of YAS, and / or a LC CDR3 comprising the amino acid sequence of HQSSX10EPYT (SEQ ID NO: 38), wherein X10 is T, R, or S.